Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0338_q5.pkl
Database        : spombe  (5049 sequences; 2391832 residues)
Timestamp       : 25 Sep 2006 at 08:24:38 GMT
Significant hits: mSPAC19B12.02C  |predicted|: Predicted GPI protein : SIM. TO S. CEREVISIAE GAS1
                  SPAC1705.03c    ||SPAC23H4.19|involved in cell wall biosynthesis |Schizosaccharomyces pombe|chr 1|||Manual
                  SPAC11E3.13c    |||GPI anchored protein |Schizosaccharomyces pombe|chr 1|||Manual
                  SPAC23A1.10     |ef1a-b||translation elongation factor |Schizosaccharomyces pombe|chr 1|||Manual
                  mPSU1           |predicted|: Predicted GPI protein : CELL WALL SYNTHESIS PROTEIN
                  SPAC13G6.10c    |||serine-rich protein|Schizosaccharomyces pombe|chr 1|||Manual
                  SPBC14F5.04c    |pgk1||phosphoglycerate kinase|Schizosaccharomyces pombe|chr 2|||Manual
                  SPBC32F12.11    |tdh1|gpd1|glyceraldehyde 3-phosphate dehydrogenase|Schizosaccharomyces pombe|chr 2|||Manual
                  mSPCC1322.10    |predicted|: Predicted GPI protein

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 29 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mSPAC19B12.02C                    Mass: 57007    Score: 189    Queries matched: 4
 |predicted|: Predicted GPI protein : SIM. TO S. CEREVISIAE GAS1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   526.84   1051.67   1051.54   0.13 0  53  0.00025 1  -.SVSPVHVDGR.Y
20   826.02   1650.04   1649.84   0.19 0  53  0.00022 1  R.DVPYFQELSVNAIR.V
21   854.52   1707.03   1706.81   0.21 0  55  0.00014 1  R.QIPVGYSTNDEEVTR.D
30   1072.28   3213.82   3213.40   0.42 0  27  0.055 1  K.GIAYQPNVDDSDTEGTLFVDPLSDGDACSR.D

2.    SPAC1705.03c                      Mass: 43547    Score: 172    Queries matched: 4
 ||SPAC23H4.19|involved in cell wall biosynthesis |Schizosaccharomyces pombe|chr 1|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   409.79   817.56   817.45   0.11 0  49  0.001 1  K.GALTVETK.A
2   419.28   836.54   836.44   0.11 0  42  0.0036 1  K.GVSVNFSK.L
28   856.53   2566.57   2566.26   0.31 0  81  2.7e-007 1  R.YIQEITMEGLESAQNIQISANSK.G
29   1284.31   2566.61   2566.26   0.35 0  (8) 5.5 1  R.YIQEITMEGLESAQNIQISANSK.G

 
      Proteins matching the same set of peptides:
      mSPAC1705.03C                     Mass: 41468    Score: 172    Queries matched: 4
 |predicted|: Predicted GPI protein : Ecm33 family
3.    SPAC11E3.13c                      Mass: 54058    Score: 150    Queries matched: 3
 |||GPI anchored protein |Schizosaccharomyces pombe|chr 1|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
14   686.38   1370.75   1370.59   0.17 0  20  0.6 1  K.GNAFFNSDTNER.F
17   788.50   1574.98   1574.79   0.19 0  82  3e-007 1  R.DIPVGYSAADVAEIR.V
27   1190.73   2379.45   2379.13   0.33 0  48  0.00067 1  R.GVDYQPGGSSTLVDPLADTSICK.R

 
      Proteins matching the same set of peptides:
      mSPAC11E3.13C                     Mass: 51689    Score: 150    Queries matched: 3
 |predicted|: Predicted GPI protein : Gas1 homology
4.    SPAC23A1.10                       Mass: 50099    Score: 125    Queries matched: 3
 |ef1a-b||translation elongation factor |Schizosaccharomyces pombe|chr 1|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   513.37   1024.73   1024.60   0.12 0  52  0.00028 1  K.IGGIGTVPVGR.V
9   560.87   1119.73   1119.59   0.14 0  37  0.011 1  K.STTTGHLIYK.C
13   671.44   1340.86   1340.68   0.18 0  39  0.0072 1  K.YNVTVIDAPGHR.D

 
      Proteins matching the same set of peptides:
      SPCC794.09c                       Mass: 50085    Score: 125    Queries matched: 3
 |ef1a-a||translation elongation factor 1 |Schizosaccharomyces pombe|chr 3|||Manual
      SPBC839.15c                       Mass: 50099    Score: 125    Queries matched: 3
 |ef1a-c||translation elongation factor |Schizosaccharomyces pombe|chr 2|||Manual
5.    mPSU1                             Mass: 40375    Score: 109    Queries matched: 2
 |predicted|: Predicted GPI protein : CELL WALL SYNTHESIS PROTEIN
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   565.85   1129.69   1129.54   0.15 0  55  0.00019 1  K.GTSAQYYVNK.A
18   795.46   1588.90   1588.71   0.19 0  54  0.00018 1  K.TQWPSTQPSDGETR.G

 
      Proteins matching the same set of peptides:
      SPAC1002.13c                      Mass: 42295    Score: 109    Queries matched: 2
 |psu1||beta-glucosidase |Schizosaccharomyces pombe|chr 1|||Manual
6.    SPAC13G6.10c                      Mass: 54406    Score: 100    Queries matched: 2
 |||serine-rich protein|Schizosaccharomyces pombe|chr 1|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   946.09   1890.17   1889.93   0.24 0  61  3.5e-005 1  K.TLMTSALGFLDGHGSVER.Y
24   1034.14   2066.27   2066.01   0.26 0  39  0.0054 1  R.GLAWIPGTDLGYSDNFVNK.G

 
      Proteins matching the same set of peptides:
      mSPAC13G6.10c                     Mass: 52568    Score: 100    Queries matched: 2
 |predicted| probably mild-alkali sensitive
7.    SPBC14F5.04c                      Mass: 44278    Score: 53     Queries matched: 2
 |pgk1||phosphoglycerate kinase|Schizosaccharomyces pombe|chr 2|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   606.93   1211.84   1211.69   0.15 0  33  0.026 1  K.GGEVILLENLR.F
12   619.87   1237.73   1237.58   0.15 0  20  0.46 1  K.IGDSLFDEAGSK.N

8.    SPBC32F12.11                      Mass: 36018    Score: 49     Queries matched: 1
 |tdh1|gpd1|glyceraldehyde 3-phosphate dehydrogenase|Schizosaccharomyces pombe|chr 2|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   735.00   1467.99   1467.82   0.18 0  49  0.00061 1  R.VPTPDVSVVDLTVK.L

 
      Proteins matching the same set of peptides:
      SPBC354.12                        Mass: 35823    Score: 49     Queries matched: 1
 |gpd3||glyceraldehyde 3-phosphate dehydrogenase|Schizosaccharomyces pombe|chr 2|||Manual
9.    mSPCC1322.10                      Mass: 23944    Score: 38     Queries matched: 1
 |predicted|: Predicted GPI protein
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   423.79   845.56   845.46   0.10 0  38  0.011 1  -.VSVTSPTR.D

10.   SPCC757.12                        Mass: 68387    Score: 29     Queries matched: 1
 |||glycosyl hydrolase family 13|Schizosaccharomyces pombe|chr 3|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   721.46   1440.90   1440.72   0.18 0  29  0.066 1  R.NYLDSITSYPIR.Q

 
      Proteins matching the same set of peptides:
      mSPCC757.12                       Mass: 66075    Score: 29     Queries matched: 1
 |predicted|: Predicted GPI protein : PUTATIVE ALPHA-AMYLASE
11.   SPAC926.02                        Mass: 51730    Score: 18     Queries matched: 2
 |||hypothetical protein|Schizosaccharomyces pombe|chr 1|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 24   1034.14   2066.27   2067.11   -0.84 1  5  12 3  R.ADLEIQRAAIPIMVAQNSK.L
26   778.18   2331.52   2331.15   0.37 2  12  2.4 1  R.FNKARLLLNMATNCDMLYK.D + Oxidation (M)

12.   SPBC3D6.12                        Score: 17     Queries matched: 1
 |||WD repeat protein|Schizosaccharomyces pombe|chr 2|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 1   409.79   817.56   817.45   0.11 0  20  0.81 2  K.QTIESLK.D

13.   SPBC14C8.14c                      Score: 17     Queries matched: 1
 |pol5||DNA polymerase V|Schizosaccharomyces pombe|chr 2|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 1   409.79   817.56   817.43   0.13 1  17  1.7 3  K.KNAQETK.Q

14.   SPBC32H8.13c                      Score: 16     Queries matched: 1
 |mok12||alpha-1,3-glucan synthase|Schizosaccharomyces pombe|chr 2|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   423.79   845.56   847.43   -1.87 0  16  2.1 2  K.TVSTPSEK.L

15.   SPCC4B3.10c                       Score: 15     Queries matched: 1
 |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizosaccharomyces pombe|chr 3|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 1   409.79   817.56   817.47   0.09 1  15  2.4 4  K.KAVEMIK.R

16.   SPAC1486.04c                      Mass: 198253   Score: 13     Queries matched: 1
 |alm1||coiled-coil |Schizosaccharomyces pombe|chr 1|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   419.28   836.54   838.54   -1.99 1  16  1.5 2  K.QRIPVVK.Q

17.   SPCC1739.11c                      Mass: 118898   Score: 13     Queries matched: 1
 |cdc11||SIN component|Schizosaccharomyces pombe|chr 3|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   435.83   869.64   871.37   -1.73 0  13  2.7 1  R.QAYMTDK.M + Oxidation (M)

18.   SPAPB2B4.03                       Mass: 47732    Score: 13     Queries matched: 1
 |cig2|cyc17|cyclin|Schizosaccharomyces pombe|chr 1|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   419.28   836.54   836.42   0.13 1  13  2.7 3  R.RSCSLSK.F

19.   SPBC354.08c                       Score: 13     Queries matched: 1
 |||DUF221|Schizosaccharomyces pombe|chr 2|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   419.28   836.54   838.44   -1.90 1  13  2.7 4  K.KHDNAVR.S

20.   SPBC3E7.10                        Score: 12     Queries matched: 1
 |||methionine aminopeptidase |Schizosaccharomyces pombe|chr 2|||Manual
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 1   409.79   817.56   817.52   0.04 1  14  2.8 5  R.KVPPHIK.R

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
25   1112.19   2222.37   2223.03   -0.66 1  11  3.7 1  EPMTIPNLTDNERVEMYR + Oxidation (M)
3   421.81   841.61   842.41   -0.81 0  7  13 1  LEEEAPR
6   447.80   893.58   892.48   1.11 1  7  11 1  AKGNAAFSK
19   815.55   1629.09   1627.89   1.20 2  6  12 1  RAGPNYQEGLRVIR
31   1317.03   3948.08   3948.17   -0.09 2  0  20 1  VGPAIPLENYEAALRAILTGKASPVETASFLASLHLTK
22   920.05   1838.09        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 2 Da
Fragment Mass Tolerance: ± 0.8 Da
Max Missed Cleavages   : 2
Instrument type        : ESI-QUAD-TOF
Number of queries      : 31

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 48.7    0.11    2  SPAC1705.03c K.GALTVETK.A
 19.7    0.11   12  SPBC3D6.12   K.QTIESLK.D
 16.6    0.13   13  SPBC14C8.14c K.KNAQETK.Q
 14.9    0.09   15  SPCC4B3.10c  K.KAVEMIK.R
 14.4    0.04   20  SPBC3E7.10   R.KVPPHIK.R
 10.4    0.08                    K.KLITMGR.G
  9.7    0.09                    R.QIFPVSK.L
  9.4    0.09                    R.QLKSQSK.N
  8.4   -0.82                    K.NNDVTEK.I
  8.3    0.15                    K.QTFTGHK.D
Top scoring peptide matches to query 2
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 41.6    0.11    2  SPAC1705.03c K.GVSVNFSK.L
 15.6   -1.99   16  SPAC1486.04c K.QRIPVVK.Q
 13.0    0.13   18  SPAPB2B4.03  R.RSCSLSK.F
 12.9   -1.90   19  SPBC354.08c  K.KHDNAVR.S
 10.6    0.09                    K.SRVNSFK.D
 10.2    1.14                    K.KSDFDPK.A
  9.8    0.13                    K.RCLSSSK.Y
  9.0   -1.92                    K.QEAHKVK.K
  8.1   -1.86                    R.HNENVAR.A
  7.6    0.07                    K.QSKLFSK.G
Top scoring peptide matches to query 3
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.7   -0.81        K.LEEEAPR.E
  5.1    0.11        K.GMRLLPR.L
  4.2   -1.80        R.TGVDEPAR.Q
  3.7   -0.89        K.SALLLNGR.M
  2.7    0.07        K.ISALGLLR.L
  2.3   -0.80        K.GVYDHPR.N
  2.1   -0.86        K.SSPVAVQR.V
  2.0   -1.86        K.EAAIELAK.F
  0.4    0.10        K.EKSLIPR.R
  0.3    0.14        R.ENTLLPR.L
Top scoring peptide matches to query 4
Score greater than 30 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 38.2    0.10    9  mSPCC1322.10 -.VSVTSPTR.D
 15.6   -1.87   14  SPBC32H8.13c K.TVSTPSEK.L
 12.9    0.13                    K.VSWTPEK.F
  7.3    0.06                    R.VSNKLTGK.D
  6.6    0.16                    K.WVGEAER.Q
  6.2    0.09                    R.VSDTRLR.L
  5.8    0.13                    M.GEVERTR.Q
  4.4    0.08                    M.VKMDVVR.T
  4.3    1.09                    K.GKTVEVGR.A
  3.3    0.16                    R.WGEIDAR.F
Top scoring peptide matches to query 5
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 13.0   -1.73   17  SPCC1739.11c R.QAYMTDK.M
 11.1   -0.95                    R.KLLLKEK.G
 11.1   -0.92                    K.QLLIRTK.E
  9.2   -0.92                    K.KAIGNIKK.F
  9.2   -0.81                    K.KANPANEK.S
  9.1   -1.80                    K.EASPVNQK.L
  9.1   -0.86                    K.AGIIRDAR.I
  7.8   -0.90                    R.KAGKAVAAR.M
  6.6   -0.87                    K.KEPEIKK.Q
  6.6   -0.87                    K.KIVTDPAK.L
Top scoring peptide matches to query 6
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.6    1.11        K.AKGNAAFSK.K
  4.4    1.12        K.QENIYVK.H
  3.4    1.07        R.IVGYARSK.I
  2.6   -0.86        R.GAGGQHVNR.T
  2.6    0.03        R.IRRAPPGK.L
  0.8    1.16        K.QDSLSSTR.N
  0.4   -1.86        R.DGVFPFSK.Y
Top scoring peptide matches to query 7
Score greater than 26 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 52.0    0.12    4  SPAC23A1.10 K.IGGIGTVPVGR.V
 10.0   -1.88                   K.QVTVKEVPK.K
  7.1   -0.90                   K.LNGLDLLIR.Q
  5.4   -1.79                   K.KALDFYDR.A
  4.7    0.17                   K.SVGPWAPRR.V
  2.3   -0.86                   R.GLGTITTVHK.K
  2.1   -1.87                   K.KQQAANVLR.G
  1.2   -0.77                   K.IVGWCTYK.L
  0.8    0.17                   K.ILLDYFNK.W
  0.6   -1.92                   K.WRLAVRVK.V
Top scoring peptide matches to query 8
Score greater than 28 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein        Peptide
 53.0    0.13    1  mSPAC19B12.02C -.SVSPVHVDGR.Y
 11.8    0.21                      K.EGSAWYDPK.N
  9.5   -1.95                      K.ISKKGAPPEK.A
  8.1   -0.74                      R.WSSASTNDAD.-
  3.0    0.14                      K.KYEDVSVGR.S
  0.8   -1.96                      K.GNVPIKTAVR.S
  0.5    1.14                      R.GQFPSNFVR.E
Top scoring peptide matches to query 9
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 37.1    0.14    4  SPAC23A1.10 K.STTTGHLIYK.C
  4.4    1.06                   K.KMTEIILKK.H
  4.1   -0.83                   K.SIAVDGMGFPK.D
  3.8   -0.79                   K.DITAETNTEK.L
  2.9    0.09                   K.RNLGIGSLYK.E
  2.0    0.13                   -.MSVGKAKGAQK.T
  1.6    0.08                   K.LVISPSTIYK.I
  1.2    0.16                   K.AATFLDFHAK.N
  1.1   -0.89                   K.FQQLTKAASK.F
  1.0    0.13                   K.TSTILACARK.I
Top scoring peptide matches to query 10
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 55.0    0.15    5  mPSU1 K.GTSAQYYVNK.A
 12.2    1.03             R.VGAAKKISNNK.A
  9.2    1.05             R.KVAAVSGDARR.A
  8.6    1.03             K.RKAALISENK.A
  6.7    0.15             K.GTNTAYSAFAK.R
  4.6    0.17             R.DEAEAPHHPK.G
  3.9    1.03             K.RSTVAQLVQK.L
  3.4   -0.92             K.QKREESLNK.R
  2.2    1.09             R.NLHGISYTPK.K
  0.5   -1.92             K.SVIALQCVSR.S
Top scoring peptide matches to query 11
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 33.2    0.15    7  SPBC14F5.04c K.GGEVILLENLR.F
  7.9    1.18                    K.ARNIRNPSQR.L
  3.6   -0.77                    R.DNLNPIEDKR.V
  3.5    1.26                    -.MPSNHNTSVPK.F
  3.2    0.15                    R.VVKIGMLPDPK.S
  3.1   -1.86                    R.INDLELITKR.N
  2.3   -1.80                    K.IPSECGLLTPK.E
  1.6    1.02                    K.FLILRLLVPK.L
  1.6   -1.80                    R.GPSTKDQVINR.T
  1.4   -0.82                    K.RSSISVAAHSAK.I
Top scoring peptide matches to query 12
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 20.1    0.15    7  SPBC14F5.04c K.IGDSLFDEAGSK.N
Top scoring peptide matches to query 13
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 38.9    0.18    4  SPAC23A1.10 K.YNVTVIDAPGHR.D
  0.1   -1.84                   R.HGGIDVDLFSKR.L
  0.1    1.05                   K.LKGKPQLVKSDK.G
Top scoring peptide matches to query 14
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 19.6    0.17    3  SPAC11E3.13c K.GNAFFNSDTNER.F
  3.9    1.12                    R.QLNDNTWHSQK.A
  2.5   -0.98                    R.SGVTPLLESARDK.A
Top scoring peptide matches to query 15
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 28.8    0.18   10  SPCC757.12 R.NYLDSITSYPIR.Q
  8.1    1.08                  R.IYIKSTHVPVQR.N
  2.6    0.22                  R.LNYNEFYVSHR.R
Top scoring peptide matches to query 16
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 49.4    0.18    8  SPBC32F12.11 R.VPTPDVSVVDLTVK.L
  4.9    1.21                    K.YERFIRPMALR.Q
  2.5    1.26                    K.MAGHMGHRSRTVK.N
  2.4   -0.88                    K.LAIVTNQRNTLVK.R
  0.6    1.33                    K.SFHMRDAPSFEK.V
Top scoring peptide matches to query 17
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 82.4    0.19    3  SPAC11E3.13c R.DIPVGYSAADVAEIR.V
  9.5   -1.87                    R.ETYQTDVLLVAIGR.V
  5.4    1.23                    K.ETEKVEESELEPR.Y
  0.1    0.21                    K.NCIQMKIPASNQR.K
Top scoring peptide matches to query 18
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 54.4    0.19    5  mPSU1 K.TQWPSTQPSDGETR.G
  5.0   -1.91             K.ASFFDIGGHSILATR.L
  1.6   -1.87             K.DSSKPTEDQESKLK.V
  0.2   -1.91             K.KSKDELWCLISGR.I
  0.0   -0.03             M.AVSLNDFISVKLKR.Y
Top scoring peptide matches to query 19
Score greater than 19 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3    1.20        R.RAGPNYQEGLRVIR.E
  6.2    1.23        R.AVGGMLPRNKLWDR.R
Top scoring peptide matches to query 20
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein        Peptide
 53.3    0.19    1  mSPAC19B12.02C R.DVPYFQELSVNAIR.V
  1.1    0.22                      K.DEDVSLLMEKNTLK.I
  0.2    1.23                      K.LVLEFFGHADTNMR.Y
  0.1    1.14                      R.METLLALFDAKNKR.N
Top scoring peptide matches to query 21
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein        Peptide
 55.3    0.21    1  mSPAC19B12.02C R.QIPVGYSTNDEEVTR.D
  1.5   -1.86                      K.KLHSSFPSTQQQPPK.T
  1.4   -0.96                      K.NKDIPEGGAKGVILLGK.D
  1.4   -1.76                      R.GADLYVQIDMHEYR.K
  0.6    0.09                      K.GALLVMPDYLELFVK.E
Top scoring peptide matches to query 22
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 23
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 61.4    0.24    6  SPAC13G6.10c K.TLMTSALGFLDGHGSVER.Y
Top scoring peptide matches to query 24
Score greater than 25 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 38.8    0.26    6  SPAC13G6.10c R.GLAWIPGTDLGYSDNFVNK.G
 10.2   -0.78                    R.VSQILERVRDGAHSMPEK.Q
  5.4   -0.84   11  SPAC926.02   R.ADLEIQRAAIPIMVAQNSK.L
  4.9   -0.84                    K.DITVNAHPNQPSRPRLPR.V
  4.6   -0.84                    K.KLDAINRLSNIIYYSER.V
  4.5   -1.89                    R.TLQSLSCARIRPLVMVPK.S
  4.5    1.22                    R.LGQKISLPIMWCSVFDR.S
  3.5   -1.92                    R.ASLLTGVDTLARAVSVTLGPK.G
  2.5   -0.86                    K.LVAKLLRNGADPAMLNGNGK.T
  2.4    0.25                    R.GWLAEGGTLIGTARCMAFR.E
Top scoring peptide matches to query 25
Score greater than 23 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.6   -0.66        R.EPMTIPNLTDNERVEMYR.R
 10.6   -0.70        K.LEFEFDSNDYFTNKILTK.T
Top scoring peptide matches to query 26
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 12.4    0.37   11  SPAC926.02 R.FNKARLLLNMATNCDMLYK.D
  4.4   -0.66                  K.SMPLPGMKDVGVPFDDAKGIVK.N
  3.4    1.35                  M.SEMEKQVENLSLEAKNEKPK.E
  3.2   -0.67                  -.MTTTSIDPPVYATVDVIREPK.A
  3.1    1.38                  K.IEFLTHYGSEFYCPVSLLR.V
  2.4    1.24                  K.LSRATPFAMVNSMLTLKPLPK.L
  2.4   -0.71                  -.MAVASSTVPSKEQIFAPESLLK.K
  1.5   -0.61                  R.SSLPQGPLSPFYVKMEHQCK.V
  1.4    1.44                  K.WDPDELVFEGLYAYDTKNR.I
  1.2   -0.81                  R.TAAVLPNNLPHLQHLVKKDPK.S
Top scoring peptide matches to query 27
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 47.7    0.33    3  SPAC11E3.13c R.GVDYQPGGSSTLVDPLADTSICK.R
  2.3    0.23                    M.ASLDIHLYVKKDLTYGECVR.V
  1.7    1.23                    K.AVFDELCSLVDPKVDAFTPKK.G
  1.5    0.37                    R.VSPPPGFCYDVHPHNNIACAK.C
  0.6    0.37                    R.VRFCFSASHNKADMDYFLR.A
  0.1   -1.79                    R.DRYQGIPFMALTATANEIVKK.D
Top scoring peptide matches to query 28
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 81.2    0.31    2  SPAC1705.03c R.YIQEITMEGLESAQNIQISANSK.G
Top scoring peptide matches to query 29
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  8.1    0.35    2  SPAC1705.03c R.YIQEITMEGLESAQNIQISANSK.G
  4.0    1.36                    R.MEQFQELLMRALWESLNQQR.W
  2.1   -0.68                    K.VYVPSYRSGAYSILCALYMLNK.H
  1.1   -1.72                    R.QRLVDTFNDPEKDAFVFLLSSK.A
  1.1   -0.55                    K.VIGMLMGIDINMNAGEGAAEEQEK.K
  0.6   -1.75                    R.FLTVSDASDLKIGEIELLLSDYK.R
  0.4   -1.61                    R.WKDRIISLCGHGFCYQCIQK.R
Top scoring peptide matches to query 30
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein        Peptide
 27.5    0.42    1  mSPAC19B12.02C K.GIAYQPNVDDSDTEGTLFVDPLSDGDACSR.D
Top scoring peptide matches to query 31
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2   -0.09        K.VGPAIPLENYEAALRAILTGKASPVETASFLASLHLTK.A