Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0106_q4.pkl
Database        : Cglabrata 041110dos (5427 sequences; 2703904 residues)
Timestamp       : 22 Feb 2005 at 14:07:32 GMT
Significant hits: mCwp1.1               |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
                  mCwp1.2               |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1
                  mCrh1p                |predicted| 432aa Similar to P53301 S.cerevisiae YGR189c CRH1 CAGL0G09449g|CAGL-IPF1559|CAGL-CDS237
                  CAGL0C02211g          similar to sp|P32623 Saccharomyces cerevisiae YEL040w UTR2 cell wall protein, hypothetical start [C
                  CAGL0G00308g          similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
                  CAGL0I06182g          highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c PIR1, start by similarity [Candida gla
                  CAGL0J11748g          similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Saccharomyces cerevisiae YM
                  sw|P04264|K2C1_HUMAN  Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protei
                  sw|P04104|K2C1_MOUSE  Keratin, type II cytoskeletal 1 (Cytokeratin 1) (67 kDa cytokeratin)
                  CAGL0F01287g          highly similar to sp|Q08193 Saccharomyces cerevisiae YOL030w, hypothetical start [Candida glabrata]
                  CAGL0M08492g          highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c required forlerance to heat shock, sta
                  CAGL0F03883g          similar to sp|Q03655 Saccharomyces cerevisiae YMR215w, start by similarity [Candida glabrata] Compl
                  CAGL0E04620g          similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerevisiae Y
                  CAGL0F01463g          similar to sp|P10863 Saccharomyces cerevisiae YER011w TIR1, start by similarity [Candida glabrata] 
                  CAGL0M13849g          highly similar to sp|P22146 Saccharomyces cerevisiae YMR307w GAS1 glycophospholipid-anchored surfac

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 27 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

Switch to Protein Summary Report

To create a bookmark for this report, right click this link: Peptide Summary Report (../data/20050222/F002682.dat)

        Error tolerant   

1.    mCwp1.1                           Mass: 19256    Score: 579    Peptides matched: 5
 |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
25   634.78   1267.55   1267.60   -0.05 0  126  7.9e-012 1  TGGSFAGTVTDAGK
47   858.94   1715.86   1715.80   0.06 0  79  3e-007 1  FSDNTYAVVNSDGSIK
54   1058.49   2114.97   2114.98   -0.01 0  185  5.9e-018 1  TGSESEGTSGFALSGSHLTYK
69   1055.20   3162.59   3162.63   -0.04 0  190  7.4e-019 1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK
70   791.66   3162.62   3162.63   -0.01 0  (89) 8.9e-009 1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK

2.    mCwp1.2                           Mass: 18631    Score: 466    Peptides matched: 5
 |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
37   499.27   1494.79   1494.77   0.03 1  35  0.0086 1  SGGSFAGTVTDAGKLK
 47   858.94   1715.86   1715.80   0.06 0  79  3e-007 1  FSDNTYAVVNSDGSIK
 54   1058.49   2114.97   2114.98   -0.01 0  185  5.9e-018 1  TGSESEGTSGFALSGSHLTYK
 69   1055.20   3162.59   3162.63   -0.04 0  169  1e-016 2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK
 70   791.66   3162.62   3162.63   -0.01 0  (85) 2.4e-008 2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK

3.    mCrh1p                            Mass: 45943    Score: 204    Peptides matched: 4
 |predicted| 432aa Similar to P53301 S.cerevisiae YGR189c CRH1 CAGL0G09449g|CAGL-IPF1559|CAGL-CDS237
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   488.78   975.54   975.51   0.03 1  40  0.0047 1  RFDNPSLK
16   561.78   1121.55   1121.52   0.03 0  40  0.0038 1  SNFYIMYGK
22   614.30   1226.59   1226.56   0.04 0  75  9e-007 1  YQQAQEDFAK
67   967.12   2898.35   2898.36   -0.01 1  49  0.0001 1  SLVVTDYSTGKEYTYGDQSGSWQSIK

 
      Proteins matching the same set of peptides:
      CAGL0G09449g                      Mass: 48063    Score: 202    Peptides matched: 4
 similar to sp|P53301 Saccharomyces cerevisiae YGR189c CRH1, hypothetical start [Candida glabrata] C
4.    CAGL0C02211g                      Mass: 53039    Score: 196    Peptides matched: 2
 similar to sp|P32623 Saccharomyces cerevisiae YEL040w UTR2 cell wall protein, hypothetical start [C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
32   690.32   1378.63   1378.59   0.04 1  87  6.6e-008 1  DSSTKFDDYSSK
49   887.41   1772.80   1772.79   0.01 0  109  2.4e-010 1  FSFSIDSCVPMPVCK

 
      Proteins matching the same set of peptides:
      mUtr2p                            Mass: 50964    Score: 196    Peptides matched: 2
 |predicted| 462aa Similar to P32623 S.cerevisiae YEL040w UTR2 CAGL0C02211g|CAGL-IPF1070|CAGL-CDS218
5.    CAGL0G00308g                      Mass: 39767    Score: 191    Peptides matched: 2
 similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
46   843.90   1685.79   1685.77   0.02 0  105  7.4e-010 1  LYGTDCNQVENVFK
52   975.00   1947.99   1947.99   0.00 0  87  3.9e-008 1  DASAVASDLAALSQYPTIR

 
      Proteins matching the same set of peptides:
      mCAGL0G00308g                     Mass: 38048    Score: 191    Peptides matched: 2
 |predicted| 357aa Similar to P53334 S. cerevisiae YGR279c SCW4 CAGL0G00308g|CAGL-IPF3933|CAGL-CDS29
6.    CAGL0I06182g                      Mass: 34833    Score: 166    Peptides matched: 2
 highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c PIR1, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   415.24   828.47   828.48   -0.01 0  54  0.00017 1  IGSIVANR
21   607.81   1213.61   1213.58   0.03 0  112  2.2e-010 1  APNDPVGAVSCK

 
      Proteins matching the same set of peptides:
      mPir2p.1                          Mass: 33013    Score: 166    Peptides matched: 2
 |predicted-NN| 322aa Highly similar to S.cerevisiae YKL164c (Pir1) CAGL0I06182g|CAGL-IPF1404|CAGL-C
      mPir2p.2                          Mass: 32525    Score: 166    Peptides matched: 2
 |predicted-HMM| 317aa Highly similar to S.cerevisiae YKL164c (Pir1) CAGL0I06182g|CAGL-IPF1404|CAGL-
7.    CAGL0J11748g                      Mass: 75039    Score: 164    Peptides matched: 3
 similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Saccharomyces cerevisiae YM
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   482.28   962.54   962.52   0.02 0  35  0.013 1  DALQTFLR
19   587.83   1173.64   1173.61   0.03 0  60  3.4e-005 1  WTAIGSQVQGK
43   543.62   1627.85   1627.82   0.03 1  69  2.7e-006 1  NAADGLSPAEKEWLK

 
      Proteins matching the same set of peptides:
      mPlb2                             Mass: 73258    Score: 164    Peptides matched: 3
 |predicted| CAGL0J11748g similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Sa
8.    sw|P04264|K2C1_HUMAN              Mass: 66018    Score: 140    Peptides matched: 3
 Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protei
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   517.27   1032.53   1032.51   0.02 0  14  1.6 1  TLLEGEESR
34   465.26   1392.77   1392.72   0.04 1  29  0.034 1  TNAENEFVTIKK
35   738.41   1474.80   1474.78   0.02 0  99  3.7e-009 1  FLEQQNQVLQTK

9.    sw|P04104|K2C1_MOUSE              Mass: 65565    Score: 133    Peptides matched: 3
 Keratin, type II cytoskeletal 1 (Cytokeratin 1) (67 kDa cytokeratin)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   567.81   1133.60   1133.57   0.04 1  4  13 5  VDSLKSDQSR
 34   465.26   1392.77   1392.72   0.04 1  29  0.034 1  TNAENEFVTIKK
 35   738.41   1474.80   1474.81   -0.01 1  99  3.7e-009 1  FLEQQNKVLQTK

10.   CAGL0F01287g                      Mass: 52284    Score: 66     Peptides matched: 2
 highly similar to sp|Q08193 Saccharomyces cerevisiae YOL030w, hypothetical start [Candida glabrata]
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   451.27   900.52   900.50   0.02 0  22  0.32 1  DLGINTIR
28   665.81   1329.60   1329.56   0.04 0  45  0.0011 1  GNAFFDSSSNER

 
      Proteins matching the same set of peptides:
      mCAGL0F01287g                     Mass: 50421    Score: 66     Peptides matched: 2
 |predicted| highly similar to sp|Q08193 Saccharomyces cerevisiae YOL030w, hypothetical start [Candi
11.   CAGL0M08492g                      Mass: 34283    Score: 64     Peptides matched: 2
 highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c required forlerance to heat shock, sta
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   415.24   828.47   828.48   -0.01 0  54  0.00017 1  IGSIVANR
 13   522.81   1043.60   1044.56   -0.95 1  10  3.9 2  GGILTDEKGR

 
      Proteins matching the same set of peptides:
      mPir3p                            Mass: 32307    Score: 64     Peptides matched: 2
 |predicted| 316aa Highly similar to S.cerevisiae YKL164c (Pir1) CAGL0M08492g|CAGL-IPF8003|CAGL-CDS3
12.   CAGL0F03883g                      Mass: 57350    Score: 53     Peptides matched: 1
 similar to sp|Q03655 Saccharomyces cerevisiae YMR215w, start by similarity [Candida glabrata] Compl
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   811.44   1620.87   1620.86   0.00 0  53  0.00012 1  DAFVFQQLGINTIR

 
      Proteins matching the same set of peptides:
      mCAGL0F03883g                     Mass: 55584    Score: 53     Peptides matched: 1
 |predicted| similar to sp|Q03655 Saccharomyces cerevisiae YMR215w, start by similarity [Candida gla
13.   CAGL0E04620g                      Mass: 44251    Score: 48     Peptides matched: 1
 similar to sp|P38248 Saccharomyces cerevisiae YBR078w ECM33 or sp|Q12355 Saccharomyces cerevisiae Y
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
20   597.80   1193.58   1193.55   0.03 0  48  0.00045 1  GGIQGDNFVCK

14.   CAGL0F01463g                      Mass: 21450    Score: 40     Peptides matched: 1
 similar to sp|P10863 Saccharomyces cerevisiae YER011w TIR1, start by similarity [Candida glabrata]
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   420.77   839.52   839.51   0.01 0  40  0.0032 1  GIEALLPK

 
      Proteins matching the same set of peptides:
      mCAGL0F01463g                     Mass: 19557    Score: 40     Peptides matched: 1
 |predicted| 202aa Similar to P10863 S. cerevisiae YER011w TIR1 CAGL0F01463g|CAGL-IPF9579|CAGL-CDS4
15.   CAGL0M13849g                      Mass: 61157    Score: 38     Peptides matched: 1
 highly similar to sp|P22146 Saccharomyces cerevisiae YMR307w GAS1 glycophospholipid-anchored surfac
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
44   546.61   1636.80   1636.77   0.03 1  38  0.0039 1  KIPVGYSSNDDADTR

 
      Proteins matching the same set of peptides:
      mGas2p                            Mass: 58873    Score: 38     Peptides matched: 1
 |predicted| 543aa Highly similar to |P22146 S. cerevisiae YMR307w GAS1 CAGL0M13849g|CAGL-IPF6049|CA
16.   CAGL0M02255g                      Mass: 41661    Score: 27     Peptides matched: 1
 highly similar to tr|Q12461 Saccharomyces cerevisiae YPL152w RRD2, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   466.27   930.53   930.54   -0.01 1  27  0.099 1  ILTDKDVK

17.   CAGL0K08514g                      Mass: 167185   Score: 24     Peptides matched: 2
 similar to sp|P34244 Saccharomyces cerevisiae YKL101w serine/threonine-protein kinase, hypothetical
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   577.30   1152.58   1151.60   0.97 1  8  5.5 1  RFSSLTQTGR
 25   634.78   1267.55   1268.67   -1.12 1  18  0.41 2  SLYSQTSISKR

18.   sw|P50446|K2C6_MOUSE              Score: 20     Peptides matched: 1
 Keratin, type II cytoskeletal 6 (Cytokeratin 6) (CK 6) (K6 keratin)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 34   465.26   1392.77   1393.71   -0.94 1  20  0.31 2  TDAENEFVTLKK

19.   sw|P05787|K2C8_HUMAN              Mass: 53510    Score: 18     Peptides matched: 1
 Keratin, type II cytoskeletal 8 (Cytokeratin 8) (K8) (CK 8)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 35   738.41   1474.80   1474.69   0.11 0  18  0.49 3  LESGMQNMSIHTK

 
      Proteins matching the same set of peptides:
      sw|Q10758|K2C8_RAT                Score: 18     Peptides matched: 1
      sw|P05786|K2C8_BOVIN              Score: 16     Peptides matched: 1
      sw|P11679|K2C8_MOUSE              Score: 16     Peptides matched: 1
20.   CAGL0C05313g                      Score: 16     Peptides matched: 1
 similar to sp|P12945 Saccharomyces cerevisiae YDL040c NAT1, start by similarity [Candida glabrata] Complete CDS. CAGL0C05313g|CAGL-IPF4087|CAGL-CDS0713.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   488.78   975.54   975.54   0.00 0  18  0.73 2  GVPATFGSLK

Peptide matches not assigned to protein hits: (no details means no match)
List sorted by Decreasing Score. Sort by Decreasing Intensity or Increasing Query # / Mr

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
29   674.83   1347.64   1347.68   -0.04 1  14  1.1 1  LLDGVADGSMRSK
13   522.81   1043.60   1044.52   -0.92 0  14  1.7 1  GLGLDDTGAAR
15   556.30   1110.58   1110.66   -0.08 1  11  2.3 1  LHTKLMAGLK
6   446.74   891.46   891.48   -0.01 1  11  3.8 1  SGSLTGSRK
40   527.90   1580.67   1580.80   -0.13 1  9  2.5 1  EIKESDLQSITYR
17   567.81   1133.60   1132.64   0.97 1  9  4.4 1  GRPSSFKVQK
3   409.73   817.45   818.42   -0.97 1  8  7.5 1  NTETRAK
41   800.35   1598.69   1598.76   -0.07 1  8  3.5 1  DSTGASINTEKWYK
30   676.38   1350.74   1350.76   -0.02 1  8  4.5 1  LKCAETLLYLK
14   538.80   1075.59   1076.54   -0.95 0  8  6.5 1  LSPEEVFEK
45   553.29   1656.85   1655.89   0.96 1  6  5.5 1  CDILPRTPTEITIK
27   653.80   1305.59   1305.53   0.06 1  6  7.5 1  AENDENDEDKK
60   1137.07   2272.12   2272.10   0.02 1  6  4.1 1  FGSENCVLWCKENLYIIK
33   695.35   1388.69   1388.65   0.04 0  5  8.6 1  EQQRPQTTEVSS
26   645.82   1289.62   1289.64   -0.02 1  5  9.7 1  GFNSVYYGQKK
55   1082.02   2162.02   2161.99   0.04 1  4  6.5 1  QNGDGANVNIEDKEAAENFK
36   747.32   1492.62   1493.78   -1.16 0  3  11 1  FELHQMIVVHGGK
62   1167.09   2332.17   2332.03   0.14 1  2  8 1  FYCDECCGLQEAERVVGLK
53   981.90   1961.79   1961.01   0.77 0  2  9.2 1  AAEMEAIDTLLITSNTLR
2   406.25   810.48   811.39   -0.91 0  2  19 1  NGPAYYK
51   946.93   1891.86   1892.04   -0.19 0  1  15 1  IAVQVILTQAATEFFNK
50   920.96   1839.91   1839.98   -0.07 1  1  17 1  LRESGLHTVEAVAYAPK
56   1082.02   2162.03   2161.09   0.94 1  1  13 1  FQRPLPTKSNRPCSVCSK
39   766.40   1530.79   1530.91   -0.12 0  1  21 1  ILIIPVGHIDNLSK
57   721.70   2162.08   2160.94   1.14 0  0  14 1  DSNFTEFEELIDPEFDSK
23   625.82   1249.62   1248.64   0.98 1  0  28 1  MTNEITGVEKK
1   436.90   435.89         
11   510.77   1019.52         
24   631.34   1260.66         
31   454.90   1361.69         
38   503.95   1508.82         
48   881.44   1760.87         
58   732.34   2193.99         
59   754.75   2261.22         
61   758.39   2272.16         
63   593.56   2370.20         
64   816.11   2445.30         
65   853.80   2558.39         
66   641.26   2561.00         
68   1040.81   3119.41         
71   1062.87   3185.58         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Data File Name         : cw0106_q4.pkl
Number of queries      : 71

Mascot:  http://www.matrixscience.com/ 

Top scoring peptide matches to query 1
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 2
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.9   -0.91                                        NGPAYYK
  0.6    0.11                                        LGDMYGR
Top scoring peptide matches to query 3
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.4   -0.97                                        NTETRAK
  7.6   -0.00                                        VDDITKK
  6.5    0.03                                        IESDGGIK
  5.7    0.00                                        TLMNAIR
  4.9   -0.93                                        ASGDTAVQA
  4.7    0.00                                        IELCKR
  3.6   -0.04                                        LTEIKSK
  3.1    0.99                                        TLDDLLK
  2.3    1.04                                        AEQDAKR
  1.9    0.01                                        LESKWR
Top scoring peptide matches to query 4
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 54.0   -0.01   6+                     CAGL0I06182g  IGSIVANR
 14.9   -0.01                                        SGLLGLNR
  7.1   -0.01                                        IGRNLEK
  6.6   -1.03                                        NGASKILK
  6.6   -0.95                                        NGAYHLR
  6.2   -0.01                                        GIVTLGGGR
  5.7   -0.03                                        SAVLAQLK
  5.5    0.06                                        LTYYNR
  5.4    0.99                                        AANILQAK
  3.8   -1.05                                        LGSLTVLK
Top scoring peptide matches to query 5
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 39.6    0.01  14                      CAGL0F01463g  GIEALLPK
 13.6    0.00                                        GLVTPVVR
  5.4   -0.95                                        ENQLIPK
  5.1   -0.90                                        REAGSHGK
  4.0   -0.96                                        RQDVVPK
  3.1    0.04                                        QQQVIPK
  3.0    0.11                                        TVDGPSHK
  2.8    0.05                                        EEPKLPK
  2.1   -1.03                                        KILALQR
  1.9   -1.00                                        LGLGRIGR
Top scoring peptide matches to query 6
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.5   -0.01                                        SGSLTGSRK
  4.8    0.05                                        SGFGFYSK
  4.0    1.01                                        WAESSIAK
  3.1    1.09                                        DDHVYDK
  3.0   -0.13                                        KKPVVPPK
  3.0    0.10                                        SSDNGNNGK
  2.1    0.94                                        KFAGIIDK
  1.3   -0.03                                        HPLEALGR
  0.9   -0.99                                        EFELVEK
Top scoring peptide matches to query 7
Score greater than 26 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 21.8    0.02  10                      CAGL0F01287g  DLGINTIR
 12.2   -0.02                                        DIAVLRSK
  8.1    0.99                                        NLVAARTR
  5.4   -0.93                                        DLGNNIEK
  4.1   -1.00                                        AASVAKIDK
  0.6   -0.98                                        SITNSPKR
  0.4    1.00                                        NLLEKQR
  0.3    0.02                                        VEQELKR
  0.3   -0.02                                        VEVIAKSR
  0.2   -1.04                                        AKVTTALAK
Top scoring peptide matches to query 8
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 26.9   -0.01  16                      CAGL0M02255g  ILTDKDVK
 15.5    0.00                                        IIESWKR
  9.3    0.03                                        LLNEISTAA
  8.3    0.00                                        LIEIKCR
  5.5    0.03                                        LVTEENVK
  4.4    0.01                                        ILMEAINK
  4.4   -0.02                                        LLNMIVTK
  4.4   -0.04                                        ILLTESKK
  4.4    0.00                                        ILERSWK
  4.0   -0.09                                        LLFLLGKK
Top scoring peptide matches to query 9
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 34.9    0.02   7                      CAGL0J11748g  DALQTFLR
 14.2    0.04                                        WINFEVR
 11.6   -0.02                                        SVLYNLVR
  9.9    0.09                                        WLDSEWK
  7.7    1.01                                        VAKQPEYK
  7.5    1.07                                        GQIDSISDK
  7.5    0.04                                        LWNDFLR
  4.2    0.99                                        RVGNTLFR
  2.9   -0.96                                        NWQFNKK
  1.0    0.99                                        FTRVAAAAR
Top scoring peptide matches to query 10
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 39.6    0.03   3                            mCrh1p  RFDNPSLK
 17.7    0.00  20                      CAGL0C05313g  GVPATFGSLK
 15.0    0.02                                        KSDVAESLK
 12.6    0.06                                        ELSEEELK
 11.7   -0.91                                        DCEELALK
 11.7    0.02                                        KMASSSPLR
 11.3    0.03                                        CVIAGLDTK
 10.7    0.02                                        LTTGAGSEIK
  9.2    0.09                                        NQTDEEIK
  9.1    0.00                                        QLFQEALK
Top scoring peptide matches to query 11
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 12
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 14.1    0.02   8              sw|P04264|K2C1_HUMAN  TLLEGEESR
  2.3   -0.01                                        TLTLDDISR
Top scoring peptide matches to query 13
Score greater than 23 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 13.7   -0.92                                        GLGLDDTGAAR
 10.1   -0.95  11                      CAGL0M08492g  GGILTDEKGR
  9.9   -1.01                                        LNITGTVLSK
  7.8   -0.95                                        KVLESANER
  5.2    0.02                                        GLGLLDELSK
  2.3    0.02                                        GRVGSIVSNR
  0.9   -0.90                                        NLLEDQDAK
  0.7   -0.95                                        IRALDESNK
  0.5   -0.95                                        QQIITNSNK
  0.3   -0.94                                        INAQETLEK
Top scoring peptide matches to query 14
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  7.7   -0.95                                        LSPEEVFEK
  5.2    0.02                                        LAESEMRLK
  3.8   -0.91                                        EKQDEAETK
  2.9    0.02                                        AISTGNWSLK
  1.7    1.04                                        RPMNIETSK
  1.6   -1.00                                        SNLFDLLQK
  1.6   -1.03                                        GSQFIVVSLK
  1.2    1.07                                        EDNSLLQEK
  1.1    0.99                                        VIGSVRSTEK
  1.0    0.01                                        ELASLSSIEK
Top scoring peptide matches to query 15
Score greater than 23 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 11.1   -0.08                                        LHTKLMAGLK
  9.9   -0.93                                        DHPMINGNSK
  9.0    1.02                                        DSLVSSDFIK
  5.8    0.02                                        SDNLNQHKR
  3.8    0.11                                        DSPEFTEMR
  3.6   -0.08                                        VVKIGSMHLK
  3.2   -0.12                                        VIGLILDQLK
  3.2   -0.04                                        VVMFFLDLK
  3.2   -0.05                                        VGLPEENIIK
  2.7    1.00                                        DSLIYQLMK
Top scoring peptide matches to query 16
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 39.9    0.03   3                            mCrh1p  SNFYIMYGK
  4.6    0.99                                        AKGYWQSPGK
Top scoring peptide matches to query 17
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.1    0.97                                        GRPSSFKVQK
  8.3    0.09                                        VDNEQDMRK
  8.1   -0.03                                        YLLIELENK
  4.8   -0.02                                        FPQLVIDFR
  4.5    0.04   9              sw|P04104|K2C1_MOUSE  VDSLKSDQSR
  4.0   -0.99                                        LNEEYLINK
  3.3    0.94                                        KIAATFQNLK
  3.3    0.02                                        DVLRTTMGNK
  2.9    0.07                                        DAVTYTEHAK
  2.5    1.02                                        LMEEKLGGEK
Top scoring peptide matches to query 18
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  7.7    0.97  17                      CAGL0K08514g  RFSSLTQTGR
  7.1    0.04                                        FVDDSEKTGR
  3.1   -0.02                                        KYLFNSPER
  1.8   -0.08                                        NIPKIADNIR
  1.4    0.94                                        IVHSPIDMLK
  0.9    0.91                                        YLGKFANLVK
  0.6    0.05                                        SHPDYELHR
  0.5    1.05                                        RFDAQTGSDR
  0.5    0.96                                        RLTEHNLNR
  0.5    0.04                                        DNNRAHDGVR
Top scoring peptide matches to query 19
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 60.0    0.03   7                      CAGL0J11748g  WTAIGSQVQGK
 15.5   -0.01                                        SYPQQVLALR
 11.9   -0.04                                        SIKDCVIVLK
 10.8   -0.04                                        KIPHNLIDPK
  6.4   -1.03                                        DLSRMTIVLK
  6.1    1.01                                        ELDSEQIVIK
  5.6   -0.97                                        ELQFQQLNR
  5.2   -0.99                                        ETKIVQGSGTR
  3.9   -1.09                                        TLYLLVGGIVK
  3.4   -0.95                                        QLGRTEQTDK
Top scoring peptide matches to query 20
Score greater than 24 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 48.4    0.03  13                      CAGL0E04620g  GGIQGDNFVCK
  8.2   -1.04                                        NNKEYLSSLK
  4.1    0.00                                        NLRYGTEADR
  2.4   -1.16                                        LNQILLTRPK
  2.0    0.02                                        SGVSGGGLSSGSSR
  1.0   -1.01                                        DLQSAYKADGK
  0.9   -1.02                                        LNFSCAIGSVK
Top scoring peptide matches to query 21
Score greater than 25 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
111.8    0.03   6                      CAGL0I06182g  APNDPVGAVSCK
  5.5   -0.11                                        QIRPPIYSLK
  0.9   -0.09                                        AVNILSDILTR
Top scoring peptide matches to query 22
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 74.9    0.04   3                            mCrh1p  YQQAQEDFAK
  1.2   -0.14                                        AQKSLGAVVVQK
  1.0   -0.04                                        KYAANEYQIK
  0.5   -1.00                                        FWTEVYQGAK
Top scoring peptide matches to query 23
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.2    0.98                                        MTNEITGVEKK
Top scoring peptide matches to query 24
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 25
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
125.7   -0.05   1                           mCwp1.1  TGGSFAGTVTDAGK
 18.5   -1.12  17                      CAGL0K08514g  SLYSQTSISKR
  8.8   -0.02                                        SSGMSAPTTQSSK
  6.2   -1.14                                        NSLVSTFAFRK
  3.9    0.94                                        QFDTADSVVTGK
  0.7    0.95                                        SAGCFEILSQR
  0.4    0.04                                        EEYWDNNNGK
Top scoring peptide matches to query 26
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.0   -0.02                                        GFNSVYYGQKK
  4.8    1.00                                        SWIECRPDVK
  4.5   -0.09                                        SVVGIGRTMATAK
  4.5    1.06                                        SADEPMTTFYK
  2.4   -0.03                                        SRYWYFLQK
  1.7    0.87                                        SNKPFKLSLQK
Top scoring peptide matches to query 27
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  6.0    0.06                                        AENDENDEDKK
  3.6    0.94                                        TVSLDSSDINVR
  3.2   -1.07                                        EDASICLPFKK
  3.0   -0.07                                        GETKTPNTSLMK
  3.0   -0.06                                        QDADVLNEFKK
  3.0    0.95                                        SQNPQADYKVR
  2.8   -0.07                                        KEAISLDMANSK
  2.5    0.90                                        AFPSLITGEDKK
  1.5    0.98                                        SEEEQEEGLKK
  1.5   -0.14                                        ALKTTVQFDGVK
Top scoring peptide matches to query 28
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 44.6    0.04  10                      CAGL0F01287g  GNAFFDSSSNER
  8.0   -0.96                                        NIYSNSDMTMR
  4.0   -0.14                                        NQFEVLSKLPR
  0.1    0.02                                        NNGYDTEFDKK
Top scoring peptide matches to query 29
Score greater than 25 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 14.2   -0.04                                        LLDGVADGSMRSK
 11.2   -0.17                                        SPSIAPINLLPVK
  6.8   -1.05                                        AAVTEDLQDFIK
  6.2    0.96                                        EKFESLPDNLR
  5.5   -1.08                                        INNATFLWRSK
  4.5    0.06                                        EENITQEDNEK
  4.4   -0.09                                        SRLLVITCGSSR
  2.1   -0.06                                        EEALQFLNKEK
  1.9   -1.01                                        ETDWDSIISGVK
  0.1    0.92                                        QELFAQIKDQK
Top scoring peptide matches to query 30
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.0   -0.02                                        LKCAETLLYLK
  7.0    0.02                                        QIPYFTNDIIK
  6.8    1.02                                        KTSTPSTGVMTIK
  3.5   -0.96                                        FSEKPDIFLEK
  3.3    1.02                                        NFLSSDIADKLK
  2.8   -0.01                                        ELLFILNQAYK
  2.2    0.05                                        CMAIRTMSLIR
  0.4    1.08                                        QQEAQFEKSQK
  0.4    0.06                                        HRGPDWSGNVVK
Top scoring peptide matches to query 31
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 32
Score greater than 21 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 86.5    0.04   4                      CAGL0C02211g  DSSTKFDDYSSK
  3.0    0.92                                        AAEGLRDIYGWK
  2.6    0.91                                        KLMNEDSSTIIK
Top scoring peptide matches to query 33
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.2    0.04                                        EQQRPQTTEVSS
Top scoring peptide matches to query 34
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 29.4    0.04   8+             sw|P04264|K2C1_HUMAN  TNAENEFVTIKK
 19.7   -0.94  18              sw|P50446|K2C6_MOUSE  TDAENEFVTLKK
Top scoring peptide matches to query 35
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 98.7    0.02   8              sw|P04264|K2C1_HUMAN  FLEQQNQVLQTK
 98.7   -0.01   9              sw|P04104|K2C1_MOUSE  FLEQQNKVLQTK
 17.5    0.11  19              sw|P05787|K2C8_HUMAN  LESGMQNMSIHTK
 15.5   -1.00                                        FLEQQNKVLETK
  7.9    0.02                                        LFVDKLIECNPK
  5.7    0.95                                        QTAPVATKIASFIK
  3.5    1.04                                        ELQDIASNSEKLK
  2.7    0.06                                        RTNSEQDTTKPAK
  0.3   -0.96                                        SSQSIEVRTLDNK
  0.2    1.00                                        TMKTFVIHIQEK
Top scoring peptide matches to query 36
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.3   -1.16                                        FELHQMIVVHGGK
  0.8   -0.24                                        FSYALVNLKPITK
Top scoring peptide matches to query 37
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 34.6    0.03   2                           mCwp1.2  SGGSFAGTVTDAGKLK
Top scoring peptide matches to query 38
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 39
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.7   -0.12                                        ILIIPVGHIDNLSK
Top scoring peptide matches to query 40
Score greater than 22 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.3   -0.13                                        EIKESDLQSITYR
  8.5    0.81                                        QLKNLTNSTVSTFK
Top scoring peptide matches to query 41
Score greater than 20 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.2   -0.07                                        DSTGASINTEKWYK
  6.8   -0.20                                        KIIDDSSQGSIIPVK
  6.1   -0.06                                        QNCEINIHKNSDK
  4.8   -0.25                                        KQLNVELPLGTIFK
  4.3   -0.14                                        KYHLQPEDISEIK
  1.1    0.91                                        TKNDDDITSISVYK
  0.8   -0.21                                        QLMCLARALLVPSK
  0.8   -0.16                                        QEEVKPDLSALKDK
  0.6   -0.06                                        KQSHIQANDADNMK
  0.6   -0.10                                        KDNKPVNEPQSDTK
Top scoring peptide matches to query 42
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 52.9    0.00  12                      CAGL0F03883g  DAFVFQQLGINTIR
  1.3    0.09                                        CKDIVAQGVQCSTR
  0.5    0.10                                        WKVSDDSHFFPTR
Top scoring peptide matches to query 43
Score greater than 22 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 69.4    0.03   7                      CAGL0J11748g  NAADGLSPAEKEWLK
  5.4    0.99                                        KQIEQIIQEGGEAGK
  3.7    0.98                                        LAAVAGTSTCHIVLSK
  1.7    0.99                                        WSLQLPTIEIEGNK
Top scoring peptide matches to query 44
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 37.6    0.03  15                      CAGL0M13849g  KIPVGYSSNDDADTR
Top scoring peptide matches to query 45
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  6.4    0.96                                        CDILPRTPTEITIK
  3.7    0.90                                        MSPELKGISILDILK
  0.8   -0.06                                        STREPILDANSTLLK
Top scoring peptide matches to query 46
Score greater than 19 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
104.7    0.02   5                      CAGL0G00308g  LYGTDCNQVENVFK
Top scoring peptide matches to query 47
Score greater than 22 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 78.7    0.06   1+                          mCwp1.1  FSDNTYAVVNSDGSIK
  4.4   -0.81                                        EYDVDMEDSDDEKK
  3.0   -0.04                                        AMNSANVLPVTKASWK
Top scoring peptide matches to query 48
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 49
Score greater than 19 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
109.1    0.01   4                      CAGL0C02211g  FSFSIDSCVPMPVCK
Top scoring peptide matches to query 50
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.9   -0.07                                        LRESGLHTVEAVAYAPK
Top scoring peptide matches to query 51
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.0   -0.19                                        IAVQVILTQAATEFFNK
Top scoring peptide matches to query 52
Score greater than 22 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 86.7    0.00   5                      CAGL0G00308g  DASAVASDLAALSQYPTIR
  3.7    0.98                                        EGLWDDAVSFKDALLLR
  2.3    0.98                                        TAIAGVFVLSPDECVTIR
Top scoring peptide matches to query 53
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.1    0.77                                        AAEMEAIDTLLITSNTLR
  0.7    0.88                                        GNCSNDSTVVDEVDPLIK
  0.7   -0.15                                        ELYGSVMQAEFLFCLR
  0.3   -1.11                                        LPDARVCHSYDSLMDGK
Top scoring peptide matches to query 54
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
184.6   -0.01   1+                          mCwp1.1  TGSESEGTSGFALSGSHLTYK
 11.7    0.83                                        SHPIVITLDNTIQKSGTYK
  5.9   -1.10                                        FYPIQNQTYAMVEKTGVK
  4.7   -0.03                                        TTSNDDPYKSFISPTSIDK
  3.4    0.83                                        GIGNGPISSLVDALSNLFNVK
  1.4   -0.17                                        NFSILYLLSGDPAHSILQK
  0.3   -0.20                                        VPTIIIAGPSYSGKTSLFHK
Top scoring peptide matches to query 55
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.8    0.04                                        QNGDGANVNIEDKEAAENFK
  3.0    0.93                                        FQRPLPTKSNRPCSVCSK
Top scoring peptide matches to query 56
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.8    0.94                                        FQRPLPTKSNRPCSVCSK
Top scoring peptide matches to query 57
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.4    1.14                                        DSNFTEFEELIDPEFDSK
Top scoring peptide matches to query 58
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 59
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 60
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.7    0.02                                        FGSENCVLWCKENLYIIK
  4.3   -1.03                                        EIGGENMNTWTVSRTPAAVLK
Top scoring peptide matches to query 61
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 62
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.4    0.14                                        FYCDECCGLQEAERVVGLK
Top scoring peptide matches to query 63
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 64
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 65
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 66
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 67
Score greater than 16 indicates homology
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 49.2   -0.01   3                            mCrh1p  SLVVTDYSTGKEYTYGDQSGSWQSIK
Top scoring peptide matches to query 68
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 69
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
189.9   -0.04   1                           mCwp1.1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK
168.6   -0.04   2                           mCwp1.2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK
Top scoring peptide matches to query 70
Score greater than 18 indicates homology
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 89.0   -0.01   1                           mCwp1.1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK
 84.8   -0.01   2                           mCwp1.2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK
Top scoring peptide matches to query 71
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide