Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0210_q5.pkl
Database        : Cglabrata 041110dos (5427 sequences; 2703904 residues)
Timestamp       : 19 Aug 2005 at 12:00:48 GMT
Significant hits: CAGL0F07579g  similar to sp|P28319 Saccharomyces cerevisiae YKL096w CWP1 cell wall mannoprotein, start by similar
                  CAGL0G00308g  similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
                  CAGL0I06160g  highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
                  CAGL0A03168g  highly similar to sp|P02400 Saccharomyces cerevisiae YDR382w RPLA4, start by similarity [Candida gl

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 25 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    CAGL0F07579g                      Mass: 20710    Score: 233    Queries matched: 5
 similar to sp|P28319 Saccharomyces cerevisiae YKL096w CWP1 cell wall mannoprotein, start by similar
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
57   979.49   1956.96   1956.98   -0.02 1  85  5.7e-008 1  K.LKFSDNTYAVVNSDGSIK.T
64   1058.47   2114.93   2114.98   -0.05 0  148  2.6e-014 1  K.TGSESEGTSGFALSGSHLTYK.G
65   1058.47   2114.93   2114.98   -0.04 0  (117) 3e-011 1  K.TGSESEGTSGFALSGSHLTYK.G
66   1058.48   2114.95   2114.98   -0.03 0  (99) 2e-009 1  K.TGSESEGTSGFALSGSHLTYK.G
67   705.99   2114.95   2114.98   -0.03 0  (147) 3.4e-014 1  K.TGSESEGTSGFALSGSHLTYK.G

 
      Proteins matching the same set of peptides:
      CAGL0F07601g                      Mass: 21335    Score: 233    Queries matched: 5
 similar to sp|P28319 Saccharomyces cerevisiae YKL096w CWP1 cell wall mannoprotein, start by similar
      mCwp1.1                           Mass: 19256    Score: 233    Queries matched: 5
 |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
      mCwp1.2                           Mass: 18631    Score: 233    Queries matched: 5
 |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1

2.    CAGL0G00308g                      Mass: 39767    Score: 107    Queries matched: 3
 similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   528.81   1055.60   1055.60   0.00 0  21  0.27 1  K.GQTLGVAVPSK.Q
12   578.83   1155.64   1155.62   0.01 0  64  1.2e-005 1  K.KPDTQVGGAGVK.G
56   650.35   1948.03   1947.99   0.04 0  22  0.12 1  K.DASAVASDLAALSQYPTIR.L

 
      Proteins matching the same set of peptides:
      mCAGL0G00308g                     Mass: 38048    Score: 107    Queries matched: 3
 |predicted| 357aa Similar to P53334 S. cerevisiae YGR279c SCW4 CAGL0G00308g|CAGL-IPF3933|CAGL-CDS29
3.    CAGL0I06160g                      Mass: 24169    Score: 100    Queries matched: 1
 highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
63   1023.47   2044.93   2044.98   -0.05 0  100  1.6e-009 1  K.IAEQCSPINLEVVSLVDC.-

 
      Proteins matching the same set of peptides:
      mPir4p.1                          Mass: 22496    Score: 100    Queries matched: 1
 |predicted-NN| 216aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|C
      mPir4p.2                          Mass: 22425    Score: 100    Queries matched: 1
 |predicted-HMM| 215aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|
4.    CAGL0A03168g                      Mass: 10954    Score: 41     Queries matched: 1
 highly similar to sp|P02400 Saccharomyces cerevisiae YDR382w RPLA4, start by similarity [Candida gl
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   593.84   1185.66   1185.66   -0.00 0  41  0.0028 1  R.INELLSALEGK.S

5.    CAGL0M10153g                      Mass: 97227    Score: 13     Queries matched: 1
 some similarities with sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr protein kinase of the phe
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   535.80   1069.58   1069.61   -0.03 0  15  0.85 1  K.NEVNQLILK.E

6.    CAGL0M06281g                      Mass: 60396    Score: 11     Queries matched: 1
 similar to sp|P38125 Saccharomyces cerevisiae YBR180w DTR1, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   523.81   1045.60   1045.66   -0.06 1  11  3.2 1  K.KIGSLIFLR.I

7.    CAGL0I03256g                      Score: 11     Queries matched: 1
 similar to sp|P47110 Saccharomyces cerevisiae YJR043c POL32 polymerase-associated gene, start by similarity [Candida glabrata] Complete CDS. CAGL0I03256g|CAGL-IPF7351|CAGL-CDS3056.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   528.81   1055.60   1055.53   0.07 0  11  2.7 2  K.QGTIESFFK.R

8.    CAGL0K09790g                      Score: 10     Queries matched: 1
 similar to sp|P17555 Saccharomyces cerevisiae YNL138w SRV2 adenylate cyclase-associated protein, start by similarity [Candida glabrata] Complete CDS. CAGL0K09790g|CAGL-IPF3178|CAGL-CDS1933.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   535.80   1069.58   1069.55   0.03 1  10  3.3 2  K.VDKSQQTHK.N

9.    CAGL0F00913g                      Score: 9      Queries matched: 1
 similar to sp|P31374 Saccharomyces cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces cerevisiae YOL045w, start by similarity [Candida glabrata] Complete CDS. CAGL0F00913g|CAGL-IPF3752|CAGL-CDS0236.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   523.81   1045.60   1046.54   -0.93 0  9  4.9 2  K.QSVAISNSNK.E

10.   CAGL0H08888g                      Score: 9      Queries matched: 1
 similar to tr|Q08967 Saccharomyces cerevisiae YPL221w BOP1, hypothetical start [Candida glabrata] Complete CDS. CAGL0H08888g|CAGL-IPF115|CAGL-CDS0794.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   535.80   1069.58   1069.64   -0.06 1  9  3.6 3  R.QNWRLILK.G

11.   CAGL0F08679g                      Mass: 46532    Score: 8      Queries matched: 1
 highly similar to sp|P41896 Saccharomyces cerevisiae YGR005c TFG2, hypothetical start [Candida glab
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   812.88   1623.74   1624.82   -1.08 1  8  2.9 1  K.VYEESLDLDLSKSK.R

12.   CAGL0D02552g                      Score: 8      Queries matched: 1
 similar to sp|P42834 Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein - chaperone, start by similarity [Candida glabrata] Complete CDS. CAGL0D02552g|CAGL-IPF4866|CAGL-CDS4906.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 15   593.84   1185.66   1185.66   -0.00 1  10  3.2 2  K.INEAKELLEK.S

13.   CAGL0M05181g                      Mass: 47907    Score: 8      Queries matched: 1
 similar to sp|Q02554 Saccharomyces cerevisiae YMR240c CUS1U2 snRNP protein, start by similarity [Ca
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   640.83   1279.65   1279.68   -0.03 1  8  4.2 1  R.DYLSGRSLLEK.K

14.   CAGL0M00594g                      Score: 8      Queries matched: 1
 similar to sp|P46974 Saccharomyces cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces cerevisiae YML081w, hypothetical start [Candida glabrata] Complete CDS. CAGL0M00594g|CAGL-IPF5429|CAGL-CDS0420.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   578.83   1155.64   1155.59   0.04 1  8  5.3 2  K.KYSEFAGVQK.H

15.   CAGL0I00660g                      Score: 7      Queries matched: 1
 highly similar to sp|P46943 Saccharomyces cerevisiae YLR289w GUF1, start by similarity [Candida glabrata] Complete CDS. CAGL0I00660g|CAGL-IPF2014|CAGL-CDS1247.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   535.80   1069.58   1069.57   0.01 1  7  5.3 4  K.VLCAHTNKK.Y

16.   CAGL0J03124g                      Mass: 96722    Score: 7      Queries matched: 2
 highly similar to sp|Q01217 Saccharomyces cerevisiae YER069w ARG5, hypothetical start [Candida glab
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 8   551.80   1101.58   1101.54   0.04 0  3  21 2  K.GGIINGETGER.I
35   733.90   1465.78   1465.75   0.03 0  5  9.2 1  R.TPPKPEATNTSPAR.V

17.   CAGL0B02101g                      Score: 7      Queries matched: 2
 similar to sp|P50079 Saccharomyces cerevisiae YGR223c, start by similarity [Candida glabrata] Complete CDS. CAGL0B02101g|CAGL-IPF5217|CAGL-CDS2444.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   564.30   1126.58   1125.55   1.03 0  1  30 4  K.TAPFGPFDFK.V
 30   680.32   1358.63   1358.74   -0.11 1  7  6.6 2  K.VVTIEGKATDQAK.V

18.   CAGL0H03553g                      Mass: 57537    Score: 7      Queries matched: 1
 highly similar to sp|P29295 Saccharomyces cerevisiae YPL204w HRR25, start by similarity [Candida gl
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
30   680.32   1358.63   1358.72   -0.09 0  7  5.8 1  R.GSTVHVIDFGLSK.K

19.   CAGL0E04950g                      Score: 7      Queries matched: 1
 similar to sp|P53118 Saccharomyces cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae YDL109c, hypothetical start [Candida glabrata] Complete CDS. CAGL0E04950g|CAGL-IPF4996|CAGL-CDS1181.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   578.83   1155.64   1156.61   -0.98 1  7  6.7 3  K.FPESDPKIPK.V

20.   CAGL0J10626g                      Score: 7      Queries matched: 1
 similar to sp|P38799 Saccharomyces cerevisiae YHR078w, start by similarity [Candida glabrata] Complete CDS. CAGL0J10626g|CAGL-IPF2845|CAGL-CDS1869.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   578.83   1155.64   1155.69   -0.05 0  7  6.9 4  R.NIIENISILK.K

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   581.31   1160.60   1160.55   0.05 0  8  5.1 1  TITGFMNYSK
22   636.31   1270.61   1271.62   -1.01 1  7  6.4 1  DPKDPVGAVSCK
11   567.80   1133.59   1134.49   -0.90 0  7  7.7 1  VDCDVEDGVK
8   551.80   1101.58   1101.56   0.02 0  6  9.2 1  GNIGLMVNER
28   674.82   1347.62   1347.68   -0.06 1  6  7.3 1  LLDGVADGSMRSK
34   727.88   1453.74   1453.71   0.03 1  6  7.4 1  YVNIMPYERNR
47   584.62   1750.83   1752.01   -1.19 1  6  5.6 1  GPGAVISLQTGSIPISKK
43   549.61   1645.80   1645.85   -0.05 1  6  6.8 1  ATGAECIPLKMNLTK
84   816.09   2445.26   2445.27   -0.01 1  5  3.1 1  YVLDFGQFQHGQPVDKDIVLK
14   588.32   1174.62   1173.62   1.00 0  5  9.9 1  AAMLYGPPGIGK
70   1086.98   2171.95   2172.04   -0.10 0  5  4.5 1  LAIYELMTEESAVNFWEK
49   907.43   1812.85   1812.87   -0.02 0  5  6.8 1  QLAGNEMLTYFAVDNK
40   801.92   1601.83   1601.84   -0.01 1  5  8.1 1  DITAVNDNKIASVSR
116   1144.84   3431.50   3431.75   -0.25 1  5  2.1 1  MLHTQRPSSPQKTQSSSLLPPVSSDINGTNPK
25   663.33   1324.64   1323.75   0.89 1  4  9.9 1  NLIEVGADPRIK
110   1074.51   3220.52   3220.53   -0.02 1  4  3 1  ENISGYKPGLNMVYNENGKGSSLTTFDTGK
61   1006.50   2010.99   2012.09   -1.10 1  3  8.3 1  AVETGVVELEITGNRNAIK
4   528.79   1055.57   1055.52   0.04 0  3  17 1  SLADNPASPGK
7   547.83   1093.65   1093.60   0.05 1  3  17 1  VSYELDKLK
68   710.02   2127.03   2127.08   -0.05 1  3  9.1 1  EYIVNCPLSPIQTKFYR
51   920.95   1839.88   1840.90   -1.02 0  2  12 1  SPGTPQENTAAPCGIITK
10   564.30   1126.58   1127.59   -1.02 0  2  21 1  QDVLNGIQNK
87   841.40   2521.19   2520.28   0.91 1  2  7.1 1  SLNPEDISGLNKELIELQMYSK
77   1139.44   2276.87   2277.08   -0.21 1  2  5.9 1  GNLDTYGFCDDVWTFIVKK
9   555.26   1108.51   1107.57   0.93 1  2  20 1  ACSGKFTPLK
21   631.32   1260.63   1261.67   -1.04 1  2  21 1  DLKSADIMTLR
129   1366.14   5460.54   5459.85   0.68 1  2  1 1  WSIYVLLISLISRVLSATDGSFVISDPTYVYNGDINVPDAGYILNTGGIAK
73   756.00   2264.99   2265.20   -0.20 0  1  10 1  IDETLNTQVAVHTTQIQINK
114   1105.63   3313.87   3313.58   0.29 1  1  4.3 1  CALEAARGMINEGFDVTFLSVDNQGLIDMK
29   679.82   1357.62   1358.76   -1.14 0  1  24 1  IVQQYSVGLAPGK
37   772.35   1542.68   1543.74   -1.06 0  1  18 1  AEPYAHDAPFLASR
62   1014.41   2026.81   2025.94   0.88 0  1  12 1  HPFLTNLYCSFQTENR
52   946.91   1891.81   1892.04   -0.23 0  1  15 1  IAVQVILTQAATEFFNK
26   1326.20   1325.19   1325.78   -0.59 1  1  15 1  LFGSSRIPPKPK
19   631.32   1260.62   1260.62   0.00 1  0  30 1  DAIEKLSDENK
17   1225.28   1224.27   1224.62   -0.35 1  0  16 1  GEAKTHELNAR
31   697.81   1393.61   1394.74   -1.13 0  0  25 1  EETIPPELALQR
1   505.26   1008.51        
2   519.25   1036.49        
16   596.80   1191.58        
18   631.30   1260.58        
20   631.32   1260.63        
24   1310.48   1309.47        
27   672.31   1342.60        
32   1429.85   1428.85        
33   723.85   1445.69        
36   747.82   1493.62        
38   785.82   1569.63        
39   799.84   1597.67        
41   808.90   1615.79        
44   836.85   1671.69        
45   838.38   1674.75        
46   872.93   1743.84        
48   887.92   1773.83        
50   912.93   1823.85        
53   962.40   1922.79        
54   962.99   1923.97        
55   965.98   1929.94        
58   981.47   1960.92        
59   987.43   1972.85        
60   1003.98   2005.94        
69   718.02   2151.04        
71   744.01   2229.01        
72   1116.56   2231.10        
74   1137.05   2272.08        
75   1137.55   2273.08        
76   1137.55   2273.09        
78   1165.57   2329.12        
79   1167.08   2332.14        
80   796.40   2386.17        
81   801.40   2401.18        
82   1210.03   2418.04        
83   1210.53   2419.04        
85   836.76   2507.25        
86   841.09   2520.25        
88   1275.58   2549.14        
89   641.09   2560.32        
90   865.07   2592.20        
91   1304.52   2607.02        
92   1308.67   2615.32        
93   891.80   2672.37        
94   1346.15   2690.28        
95   904.42   2710.24        
96   918.80   2753.37        
97   1383.67   2765.33        
98   1401.58   2801.15        
99   1451.10   2900.19        
100   978.13   2931.38        
101   990.42   2968.25        
102   1017.17   3048.50        
103   1030.45   3088.34        
104   1040.80   3119.39        
105   1044.81   3131.42        
106   1049.49   3145.43        
107   789.11   3152.41        
108   1068.49   3202.45        
109   1071.14   3210.40        
111   815.65   3258.56        
112   1090.14   3267.40        
113   1090.15   3267.43        
115   1108.12   3321.34        
117   1222.16   3663.46        
118   1271.90   3812.66        
119   1335.67   4003.99        
120   1338.61   4012.82        
121   1348.22   4041.64        
122   1011.44   4041.71        
123   1370.22   4107.62        
124   1381.77   4142.29        
125   1420.56   4258.65        
126   1464.58   4390.73        
127   1219.89   4875.53        
128   1305.61   5218.40        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 129

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 3
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 11.2   -0.06    6  CAGL0M06281g K.KIGSLIFLR.I
  9.3   -0.93    9  CAGL0F00913g K.QSVAISNSNK.E
  6.4    0.11                    R.IQGGGNSGNSR.L
  3.0    0.13                    R.QLQEEEDR.Q
  3.0    0.07                    K.QLVSCNIGR.H
  1.8   -0.01                    K.LKESLTSLR.E
  1.8    0.01                    R.LKGQITCVK.F
  1.8    0.04                    K.LKLANEACK.K
  1.8    0.04                    R.LQTEIKSID.-
  1.3   -0.95                    K.LESELSELK.Q
Top scoring peptide matches to query 4
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.04        R.SLADNPASPGK.Q
Top scoring peptide matches to query 5
Score greater than 25 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 20.9    0.00    2  CAGL0G00308g K.GQTLGVAVPSK.Q
 11.0    0.07    7  CAGL0I03256g K.QGTIESFFK.R
  1.0    0.04                    K.KASLEYAFK.E
Top scoring peptide matches to query 6
Score greater than 23 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 15.4   -0.03    5  CAGL0M10153g K.NEVNQLILK.E
  9.5    0.03    8  CAGL0K09790g K.VDKSQQTHK.N
  9.2   -0.06   10  CAGL0H08888g R.QNWRLILK.G
  7.4    0.01   15  CAGL0I00660g K.VLCAHTNKK.Y
  7.1    0.10                    R.EKVEYDCK.F
  6.9   -1.05                    K.KLLDDIINK.K
  6.3    0.09                    K.YCNEMLLK.L
  4.8    0.00                    K.VGELTSSHIK.Y
  4.4   -1.05                    R.LIQTEILNK.M
  4.3   -1.09                    R.ELKTLLLNK.G
Top scoring peptide matches to query 7
Score greater than 14 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7    0.05        K.VSYELDKLK.D
  1.3    1.07        K.YNVDVIDKK.G
  0.7    0.14        K.QFNLSENDK.F
Top scoring peptide matches to query 8
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  6.1    0.02                    R.GNIGLMVNER.L
  2.5    0.04   16  CAGL0J03124g K.GGIINGETGER.I
  2.1   -0.01                    R.AGRLAEMNLK.D
  1.5   -0.01                    K.KAEQMLLNR.I
Top scoring peptide matches to query 9
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.9    0.93        K.ACSGKFTPLK.Q
  1.9    0.91        K.LVKYNTENK.G
  1.1   -0.18        K.LFIYLSLLK.D
  0.8   -0.11        R.AFEFLELLK.I
  0.8   -0.03        K.AKYEDEINK.R
  0.8    0.96        R.EGSEFGELIK.H
  0.8   -1.09        R.FLNKFANTR.S
  0.8   -1.01        K.GYWVTENNK.R
  0.4   -1.09        K.LAQLGGHSTAR.T
  0.0   -0.07        K.VQETLQTYK.S
Top scoring peptide matches to query 10
Score greater than 14 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  2.2   -1.02                    K.QDVLNGIQNK.K
  1.2   -1.07                    K.ELEEAAIILK.Q
  0.7    0.02                    K.KDAGMHNNLK.V
  0.6    1.03   17  CAGL0B02101g K.TAPFGPFDFK.V
  0.4    0.01                    R.KPETSFFSGK.N
Top scoring peptide matches to query 11
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.7   -0.90        R.VDCDVEDGVK.S
  6.7   -0.89        R.VDNSNESNEK.S
  6.6   -0.95        K.VFGSGNNSTPR.S
  4.3    1.05        R.EQIINEMEK.E
  4.0   -1.01        R.TLNVNYANVK.D
  4.0   -0.91        R.RSENDYSHK.V
  3.2   -0.01        R.QIFDEELLK.Q
  3.0   -1.03        R.VCNKVFQLK.H
  2.7   -0.98        K.FDQMPGSIIK.M
  1.8   -1.06        R.YIPLLTCKK.A
Top scoring peptide matches to query 12
Score greater than 24 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 64.3    0.01    2  CAGL0G00308g K.KPDTQVGGAGVK.G
  7.9    0.04   14  CAGL0M00594g K.KYSEFAGVQK.H
  6.8   -0.98   19  CAGL0E04950g K.FPESDPKIPK.V
  6.7   -0.05   20  CAGL0J10626g R.NIIENISILK.K
  5.3   -0.10                    K.LNLSIRSLIK.K
  5.1   -0.05                    R.KIAVEENIIK.G
  4.1   -0.95                    R.EPIASGDAGKGR.D
  4.0   -0.05                    K.KDLQLIDAIK.E
  3.4    0.95                    R.KKPSMPQLVK.E
  2.2   -0.01                    K.QLASNNRVVR.E
Top scoring peptide matches to query 13
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.4    0.05        R.TITGFMNYSK.A
  2.7    1.01        K.NAVSIQCGRR.F
  2.1   -1.04        K.ISVVSETGSRK.A
  1.0   -0.13        K.AITSLLRFLK.S
  0.3    1.03        R.VGGASEVEVGEK.K
Top scoring peptide matches to query 14
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.2    1.00        R.AAMLYGPPGIGK.T
  0.1    0.98        K.DPKSCTILIK.G
Top scoring peptide matches to query 15
Score greater than 25 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 41.0   -0.00    4  CAGL0A03168g R.INELLSALEGK.S
 10.4   -0.00   12  CAGL0D02552g K.INEAKELLEK.S
  6.0   -0.00                    K.IENDKVELVK.A
  3.6    0.05                    K.NMVENEIPLK.E
Top scoring peptide matches to query 16
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 17
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4   -0.35        K.GEAKTHELNAR.Y
  0.4   -0.37        K.QRSNRPTPNR.Q
Top scoring peptide matches to query 18
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 19
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5    0.00        K.DAIEKLSDENK.T
Top scoring peptide matches to query 20
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 21
Score greater than 14 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8   -1.04        K.DLKSADIMTLR.N
  1.8   -0.99        K.VNDDTSKEVQK.T
Top scoring peptide matches to query 22
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.7   -1.01        K.DPKDPVGAVSCK.V
Top scoring peptide matches to query 23
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  8.4   -0.03   13  CAGL0M05181g R.DYLSGRSLLEK.K
  4.7    0.06                    R.DYEIEQQVEK.L
  2.4    0.04                    K.GVLTNDEYVDR.E
  1.3   -1.03                    M.FRSTTSNVLTR.A
Top scoring peptide matches to query 24
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 25
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4    0.89        R.NLIEVGADPRIK.N
  0.9    0.97        K.NIRNANFFSNK.D
Top scoring peptide matches to query 26
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.6   -0.59        K.LFGSSRIPPKPK.Q
Top scoring peptide matches to query 27
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 28
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.0   -0.06        R.LLDGVADGSMRSK.A
  3.4    0.93        R.EKFESLPDNLR.I
  1.0    0.87        K.SLGDVPLFLTSAK.S
Top scoring peptide matches to query 29
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.1   -1.14        K.IVQQYSVGLAPGK.R
Top scoring peptide matches to query 30
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  7.1   -0.09   18  CAGL0H03553g R.GSTVHVIDFGLSK.K
  6.5   -0.11   17  CAGL0B02101g K.VVTIEGKATDQAK.V
  5.8   -0.02                    K.LTGDNRYYTEK.E
  2.5    0.96                    K.DTKVMFQGFTGK.Q
  2.4   -0.07                    R.LELSDGDEQLIK.Q
  2.4   -0.06                    K.NPDVPSGNSFVVK.T
  2.0   -0.14                    K.KVRPELAGNFTK.N
  1.9   -0.03                    R.NGTSTSSHKNAAGK.E
  1.5   -0.05                    K.GGDNVSRPTSLEK.N
  0.2   -0.14                    R.LDQLQFLRQAK.F
Top scoring peptide matches to query 31
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4   -1.13        R.EETIPPELALQR.T
Top scoring peptide matches to query 32
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 33
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 34
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6    0.03        R.YVNIMPYERNR.V
  3.9   -0.13        K.GSLVNIGLRSGILR.R
  3.8    1.00        R.MDHVFVRGSHIR.F
  3.6   -0.91        R.STTAEIADTEFDR.M
  3.3    1.04        K.RVGNQFNAMFNR.K
  2.6    0.11        R.DVFDWNSVMADR.D
  1.6    1.08        K.GTESDSWSFPRGK.I
  1.6    1.01        R.SLSMANAAVEIYGK.R
  1.4    0.94        R.SGGTVGPIVAAQLGAR.T
  1.1    0.16        K.DSSHESLCYNDK.Y
Top scoring peptide matches to query 35
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  4.7    0.03   16  CAGL0J03124g R.TPPKPEATNTSPAR.V
  1.5   -0.92                    R.GLNYYPNLEAEGK.D
  1.2    0.12                    R.TPEECVLHYYR.T
  1.0    0.02                    R.KIGNGDGFMLTSVK.K
  0.2   -0.99                    R.AQTALQFLLDGYK.E
Top scoring peptide matches to query 36
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 37
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.9   -1.06        R.AEPYAHDAPFLASR.V
Top scoring peptide matches to query 38
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 39
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 40
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.5   -0.01        K.DITAVNDNKIASVSR.D
  4.1    1.01        K.VWSLEDGSNPRTLK.G
  1.9    0.08        K.TPNTSLMKTDHSDR.D
Top scoring peptide matches to query 41
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 42
Score greater than 21 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  8.5   -1.08   11  CAGL0F08679g K.VYEESLDLDLSKSK.R
Top scoring peptide matches to query 43
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.5   -0.05        K.ATGAECIPLKMNLTK.D
  0.2   -0.04        K.TVSVPCTLQAIGTDGK.V
Top scoring peptide matches to query 44
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 45
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 46
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 47
Score greater than 18 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6   -1.19        K.GPGAVISLQTGSIPISKK.I
Top scoring peptide matches to query 48
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 49
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8   -0.02        K.QLAGNEMLTYFAVDNK.D
Top scoring peptide matches to query 50
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 51
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5   -1.02        R.SPGTPQENTAAPCGIITK.R
Top scoring peptide matches to query 52
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.7   -0.23        K.IAVQVILTQAATEFFNK.K
Top scoring peptide matches to query 53
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 54
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 55
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 56
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 21.6    0.04    2  CAGL0G00308g K.DASAVASDLAALSQYPTIR.L
Top scoring peptide matches to query 57
Score greater than 19 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 84.9   -0.02    1  CAGL0F07579g K.LKFSDNTYAVVNSDGSIK.T
  1.3    0.08                    R.KLYSDIPMSDPEEDYR.L
  1.2    1.12                    K.GAFESVLNCCTHWYGR.D
Top scoring peptide matches to query 58
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 59
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 60
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 61
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.1   -1.10        K.AVETGVVELEITGNRNAIK.E
  2.8   -1.17        K.IALVSGINISTTAQERVIK.L
  2.7   -0.12        K.VDLWSIGIVFLNVVFYK.N
Top scoring peptide matches to query 62
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.9    0.88        K.HPFLTNLYCSFQTENR.I
Top scoring peptide matches to query 63
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
100.3   -0.05    3  CAGL0I06160g K.IAEQCSPINLEVVSLVDC.-
Top scoring peptide matches to query 64
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
147.9   -0.05    1  CAGL0F07579g K.TGSESEGTSGFALSGSHLTYK.G
  5.7   -0.07                    R.TTSNDDPYKSFISPTSIDK.H
Top scoring peptide matches to query 65
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
117.3   -0.04    1  CAGL0F07579g K.TGSESEGTSGFALSGSHLTYK.G
Top scoring peptide matches to query 66
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 99.2   -0.03    1  CAGL0F07579g K.TGSESEGTSGFALSGSHLTYK.G
Top scoring peptide matches to query 67
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
146.9   -0.03    1  CAGL0F07579g K.TGSESEGTSGFALSGSHLTYK.G
  6.6   -1.04                    R.TTATTDVTTVDTSGPPYFDK.L
  4.0   -0.05                    R.TTSNDDPYKSFISPTSIDK.H
Top scoring peptide matches to query 68
Score greater than 14 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5   -0.05        R.EYIVNCPLSPIQTKFYR.M
  2.5    0.95        K.FSGLQILIDNFSNYGPSVR.G
  1.6    0.88        K.IASGRGIVLSAKPDDIDMLR.Q
  1.6   -1.06        R.QEAENALLNFNKDGSLPLR.T
  1.6   -0.06        R.QQALKDITEIEHSFAELR.Q
  1.4   -1.09        R.LNISSFSLDYKPLKDNFK.L
  1.1   -1.10        K.TGKPLPNQPPAKPMPAVEEK.S
Top scoring peptide matches to query 69
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 70
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.2   -0.10        K.LAIYELMTEESAVNFWEK.Y
Top scoring peptide matches to query 71
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 72
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 73
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.3   -0.20        K.IDETLNTQVAVHTTQIQINK.T
  0.5    0.94        K.ELAVYFYESFQYSSTTTTK.S
Top scoring peptide matches to query 74
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 75
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 76
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 77
Score greater than 14 indicates homology
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.0   -0.21        K.GNLDTYGFCDDVWTFIVKK.C
Top scoring peptide matches to query 78
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 79
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 80
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 81
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 82
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 83
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 84
Score greater than 18 indicates homology
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.5   -0.01        R.YVLDFGQFQHGQPVDKDIVLK.E
Top scoring peptide matches to query 85
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 86
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 87
Score greater than 15 indicates homology
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.2    0.91        K.SLNPEDISGLNKELIELQMYSK.Q
  2.1   -0.90        R.VSADEYVSMESGSEFVESWWAK.T
Top scoring peptide matches to query 88
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 89
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 90
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 91
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 92
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 93
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 94
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 95
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 96
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 97
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 98
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 99
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 100
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 101
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 102
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 103
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 104
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 105
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 106
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 107
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 108
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 109
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 110
Score greater than 16 indicates homology
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.5   -0.02        K.ENISGYKPGLNMVYNENGKGSSLTTFDTGK.G
Top scoring peptide matches to query 111
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 112
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 113
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 114
Score greater than 13 indicates homology
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2    0.29        K.CALEAARGMINEGFDVTFLSVDNQGLIDMK.E
  0.6    0.12        R.TCVILNNLDAMLGMITRLDELVKPQELSK.Y
Top scoring peptide matches to query 115
Score greater than 19 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 116
Score greater than 14 indicates homology
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.5   -0.25        K.MLHTQRPSSPQKTQSSSLLPPVSSDINGTNPK.R
  1.6    0.90        R.VYQYLEFQSLSNFHTYENDSFEKLTNSK.Q
  1.6   -1.08        K.FKAHFQDDYNLCHFWTNLEVGDLNFFR.S
Top scoring peptide matches to query 117
Score greater than 18 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 118
Score greater than 18 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 119
Score greater than 18 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 120
Score greater than 17 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 121
Score greater than 17 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 122
Score greater than 18 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 123
Score greater than 17 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 124
Score greater than 17 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 125
Score greater than 15 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 126
Score greater than 16 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 127
Score greater than 15 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 128
Score greater than 13 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 129
Score greater than 14 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5    0.68        M.WSIYVLLISLISRVLSATDGSFVISDPTYVYNGDINVPDAGYILNTGGIAK.E