Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0106_q5.pkl
Database        : Cglabrata 041110dos (5427 sequences; 2703904 residues)
Timestamp       : 22 Feb 2005 at 14:04:54 GMT
Significant hits: mCwp1.1       |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
                  mCwp1.2       |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1
                  mSSr1         |validated by us| CAGL0H06413g similar to sp|O13547 Saccharomyces cerevisiae YLR390wa CW14, start b
                  CAGL0I06160g  highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
                  CAGL0G09449g  similar to sp|P53301 Saccharomyces cerevisiae YGR189c CRH1, hypothetical start [Candida glabrata] C
                  CAGL0I06182g  highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c PIR1, start by similarity [Candida gla
                  CAGL0G00308g  similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
                  CAGL0M08492g  highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c required forlerance to heat shock, sta
                  CAGL0J11748g  similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Saccharomyces cerevisiae YM
                  CAGL0F01463g  similar to sp|P10863 Saccharomyces cerevisiae YER011w TIR1, start by similarity [Candida glabrata] 
                  CAGL0M01826g  highly similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerev

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 27 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

Switch to Protein Summary Report

To create a bookmark for this report, right click this link: Peptide Summary Report (../data/20050222/F002681.dat)

        Error tolerant   

1.    mCwp1.1                           Mass: 19256    Score: 760    Peptides matched: 8
 |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   634.79   1267.57   1267.60   -0.03 0  119  3.5e-011 1  TGGSFAGTVTDAGK
23   503.91   1508.70   1508.78   -0.09 1  (100) 2.2e-009 1  TGGSFAGTVTDAGKLK
24   755.37   1508.73   1508.78   -0.05 1  122  1.4e-011 1  TGGSFAGTVTDAGKLK
26   780.82   1559.63   1559.73   -0.09 0  68  4.1e-006 1  GNSGFFAIPSGSEYK
38   858.87   1715.73   1715.80   -0.07 0  129  2.7e-012 1  FSDNTYAVVNSDGSIK
39   572.92   1715.74   1715.80   -0.06 0  (38) 0.0035 1  FSDNTYAVVNSDGSIK
42   1058.44   2114.86   2114.98   -0.11 0  141  1.1e-013 1  TGSESEGTSGFALSGSHLTYK
48   1055.16   3162.45   3162.63   -0.18 0  181  5.3e-018 1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK

2.    mCwp1.2                           Mass: 18631    Score: 656    Peptides matched: 7
 |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   627.78   1253.55   1253.59   -0.03 0  100  2.9e-009 1  SGGSFAGTVTDAGK
22   499.25   1494.71   1494.77   -0.05 1  61  1.9e-005 1  SGGSFAGTVTDAGKLK
 26   780.82   1559.63   1559.73   -0.09 0  68  4.1e-006 1  GNSGFFAIPSGSEYK
 38   858.87   1715.73   1715.80   -0.07 0  129  2.7e-012 1  FSDNTYAVVNSDGSIK
 39   572.92   1715.74   1715.80   -0.06 0  (38) 0.0035 1  FSDNTYAVVNSDGSIK
 42   1058.44   2114.86   2114.98   -0.11 0  141  1.1e-013 1  TGSESEGTSGFALSGSHLTYK
 48   1055.16   3162.45   3162.63   -0.18 0  157  1.5e-015 2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK

3.    mSSr1                             Mass: 19214    Score: 201    Peptides matched: 4
 |validated by us| CAGL0H06413g similar to sp|O13547 Saccharomyces cerevisiae YLR390wa CW14, start b
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
30   538.93   1613.76   1613.83   -0.07 0  (50) 0.00024 1  TPPACLLACVAQVSK
31   807.89   1613.76   1613.83   -0.07 0  117  4.7e-011 1  TPPACLLACVAQVSK
45   1109.91   2217.80   2216.95   0.86 0  16  0.29 1  NCLDSICPNGNSDAAYTAFK
47   909.02   2724.04   2724.17   -0.13 0  68  1.2e-006 1  QSSQCHTLNQVGCFCENENTAIK

4.    CAGL0I06160g                      Mass: 24169    Score: 191    Peptides matched: 2
 highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   551.79   1101.57   1101.60   -0.03 0  83  2e-007 1  NDGTLQLTLK
36   565.27   1692.78   1692.84   -0.06 1  108  3.7e-010 1  ESSCKNDGTLQLTLK

 
      Proteins matching the same set of peptides:
      mPir4p.1                          Mass: 22496    Score: 191    Peptides matched: 2
 |predicted-NN| 216aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|C
      mPir4p.2                          Mass: 22425    Score: 191    Peptides matched: 2
 |predicted-HMM| 215aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|
5.    CAGL0G09449g                      Mass: 48063    Score: 135    Peptides matched: 2
 similar to sp|P53301 Saccharomyces cerevisiae YGR189c CRH1, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
14   614.27   1226.53   1226.56   -0.03 0  55  9.4e-005 1  YQQAQEDFAK
32   809.86   1617.70   1617.75   -0.05 0  80  2.2e-007 1  ALATSFSENFTSESK

 
      Proteins matching the same set of peptides:
      mCrh1p                            Mass: 45943    Score: 135    Peptides matched: 2
 |predicted| 432aa Similar to P53301 S.cerevisiae YGR189c CRH1 CAGL0G09449g|CAGL-IPF1559|CAGL-CDS237
6.    CAGL0I06182g                      Mass: 34833    Score: 114    Peptides matched: 2
 highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c PIR1, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   415.23   828.45   828.48   -0.03 0  42  0.0027 1  IGSIVANR
13   607.78   1213.54   1213.58   -0.04 0  72  2.2e-006 1  APNDPVGAVSCK

 
      Proteins matching the same set of peptides:
      mPir2p.1                          Mass: 33013    Score: 114    Peptides matched: 2
 |predicted-NN| 322aa Highly similar to S.cerevisiae YKL164c (Pir1) CAGL0I06182g|CAGL-IPF1404|CAGL-C
      mPir2p.2                          Mass: 32525    Score: 114    Peptides matched: 2
 |predicted-HMM| 317aa Highly similar to S.cerevisiae YKL164c (Pir1) CAGL0I06182g|CAGL-IPF1404|CAGL-
7.    CAGL0G00308g                      Mass: 39767    Score: 97     Peptides matched: 1
 similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
35   843.86   1685.71   1685.77   -0.06 0  97  3.9e-009 1  LYGTDCNQVENVFK

 
      Proteins matching the same set of peptides:
      mCAGL0G00308g                     Mass: 38048    Score: 97     Peptides matched: 1
 |predicted| 357aa Similar to P53334 S. cerevisiae YGR279c SCW4 CAGL0G00308g|CAGL-IPF3933|CAGL-CDS29
8.    CAGL0M08492g                      Mass: 34283    Score: 86     Peptides matched: 2
 highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c required forlerance to heat shock, sta
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   415.23   828.45   828.48   -0.03 0  42  0.0027 1  IGSIVANR
6   523.27   1044.53   1044.56   -0.02 1  44  0.0016 1  GGILTDEKGR

 
      Proteins matching the same set of peptides:
      mPir3p                            Mass: 32307    Score: 86     Peptides matched: 2
 |predicted| 316aa Highly similar to S.cerevisiae YKL164c (Pir1) CAGL0M08492g|CAGL-IPF8003|CAGL-CDS3
9.    CAGL0J11748g                      Mass: 75039    Score: 57     Peptides matched: 1
 similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Saccharomyces cerevisiae YM
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   587.80   1173.58   1173.61   -0.03 0  57  6.5e-005 1  WTAIGSQVQGK

 
      Proteins matching the same set of peptides:
      mPlb2                             Mass: 73258    Score: 57     Peptides matched: 1
 |predicted| CAGL0J11748g similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Sa
10.   CAGL0F01463g                      Mass: 21450    Score: 53     Peptides matched: 1
 similar to sp|P10863 Saccharomyces cerevisiae YER011w TIR1, start by similarity [Candida glabrata]
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   420.75   839.48   839.51   -0.03 0  53  0.00013 1  GIEALLPK

 
      Proteins matching the same set of peptides:
      mCAGL0F01463g                     Mass: 19557    Score: 53     Peptides matched: 1
 |predicted| 202aa Similar to P10863 S. cerevisiae YER011w TIR1 CAGL0F01463g|CAGL-IPF9579|CAGL-CDS4
11.   CAGL0M01826g                      Mass: 43265    Score: 34     Peptides matched: 1
 highly similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerev
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   649.83   1297.64   1297.67   -0.03 0  36  0.0076 1  EVNVLNINNNR

 
      Proteins matching the same set of peptides:
      mCAGL0M01826g                     Mass: 41542    Score: 34     Peptides matched: 1
 |predicted| 404aa Highly similar to 38248 S.cerevisiae YBR078w ECM33 CAGL0M01826g|CAGL-IPF6362|CAGL
12.   CAGL0J08756g                      Mass: 95832    Score: 18     Peptides matched: 1
 similar to tr|Q05787 Saccharomyces cerevisiae YLR207w HRD3 involved in degradation of HMG2P, hypoth
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   599.83   1197.64   1198.68   -1.04 1  18  0.46 1  GLSTVPQSVRR

13.   CAGL0E04620g                      Mass: 44251    Score: 17     Peptides matched: 1
 similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerevisiae Y
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   469.71   937.41   937.44   -0.03 0  17  0.65 1  DVDEVSFK

14.   CAGL0F08371g                      Score: 17     Peptides matched: 1
 highly similar to sp|P53322 Saccharomyces cerevisiae YGR260w TNA1, hypothetical start [Candida glabrata] Complete CDS. CAGL0F08371g|CAGL-IPF611|CAGL-CDS1914.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   523.27   1044.53   1044.56   -0.02 1  17  0.93 3  KVLESANER

15.   CAGL0K08514g                      Mass: 167185   Score: 16     Peptides matched: 1
 similar to sp|P34244 Saccharomyces cerevisiae YKL101w serine/threonine-protein kinase, hypothetical
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   634.79   1267.57   1268.67   -1.10 1  18  0.44 2  SLYSQTSISKR

16.   CAGL0L04532g                      Score: 15     Peptides matched: 1
 highly similar to sp|P13188 Saccharomyces cerevisiae YOR168w GLN4, hypothetical start [Candida glabrata] Complete CDS. CAGL0L04532g|CAGL-IPF8133|CAGL-CDS0823.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   523.27   1044.53   1044.62   -0.09 0  17  0.93 2  LNITGTVLSK

17.   CAGL0H02431g                      Score: 14     Peptides matched: 1
 similar to sp|Q03496 Saccharomyces cerevisiae YMR259c, hypothetical start [Candida glabrata] Complete CDS. CAGL0H02431g|CAGL-IPF8739|CAGL-CDS0139.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   551.79   1101.57   1100.62   0.96 1  14  1.5 2  LDETILRNK

18.   CAGL0L09823g                      Mass: 83199    Score: 13     Peptides matched: 1
 some similarities with sp|P09798 Saccharomyces cerevisiae YKL022c CDC16, hypothetical start [Candid
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   409.71   817.40   817.42   -0.02 0  13  2.4 1  IESDGGIK

19.   CAGL0H03421g                      Score: 13     Peptides matched: 1
 weakly similar to sp|P53159 Saccharomyces cerevisiae YGL075c MPS2, start by similarity [Candida glabrata] Complete CDS. CAGL0H03421g|CAGL-IPF1930|CAGL-CDS3110.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   551.79   1101.57   1101.60   -0.03 1  13  1.9 3  SKADSLGSPIK

20.   sw|P04264|K2C1_HUMAN              Mass: 66018    Score: 12     Peptides matched: 1
 Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protei
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   517.24   1032.48   1032.51   -0.03 0  12  2.4 1  TLLEGEESR

Peptide matches not assigned to protein hits: (no details means no match)
List sorted by Decreasing Score. Sort by Decreasing Intensity or Increasing Query # / Mr

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   577.27   1152.53   1152.54   -0.01 1  12  2.1 1  FVDDSEKTGR
34   559.26   1674.77   1674.88   -0.11 1  11  1.9 1  KLLHITPDFHPDSR
20   671.84   1341.67   1341.75   -0.08 1  9  3.7 1  QGTRYVHQILK
8   556.27   1110.53   1111.51   -0.98 0  8  4.5 1  DHPMINGNSK
29   533.54   1597.61   1597.83   -0.21 1  8  3.2 1  KAYGFTITIHEYR
9   567.78   1133.54   1134.65   -1.11 1  4  16 1  YIPLLTCKK
41   585.57   1753.68   1753.74   -0.06 0  4  8 1  FESQSNDNELNENSK
19   660.78   1319.54   1319.68   -0.14 0  2  20 1  VDLGNLTAQAYR
18   436.17   1305.50   1306.66   -1.16 1  0  25 1  EDASICLPFKK
21   747.28   1492.55         
25   772.32   1542.63         
27   787.38   1572.75         
28   526.89   1577.65         
33   546.26   1635.75         
37   849.86   1697.71         
40   865.86   1729.71         
43   539.22   2152.85         
44   728.99   2183.95         
46   778.05   2331.13         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Data File Name         : cw0106_q5.pkl
Number of queries      : 48

Mascot:  http://www.matrixscience.com/ 

Top scoring peptide matches to query 1
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 13.4   -0.02  18                      CAGL0L09823g  IESDGGIK
 12.2   -1.03                                        NTETRAK
  7.1    0.02                                        IEEGENK
  4.5   -0.07                                        LKIDSSR
  4.0   -0.09                                        LTEIKSK
  4.0   -1.00                                        LGMQDQK
  3.9   -0.02                                        ILENSDK
  3.1   -0.05                                        LESKWR
  3.1   -0.02                                        IDTNVEK
  3.1   -0.09                                        IESTLKK
Top scoring peptide matches to query 2
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 42.2   -0.03   6+                     CAGL0I06182g  IGSIVANR
  6.6   -1.05                                        NGASKILK
  6.4   -0.03                                        SGLLGLNR
  5.9   -0.02                                        GSLLPTNK
  5.6   -0.04                                        GILSQRR
  4.1   -0.06                                        SAVLAQLK
  3.8    0.96                                        AANILQAK
  3.6   -0.03                                        IGRNLEK
  2.8    0.00                                        LNLEQGR
  2.6   -0.97                                        NGAYHLR
Top scoring peptide matches to query 3
Score greater than 25 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 53.5   -0.03  10                      CAGL0F01463g  GIEALLPK
  9.0   -0.99                                        ENQLIPK
  8.1    0.01                                        EEPKLPK
  7.7   -0.04                                        GLVTPVVR
  5.2   -0.95                                        AAVLENPQ
  4.0   -0.94                                        REAGSHGK
  3.4   -0.04                                        KVQQIPK
  3.4   -0.00                                        QQQVIPK
  3.1   -0.04                                        VDRLPLK
  3.1   -1.02                                        GIALTAAPK
Top scoring peptide matches to query 4
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 17.0   -0.03  13                      CAGL0E04620g  DVDEVSFK
  3.6   -0.07                                        ITDALSYR
  2.0   -1.03                                        QSFSTNGAK
  1.9   -0.01                                        VDPMYDAK
  1.9   -1.11                                        SKYIMLGK
  1.4   -1.06                                        NTYEATIK
  1.4   -0.00                                        DVEYEQR
  1.2   -0.07                                        TIEKYER
  1.1   -1.09                                        SKEATIYK
  1.1    0.96                                        RGMVDMTK
Top scoring peptide matches to query 5
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 12.3   -0.03  20              sw|P04264|K2C1_HUMAN  TLLEGEESR
  8.2    0.85                                        NVLPHVVVR
  4.0   -1.08                                        QLSKSTGWK
  2.9   -0.02                                        ADLELACNK
Top scoring peptide matches to query 6
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 44.3   -0.02   8                      CAGL0M08492g  GGILTDEKGR
 16.6   -0.09  16                      CAGL0L04532g  LNITGTVLSK
 16.5   -0.02  14                      CAGL0F08371g  KVLESANER
 11.6    0.01                                        GLGLDDTGAAR
 10.2   -1.03                                        LDITEEAKK
 10.2   -1.07                                        EVLTTKDLK
  9.0    0.02                                        NLLEDQDAK
  8.1   -0.01                                        NLVSELADGK
  4.1    0.99                                        INSYTYRK
  3.8    0.95                                        IIVEADEKK
Top scoring peptide matches to query 7
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 82.9   -0.03   4                      CAGL0I06160g  NDGTLQLTLK
 14.0    0.96  17                      CAGL0H02431g  LDETILRNK
 13.1   -0.03  19                      CAGL0H03421g  SKADSLGSPIK
 11.9    0.89                                        DLLIKTGLTK
 11.9    0.96                                        DIREQVITK
 10.2    0.93                                        IDAITVKDVK
  9.6   -0.08                                        DMRILLITK
  9.3    0.93                                        DLPISKSTLK
  8.2   -1.07                                        SVTVSRISVR
  8.1   -0.06                                        SKALSLSPATK
Top scoring peptide matches to query 8
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.1   -0.98                                        DHPMINGNSK
  6.1   -0.13                                        LHTKLMAGLK
  3.0   -0.03                                        SDNLNQHKR
  1.9   -1.03                                        FSNDFLEIK
  0.9   -0.13                                        VAPELWLKR
Top scoring peptide matches to query 9
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.6   -1.11                                        YIPLLTCKK
  0.6    0.98                                        ADSLTQEELK
  0.2    0.90                                        GRPSSFKVQK
  0.1    0.03                                        VDNEQDMRK
Top scoring peptide matches to query 10
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 11.8   -0.01                                        FVDDSEKTGR
  3.6   -0.11                                        SASRAVFLFR
  3.3   -0.07                                        AEKDYTSVLK
  2.7   -0.06                                        KYLFNSPER
  2.6    0.90                                        IVHSPIDMLK
  1.6   -0.05                                        SETTKSLTMR
  1.2   -0.08                                        NKHINQLMR
  0.8   -1.11                                        VAYVYLLASR
  0.3   -0.07                                        AFIRTFQDR
  0.1   -0.08                                        KWAGAQHLSR
Top scoring peptide matches to query 11
Score greater than 25 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 57.2   -0.03   9                      CAGL0J11748g  WTAIGSQVQGK
  9.3   -0.07                                        SYPQQVLALR
  8.1   -0.10                                        KIPHNLIDPK
  6.9   -0.10                                        SIKDCVIVLK
  6.4   -1.03                                        ELQFQQLNR
  2.0   -0.07                                        WSGLVESKLR
Top scoring peptide matches to query 12
Score greater than 23 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 18.1   -1.04  12                      CAGL0J08756g  GLSTVPQSVRR
  9.0   -1.03                                        GNIAQAKQELK
  4.6   -0.04                                        FANVPVVIDPK
  4.5   -0.02                                        EQTRNAVRPK
  4.4   -0.98                                        IGTEDSSLHLK
Top scoring peptide matches to query 13
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 71.8   -0.04   6                      CAGL0I06182g  APNDPVGAVSCK
  1.5   -0.16                                        AVNILSDILTR
Top scoring peptide matches to query 14
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 54.7   -0.03   5                      CAGL0G09449g  YQQAQEDFAK
  1.6   -0.10                                        KYAANEYQIK
Top scoring peptide matches to query 15
Score greater than 25 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
100.0   -0.03   2                           mCwp1.2  SGGSFAGTVTDAGK
  6.7   -0.17                                        YLLVNHLINR
  4.9    0.87                                        FSAEALSFLIR
  3.0   -1.11                                        TFELSKEFVR
  2.9   -1.05                                        LCYDSKISNR
  1.6    0.97                                        RNMSDSTSLSR
  0.7    0.96                                        NVYETVTGDQK
  0.5   -1.03                                        SSSTNSNSSTRK
Top scoring peptide matches to query 16
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
119.3   -0.03   1                           mCwp1.1  TGGSFAGTVTDAGK
 18.2   -1.10  15                      CAGL0K08514g  SLYSQTSISKR
  5.5    0.96                                        QFDTADSVVTGK
  4.5   -0.07                                        SSIDSDTRFLK
  1.1    0.06                                        EEYWDNNNGK
Top scoring peptide matches to query 17
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 35.7   -0.03  11                      CAGL0M01826g  EVNVLNINNNR
  5.3   -0.08                                        LTSAQSATPVPVK
Top scoring peptide matches to query 18
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.4   -1.16                                        EDASICLPFKK
Top scoring peptide matches to query 19
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.6   -0.14                                        VDLGNLTAQAYR
  0.6    0.88                                        EYLWAFVTYK
  0.4   -0.22                                        EVQHLNAIIKR
Top scoring peptide matches to query 20
Score greater than 21 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.1   -0.08                                        QGTRYVHQILK
  8.8    0.89                                        ASAQDIRLNLLK
  8.8   -0.15                                        VCKLWALIIVK
  7.5    0.91                                        EIQNLNEKILK
  6.4   -1.05                                        CVRGFDHVLLK
  5.7   -0.09                                        QELTERNVILK
  3.5    0.05                                        DGPPQDMNDIIK
  2.4    0.89                                        QQTLLLNDRLK
  1.0    1.03                                        QKTLEDSTYEK
  0.8   -1.15                                        ALRTTVIETVLK
Top scoring peptide matches to query 21
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 22
Score greater than 16 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 61.1   -0.05   2                           mCwp1.2  SGGSFAGTVTDAGKLK
Top scoring peptide matches to query 23
Score greater than 19 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 99.8   -0.09   1                           mCwp1.1  TGGSFAGTVTDAGKLK
Top scoring peptide matches to query 24
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
122.0   -0.05   1                           mCwp1.1  TGGSFAGTVTDAGKLK
 10.4   -0.06                                        RAYIFFGSHNGLK
  2.6    0.08                                        TETEEFEHGFQR
  2.1    1.09                                        DWPSMNQEDMKK
Top scoring peptide matches to query 25
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 26
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 67.5   -0.09   1+                          mCwp1.1  GNSGFFAIPSGSEYK
Top scoring peptide matches to query 27
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 28
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 29
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.0   -0.21                                        KAYGFTITIHEYR
Top scoring peptide matches to query 30
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 50.3   -0.07   3                             mSSr1  TPPACLLACVAQVSK
Top scoring peptide matches to query 31
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
117.4   -0.07   3                             mSSr1  TPPACLLACVAQVSK
 11.0   -0.01                                        TPNVFDKSGQSSGYK
  4.6    0.84                                        NRVRPSLLTPFWK
Top scoring peptide matches to query 32
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 79.9   -0.05   5                      CAGL0G09449g  ALATSFSENFTSESK
Top scoring peptide matches to query 33
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 34
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.7   -0.11                                        KLLHITPDFHPDSR
Top scoring peptide matches to query 35
Score greater than 19 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 97.1   -0.06   7                      CAGL0G00308g  LYGTDCNQVENVFK
  0.4   -1.10                                        NPLPEVADDTDNFIK
Top scoring peptide matches to query 36
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
108.1   -0.06   4                      CAGL0I06160g  ESSCKNDGTLQLTLK
  7.3    0.94                                        QRMMSALNASEDVIK
  5.8    0.98                                        QSKCQTCGDAPVITK
  2.4   -1.08                                        QMPTSTTAKAWMTLK
  2.3   -1.04                                        HHGSATSGSASQLAQQK
  2.2    0.76                                        AIGPKDIIVALLDNLK
  1.9   -0.14                                        TSHSSSIPPVVGREIK
  1.5   -1.14                                        VQKGGALYYINNNLK
  1.3   -1.07                                        KYDGEQETLVGNTIK
  1.3    0.88                                        YTDQELKDDLVLLK
Top scoring peptide matches to query 37
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 38
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
128.9   -0.07   1+                          mCwp1.1  FSDNTYAVVNSDGSIK
  5.7   -0.11                                        QSNDKSFEASLLSYK
Top scoring peptide matches to query 39
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 37.9   -0.06   1+                          mCwp1.1  FSDNTYAVVNSDGSIK
Top scoring peptide matches to query 40
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 41
Score greater than 14 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.5   -0.06                                        FESQSNDNELNENSK
  1.6   -0.13                                        FVDEDSNSWTNLLSK
Top scoring peptide matches to query 42
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
141.3   -0.11   1+                          mCwp1.1  TGSESEGTSGFALSGSHLTYK
  9.4    0.72                                        SHPIVITLDNTIQKSGTYK
  2.0    0.98                                        AYLASDSDESEEEVNEEAK
  0.6   -0.14                                        TTSNDDPYKSFISPTSIDK
  0.2   -0.36                                        QLELWNTPEILLIHLKR
Top scoring peptide matches to query 43
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 44
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 45
Score greater than 13 indicates homology
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 15.8    0.86   3                             mSSr1  NCLDSICPNGNSDAAYTAFK
Top scoring peptide matches to query 46
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 47
Score greater than 17 indicates homology
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 68.0   -0.13   3                             mSSr1  QSSQCHTLNQVGCFCENENTAIK
Top scoring peptide matches to query 48
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
181.1   -0.18   1                           mCwp1.1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK
156.7   -0.18   2                           mCwp1.2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK
  3.8    0.89                                        CIQADQPITRGTIQTQWLLKPYDECK