Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0129_q2.pkl
Database        : Cglabrata 041110dos (5427 sequences; 2703904 residues)
Timestamp       : 22 Feb 2005 at 14:09:53 GMT
Significant hits: Glu-C         |Endoproteinase- mature protein - (Staphylococcal serine proteinase) ACC P04188
                  CAGL0M01826g  highly similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerev
                  CAGL0F01287g  highly similar to sp|Q08193 Saccharomyces cerevisiae YOL030w, hypothetical start [Candida glabrata]
                  mSSr1         |validated by us| CAGL0H06413g similar to sp|O13547 Saccharomyces cerevisiae YLR390wa CW14, start b
                  CAGL0F07579g  similar to sp|P28319 Saccharomyces cerevisiae YKL096w CWP1 cell wall mannoprotein, start by similar
                  CAGL0I06204g  highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c PIR1, start by similarity [Candida gla
                  CAGL0G00308g  similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
                  CAGL0E04620g  similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerevisiae Y
                  CAGL0I06160g  highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
                  CAGL0K10054g  similar to sp|P32896 Saccharomyces cerevisiae YDR081c PDC2 pyruvate decarboxylase regulatory protei

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 27 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

Switch to Protein Summary Report

To create a bookmark for this report, right click this link: Peptide Summary Report (../data/20050222/F002686.dat)

        Error tolerant   

1.    Glu-C                             Mass: 29006    Score: 262    Peptides matched: 7
 |Endoproteinase- mature protein - (Staphylococcal serine proteinase) ACC P04188
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   570.33   1138.65   1138.63   0.01 0  49  0.0004 1  TLLTNKHVVD
 17   408.58   1222.71   1222.69   0.01 0  6  7.6 2  SKGKITYLKGE
20   630.82   1259.64   1259.62   0.02 0  55  0.00013 1  VVKPATMSNNAE
21   458.92   1373.75   1373.74   0.01 0  33  0.017 1  NVRNFLKQNIE
25   733.85   1465.68   1465.67   0.01 0  13  1.5 1  LSTTGGNSGSPVFNE
27   759.91   1517.81   1517.81   0.00 0  96  6.2e-009 1  APTGTFIASGVVVGKD
35   642.01   1923.01   1923.02   -0.01 1  11  1.8 1  LAIVKFSPNEQNKHIGE

 
      Proteins matching the same set of peptides:
      Glu-C/V8                          Mass: 36304    Score: 260    Peptides matched: 7
 |Endoproteinase precursor (Staphylococcal serine proteinase) ACC P04188

2.    CAGL0M01826g                      Mass: 43265    Score: 120    Peptides matched: 2
 highly similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerev
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   526.77   1051.53   1051.52   0.01 1  72  2.2e-006 1  SVEGFGSLKE
22   698.33   1394.64   1394.63   0.01 1  48  0.00048 1  SVSGALQFASNADE

 
      Proteins matching the same set of peptides:
      mCAGL0M01826g                     Mass: 41542    Score: 120    Peptides matched: 2
 |predicted| 404aa Highly similar to 38248 S.cerevisiae YBR078w ECM33 CAGL0M01826g|CAGL-IPF6362|CAGL
3.    CAGL0F01287g                      Mass: 52284    Score: 110    Peptides matched: 2
 highly similar to sp|Q08193 Saccharomyces cerevisiae YOL030w, hypothetical start [Candida glabrata]
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   708.33   1414.64   1414.64   0.00 1  67  7e-006 1  IKGNAFFDSSSNE
29   790.37   1578.72   1578.72   -0.00 0  46  0.00065 1  FGCNQVPGARPFTE

 
      Proteins matching the same set of peptides:
      mCAGL0F01287g                     Mass: 50421    Score: 110    Peptides matched: 2
 |predicted| highly similar to sp|Q08193 Saccharomyces cerevisiae YOL030w, hypothetical start [Candi
4.    mSSr1                             Mass: 19214    Score: 59     Peptides matched: 1
 |validated by us| CAGL0H06413g similar to sp|O13547 Saccharomyces cerevisiae YLR390wa CW14, start b
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
43   949.17   3792.67   3792.68   -0.01 1  59  4.2e-006 1  TPPACLLACVAQVSKQSSQCHTLNQVGCFCENE

5.    CAGL0F07579g                      Mass: 20710    Score: 58     Peptides matched: 1
 similar to sp|P28319 Saccharomyces cerevisiae YKL096w CWP1 cell wall mannoprotein, start by similar
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
37   926.11   2775.30   2775.31   -0.01 0  58  1.4e-005 1  GTSGFALSGSHLTYKGNSGFFAIPSGSE

 
      Proteins matching the same set of peptides:
      CAGL0F07601g                      Mass: 21335    Score: 58     Peptides matched: 1
 similar to sp|P28319 Saccharomyces cerevisiae YKL096w CWP1 cell wall mannoprotein, start by similar
      mCwp1.1                           Mass: 19256    Score: 58     Peptides matched: 1
 |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
      mCwp1.2                           Mass: 18631    Score: 58     Peptides matched: 1
 |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1
6.    CAGL0I06204g                      Mass: 35969    Score: 44     Peptides matched: 1
 highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c PIR1, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   504.74   1007.47   1007.46   0.01 1  44  0.0015 1  SCKVDGTLE

 
      Proteins matching the same set of peptides:
      mPir1p                            Mass: 34149    Score: 44     Peptides matched: 1
 |predicted| 331aa Highly similar S. cerevisiae YKL164c PIR1 CAGL0I06204g|CAGL-IPF1408|CAGL-CDS3158.
7.    CAGL0G00308g                      Mass: 39767    Score: 37     Peptides matched: 1
 similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   548.77   1095.53   1095.52   0.01 1  37  0.0066 1  KYWGVLSDE

 
      Proteins matching the same set of peptides:
      mCAGL0G00308g                     Mass: 38048    Score: 37     Peptides matched: 1
 |predicted| 357aa Similar to P53334 S. cerevisiae YGR279c SCW4 CAGL0G00308g|CAGL-IPF3933|CAGL-CDS29
8.    CAGL0E04620g                      Mass: 44251    Score: 35     Peptides matched: 1
 similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerevisiae Y
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   425.76   849.51   849.50   0.01 0  35  0.014 1  VSFKKLE

9.    CAGL0I06160g                      Mass: 24169    Score: 35     Peptides matched: 1
 highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   480.74   959.46   959.44   0.02 0  35  0.016 1  QCSPINLE

 
      Proteins matching the same set of peptides:
      mPir4p.1                          Mass: 22496    Score: 35     Peptides matched: 1
 |predicted-NN| 216aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|C
      mPir4p.2                          Mass: 22425    Score: 35     Peptides matched: 1
 |predicted-HMM| 215aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|
10.   CAGL0K10054g                      Mass: 92018    Score: 30     Peptides matched: 1
 similar to sp|P32896 Saccharomyces cerevisiae YDR081c PDC2 pyruvate decarboxylase regulatory protei
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   480.74   959.46   959.50   -0.04 1  30  0.054 2  MLLDLNIE

11.   CAGL0M13849g                      Mass: 61157    Score: 23     Peptides matched: 1
 highly similar to sp|P22146 Saccharomyces cerevisiae YMR307w GAS1 glycophospholipid-anchored surfac
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   481.77   961.53   961.52   0.01 0  23  0.21 1  VTPRLFTE

 
      Proteins matching the same set of peptides:
      mGas2p                            Mass: 58873    Score: 23     Peptides matched: 1
 |predicted| 543aa Highly similar to |P22146 S. cerevisiae YMR307w GAS1 CAGL0M13849g|CAGL-IPF6049|CA
12.   CAGL0G09174g                      Mass: 104862   Score: 22     Peptides matched: 1
 similar to sp|Q08951 Saccharomyces cerevisiae YPL195w YKS4, start by similarity [Candida glabrata]
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   480.74   959.46   958.54   0.92 1  22  0.32 3  ILFIPDIE

13.   CAGL0M07876g                      Score: 18     Peptides matched: 1
 highly similar to sp|P47095 Saccharomyces cerevisiae YJR024c, hypothetical start [Candida glabrata] Complete CDS. CAGL0M07876g|CAGL-IPF9239|CAGL-CDS4382.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   425.76   849.51   849.46   0.05 0  18  0.73 2  FKISNIE

14.   CAGL0H05907g                      Mass: 76488    Score: 18     Peptides matched: 2
 similar to sp|P15179 Saccharomyces cerevisiae YPL104w MSD1, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   492.73   983.44   983.51   -0.07 1  10  3.4 2  LRADRQPE
 8   499.71   997.40   996.57   0.83 0  8  5.6 3  IKNTKHKE

15.   CAGL0I09174g                      Mass: 18053    Score: 17     Peptides matched: 1
 similar to sp|P38337 Saccharomyces cerevisiae YBR258c, hypothetical start [Candida glabrata] Comple
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   416.74   831.47   831.47   -0.00 0  17  1 1  ALKLSVSD

16.   CAGL0I00286g                      Score: 17     Peptides matched: 1
 highly similar to sp|P23585 Saccharomyces cerevisiae YMR011w HXT2 or sp|P39003 Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004 Saccharomyces cerevisiae YDR342c HXT7, hypothetical start [Candida glabrata] Complete CDS. CAGL0I00286g|CAGL-IPF1995|CAGL-CDS1738.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   425.76   849.51   849.42   0.09 1  17  0.95 3  FQLKADE

17.   CAGL0M08756g                      Score: 17     Peptides matched: 1
 similar to sp|P52911 Saccharomyces cerevisiae YDR261c exo-beta-1 3-glucanase, hypothetical start [Candida glabrata] Complete CDS. CAGL0M08756g|CAGL-IPF8154|CAGL-CDS1666.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   425.76   849.51   849.42   0.09 1  17  1 4  DFAQIKE

18.   CAGL0M11264g                      Score: 16     Peptides matched: 1
 similar to sp|Q05021 Saccharomyces cerevisiae YMR227c TAF67, start by similarity [Candida glabrata] Complete CDS. CAGL0M11264g|CAGL-IPF8828|CAGL-CDS1775.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   425.76   849.51   849.46   0.05 0  16  1.2 5  FIKNSIE

19.   CAGL0I09218g                      Score: 15     Peptides matched: 1
 similar to sp|P38339 Saccharomyces cerevisiae YBR260c RGD1, start by similarity [Candida glabrata] Complete CDS. CAGL0I09218g|CAGL-IPF8982|CAGL-CDS1144.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 13   548.77   1095.53   1094.54   0.99 0  15  0.98 2  VNYQIKAME

20.   CAGL0I05808g                      Score: 15     Peptides matched: 1
 similar to sp|P40344 Saccharomyces cerevisiae YNR007c AUT1 essential for autophagocytosis, start by similarity [Candida glabrata] Complete CDS. CAGL0I05808g|CAGL-IPF1374|CAGL-CDS3521.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   425.76   849.51   848.37   1.14 1  15  1.6 6  EMQKNAE

Peptide matches not assigned to protein hits: (no details means no match)
List sorted by Decreasing Score. Sort by Decreasing Intensity or Increasing Query # / Mr

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   448.67   895.33   895.44   -0.11 0  14  1.3 1  FNNFLIE
9   503.26   1004.50   1004.49   0.01 1  13  2.1 1  VQPREFTE
7   492.73   983.44   983.50   -0.06 1  13  1.8 1  LTKDNKHE
16   596.81   1191.61   1191.62   -0.01 0  12  2.4 1  RVGMIRNAFE
34   612.67   1834.98   1834.98   0.00 0  9  2.6 1  KGRIGSIVANRQFQFD
8   499.71   997.40   996.46   0.94 0  8  4.8 1  QLFSYNPE
26   744.84   1487.66   1487.84   -0.19 0  8  4.6 1  IVPVLLAKMVYNE
17   408.58   1222.71   1221.64   1.07 1  8  5.3 1  KEQTPVLGHVD
18   614.26   1226.51   1225.67   0.84 1  5  10 1  IDLKWTPPKE
24   483.92   1448.74   1448.72   0.02 1  5  9.1 1  HFREWKSFALE
11   523.29   1044.57   1044.56   0.01 0  3  20 1  SVQNRLVTE
28   787.88   1573.74   1573.79   -0.05 1  3  15 1  SMIKKFLMSFVED
14   568.74   1135.47   1134.63   0.84 1  2  20 1  KEYLAKVVGE
32   892.87   1783.72   1784.81   -1.08 1  1  14 1  NATFDFRQSKQQSND
42   1122.47   3364.38   3364.56   -0.18 0  1  2.3 1  RRINTAPVLNMMKSSTTPPWCQSACWGTD
1   415.18   828.35         
19   629.83   1257.65         
30   871.95   1741.88         
31   581.64   1741.91         
33   903.87   1805.72         
36   852.37   2554.10         
38   1045.11   3132.30         
39   1052.43   3154.27         
40   1057.76   3170.24         
41   1115.14   3342.39         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : V8-DE
Fixed modifications    : Carbamidomethyl (C)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Data File Name         : cw0129_q2.pkl
Number of queries      : 43

Mascot:  http://www.matrixscience.com/ 

Top scoring peptide matches to query 1
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 2
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 17.4   -0.00  15                      CAGL0I09174g  ALKLSVSD
 10.8    1.02                                        KAIGQSVE
  9.8    1.05                                        QGKIADAE
  9.1   -0.02                                        AIKLMKE
  8.9    0.01                                        KQLMLAE
  8.3    0.05                                        QIQMLAE
  7.6   -0.99                                        SLILATSE
  7.5    1.05                                        GIAQSLNE
  7.1    0.02                                        ALRSEKE
  7.0    0.03                                        LAKGLTDD
Top scoring peptide matches to query 3
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 35.5    0.01   8                      CAGL0E04620g  VSFKKLE
 18.4    0.05  13                      CAGL0M07876g  FKISNIE
 17.3    0.09  16                      CAGL0I00286g  FQLKADE
 16.9    0.09  17                      CAGL0M08756g  DFAQIKE
 16.4    0.05  18                      CAGL0M11264g  FIKNSIE
 14.9    1.14  20                      CAGL0I05808g  EMQKNAE
 14.7    1.03                                        FKGKQIE
 12.8    0.01                                        FKIKTVD
 12.6    0.07                                        KSTSSIVE
 12.6    0.01                                        KFIKISD
Top scoring peptide matches to query 4
Score greater than 24 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 14.1   -0.11                                        FNNFLIE
 10.8    0.90                                        KVCGRFE
 10.3   -0.11                                        EKSTFRE
  7.2    0.77                                        KIKHIKE
  6.8   -0.07                                        ETQRSFE
  6.8   -0.09                                        EKTQYVE
  6.8    0.88                                        KIDMFIE
  6.7   -0.02                                        MLSWCAE
  6.7    0.85                                        KQYLSKE
  6.7    0.94                                        KCMITNE
Top scoring peptide matches to query 5
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 35.0    0.02   9                      CAGL0I06160g  QCSPINLE
 29.7   -0.04  10                      CAGL0K10054g  MLLDLNIE
 22.0    0.92  12                      CAGL0G09174g  ILFIPDIE
 14.3   -1.00                                        KASMPADLE
 13.9    0.01                                        GKGDGTSPIE
 12.2    0.95                                        QLMNLVLE
 11.7   -0.03                                        NLEVPFLE
  9.9   -0.03                                        LSTNVANLE
  9.7   -1.04                                        CTLRGLLE
  9.7    0.01                                        NITNAGEIE
Top scoring peptide matches to query 6
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 23.3    0.01  11                      CAGL0M13849g  VTPRLFTE
  7.2    1.05                                        AQETSLALE
  6.2    0.02                                        LSPLFKEE
  5.0    0.03                                        AEKAKMRE
  3.2   -0.91                                        NSNRKDTE
  2.9   -0.06                                        SILFLKLE
  2.9    0.05                                        EALGLSMLE
  2.6    0.05                                        LSSDIIWE
  2.1    1.07                                        KASMPADLE
  2.1    1.04                                        QASAKAKEE
Top scoring peptide matches to query 7
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 13.0   -0.06                                        LTKDNKHE
 10.2   -0.07  14                      CAGL0H05907g  LRADRQPE
  9.9    0.97                                        NVQIYAFE
  7.2   -0.02                                        LTGFDIGFD
  5.0   -0.05                                        DVLQNLAPD
  4.7   -0.11                                        LDTPAIILE
  1.9   -1.03                                        TNDVPTPIE
  1.3   -0.08                                        DVKVNIPAE
  1.1   -0.05                                        TLANSPLGPD
  0.3   -1.01                                        NNDKATPPE
Top scoring peptide matches to query 8
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.4    0.94                                        QLFSYNPE
  8.4    0.80                                        KLRPIELE
  7.7    0.83  14                      CAGL0H05907g  IKNTKHKE
  7.3   -0.09                                        TVRSMYLE
  6.9   -0.15                                        QNVVPSILE
  6.8   -0.15                                        TPVNVLNIE
  6.3   -0.08                                        EVAQFYIE
  5.8   -0.09                                        AKATNHDLE
  5.4    0.86                                        QVKHIFPE
  5.3    0.90                                        TVYKMNLE
Top scoring peptide matches to query 9
Score greater than 24 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 13.1    0.01                                        VQPREFTE
 10.6   -0.03                                        GGIRIFVDE
  6.7   -0.00                                        GIGLDTSITE
  4.5   -0.94                                        DNAGPFASID
  4.2   -0.07                                        ARTLRFLE
  4.2   -0.03                                        INKWSTKE
  4.2    0.01                                        INAACSKLE
  3.8   -0.99                                        IDCILLME
  3.1   -1.00                                        LDFVPTISD
  3.1   -0.99                                        DLFAQAARD
Top scoring peptide matches to query 10
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 44.5    0.01   6                      CAGL0I06204g  SCKVDGTLE
 14.3   -0.09                                        ANLHRRLE
 14.1   -0.10                                        FLIFLLNE
 14.1   -0.04                                        FLINKMNE
 14.1   -0.01                                        FHHPQTLE
 11.2   -0.02                                        SATIFNNIE
  9.4   -0.14                                        LLKQKHIE
  8.0    0.02                                        TNANAEFIE
  7.9   -0.06                                        ISKYAANLE
  7.9   -0.09                                        KSYLQKIE
Top scoring peptide matches to query 11
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.4    0.01                                        SVQNRLVTE
  2.7   -1.06                                        KLGFRLIAE
  1.1    1.06                                        EEPTKLNVD
  1.0    0.97                                        RTGGVLLLTD
  0.1    0.09                                        FGTYLDSKD
Top scoring peptide matches to query 12
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 72.0    0.01   2                      CAGL0M01826g  SVEGFGSLKE
 11.0   -1.06                                        TSKFSVKKE
 10.2   -0.01                                        KIMEQFKE
 10.0   -1.11                                        QRVPIALKE
  8.4   -0.01                                        KPFFANLSE
  8.3   -0.03                                        QLTAYSLKE
  8.0    0.02                                        LKLSMGMSAD
  7.8    0.03                                        SVSKFNQQD
  5.2    1.10                                        WSVSGSENGE
  5.2    0.01                                        SATLGSQIFE
Top scoring peptide matches to query 13
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 37.1    0.01   7                      CAGL0G00308g  KYWGVLSDE
 15.4    0.99  19                      CAGL0I09218g  VNYQIKAME
 14.5   -0.03                                        FDFQLLGKE
 13.3    0.01                                        TKWSMLTTE
 10.1    0.04                                        VICQVFSDE
 10.1    0.09                                        FYFTTSSED
  7.6    0.08                                        SSSSPTSLSED
  7.2   -0.06                                        FSKAFAALLE
  7.1   -1.01                                        FVFILNTDE
  6.8   -0.04                                        LHVLAASWAE
Top scoring peptide matches to query 14
Score greater than 14 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.4    0.84                                        KEYLAKVVGE
  1.8   -0.12                                        ENIFTKKQE
  1.5    0.81                                        KKSKHKKHD
  1.3   -1.14                                        LYEKSAVAKE
  1.1   -0.15                                        ESLPRLPLPD
  1.0    0.83                                        QLNGVLLHLE
  0.5   -1.15                                        LKLDNVGLHE
Top scoring peptide matches to query 15
Score greater than 27 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 49.1    0.01   1                             Glu-C  TLLTNKHVVD
 11.8    0.05                                        QLVDSKHVVD
  5.9    0.08                                        TIMFNLKSAD
  0.8    0.12                                        TLTSMFPDLD
  0.6   -0.86                                        NTISTSGQFAD
  0.5    0.08                                        QLNIQYFVD
Top scoring peptide matches to query 16
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 12.0   -0.01                                        RVGMIRNAFE
  8.4   -0.01                                        KAKVNNKDFE
  8.3   -0.02                                        KVILNQAFME
  0.9   -1.01                                        EAGIYKRKND
  0.9   -0.10                                        KRRLSKYLE
  0.6    0.02                                        EYNLLKHFE
Top scoring peptide matches to query 17
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  7.7    1.07                                        KEQTPVLGHVD
  6.1    0.01   1                             Glu-C  SKGKITYLKGE
  1.0    0.03                                        EQIKGKLHRD
  0.2    0.11                                        SQGPFVFQKGE
  0.2    1.03                                        KGKKVSGFKDE
  0.1    1.05                                        KIFKTVVDASD
  0.1    0.00                                        KLIKVTVHNGD
Top scoring peptide matches to query 18
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.2    0.84                                        IDLKWTPPKE
  3.4    0.94                                        WENILTAHNE
  2.7    0.82                                        TKMLLNLHKE
  1.8   -1.03                                        FQSYIDNVNE
  1.4    0.77                                        RVVIQELLKE
  1.3   -0.14                                        SGVTNLIIPGAGE
  1.1    0.81                                        LSVPEAKRVVE
  1.1   -1.13                                        KFIDNARHVE
  1.0    0.85                                        YVSLIINYLE
  0.9   -1.15                                        ALAAAKRAAEQE
Top scoring peptide matches to query 19
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 20
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 54.7    0.02   1                             Glu-C  VVKPATMSNNAE
 16.1   -0.06                                        TPTVVKTSSLVE
  7.6   -0.02                                        KEGQWSVIGKE
  7.3    0.04                                        FVKPFNHDGAE
  5.9   -0.07                                        VISSTLDRLKE
  2.3   -0.07                                        QMKEKAKLRE
  2.3    0.09                                        ACQGDSGGPLVAE
  2.2   -0.06                                        TLKTSGLIIDAE
  0.5    0.96                                        KVVAETVNSALE
  0.2   -0.04                                        TSQLQGAKSIVE
Top scoring peptide matches to query 21
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 32.7    0.01   1                             Glu-C  NVRNFLKQNIE
  8.5    0.06                                        SLLAGGVELCNIE
  5.3    0.02                                        ASQSKNKQQVKE
  4.4    0.07                                        NNDLKSSLQNLE
  0.7   -0.95                                        MSQRKLQQEID
Top scoring peptide matches to query 22
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 47.9    0.01   2                      CAGL0M01826g  SVSGALQFASNADE
  0.5    0.01                                        TQSLARCLGTCE
  0.3   -1.18                                        VKRKIKPDGINE
Top scoring peptide matches to query 23
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 66.6    0.00   3                      CAGL0F01287g  IKGNAFFDSSSNE
  6.2   -0.11                                        RRPDLLSKSTQD
  6.1    0.88                                        AGGAKRATAIADALE
  4.5   -0.03                                        FSNVYQMKRQD
  2.2   -1.16                                        VYDPLINLVKKD
  1.6   -0.05                                        FHPTQPIFVSAGD
  1.5   -0.18                                        NIQKFVLQLLAE
Top scoring peptide matches to query 24
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.1    0.02                                        HFREWKSFALE
  3.5    0.98                                        KVGCALMPIFIAE
  2.4    0.01                                        LFSFANFLKSFE
  1.1   -0.99                                        TVSSILDNFVLNE
  1.0    0.02                                        ENSVAPALMLYLE
  0.3    0.97                                        YGVEVLRGVLQSE
Top scoring peptide matches to query 25
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 12.5    0.01   1                             Glu-C  LSTTGGNSGSPVFNE
Top scoring peptide matches to query 26
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  7.9   -0.19                                        IVPVLLAKMVYNE
  7.9   -0.13                                        LVTGKAGITLSEGNE
  4.4    0.82                                        LSKFQKLLVDAPE
  3.1   -0.19                                        SIEIIAVLTSISKD
  2.8   -1.04                                        GGSGQSGQLDGARGKD
  1.7   -1.14                                        FKKYDVHLTIPE
Top scoring peptide matches to query 27
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 96.2    0.00   1                             Glu-C  APTGTFIASGVVVGKD
Top scoring peptide matches to query 28
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.6   -0.05                                        SMIKKFLMSFVED
  1.2   -1.07                                        KKPETQVATTTATAE
Top scoring peptide matches to query 29
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 45.8   -0.00   3                      CAGL0F01287g  FGCNQVPGARPFTE
  2.1   -0.05                                        FGCNRVLPRQFGE
  0.8   -1.07                                        FGIDSGRASTVSLRD
  0.7   -1.01                                        CNCTKIDKTQALE
  0.6   -0.04                                        YGVQPGSNFVVLNGE
  0.4    0.98                                        TWARFDPDGTGKLD
  0.1    1.07                                        AQGSQQSNGSTNSTPD
Top scoring peptide matches to query 30
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 31
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 32
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.4   -1.08                                        NATFDFRQSKQQSND
  1.3   -1.18                                        NPNAIRETNSSINKID
  0.7   -0.23                                        LAVVRSSARGNVDVQVD
Top scoring peptide matches to query 33
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 34
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.0    0.00                                        KGRIGSIVANRQFQFD
Top scoring peptide matches to query 35
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.9   -0.01   1                             Glu-C  LAIVKFSPNEQNKHIGE
Top scoring peptide matches to query 36
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 37
Score greater than 16 indicates homology
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 58.3   -0.01   5                      CAGL0F07579g  GTSGFALSGSHLTYKGNSGFFAIPSGSE
Top scoring peptide matches to query 38
Score greater than 19 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 39
Score greater than 19 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 40
Score greater than 19 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 41
Score greater than 18 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 42
Score greater than 13 indicates homology
Score greater than 17 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.1   -0.18                                        RRINTAPVLNMMKSSTTPPWCQSACWGTD
Top scoring peptide matches to query 43
Score greater than 16 indicates homology
Score greater than 17 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 58.6   -0.01   4                             mSSr1  TPPACLLACVAQVSKQSSQCHTLNQVGCFCENE