Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0106_q3.pkl
Database        : Cglabrata 041110dos (5427 sequences; 2703904 residues)
Timestamp       : 22 Feb 2005 at 14:08:46 GMT
Significant hits: mCwp1.1               |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
                  mCwp1.2               |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1
                  mSSr1                 |validated by us| CAGL0H06413g similar to sp|O13547 Saccharomyces cerevisiae YLR390wa CW14, start b
                  CAGL0J11748g          similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Saccharomyces cerevisiae YM
                  CAGL0G09449g          similar to sp|P53301 Saccharomyces cerevisiae YGR189c CRH1, hypothetical start [Candida glabrata] C
                  CAGL0C02211g          similar to sp|P32623 Saccharomyces cerevisiae YEL040w UTR2 cell wall protein, hypothetical start [C
                  CAGL0I06160g          highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
                  CAGL0G00308g          similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
                  sw|P13645|K1CJ_HUMAN  Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10)
                  sw|Q61414|K1CO_MOUSE  Keratin, type I cytoskeletal 15 (Cytokeratin 15) (K15) (CK 15)
                  sw|P04264|K2C1_HUMAN  Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protei
                  CAGL0M08492g          highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c required forlerance to heat shock, sta
                  CAGL0M02255g          highly similar to tr|Q12461 Saccharomyces cerevisiae YPL152w RRD2, start by similarity [Candida gla

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 26 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

Switch to Protein Summary Report

To create a bookmark for this report, right click this link: Peptide Summary Report (../data/20050222/F002683.dat)

        Error tolerant   

1.    mCwp1.1                           Mass: 19256    Score: 833    Peptides matched: 6
 |Weig et al. 2004| 198aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07601g|CAGL-IPF545|CAGL-CDS42
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   634.82   1267.63   1267.60   0.02 0  132  1.9e-012 1  TGGSFAGTVTDAGK
33   755.41   1508.81   1508.78   0.02 1  126  5.6e-012 1  TGGSFAGTVTDAGKLK
46   858.91   1715.81   1715.80   0.01 0  133  1.2e-012 1  FSDNTYAVVNSDGSIK
53   653.34   1957.00   1956.98   0.02 1  37  0.0037 1  LKFSDNTYAVVNSDGSIK
54   1058.49   2114.96   2114.98   -0.01 0  197  3.1e-019 1  TGSESEGTSGFALSGSHLTYK
68   1055.20   3162.59   3162.63   -0.04 0  208  1e-020 1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK

2.    mCwp1.2                           Mass: 18631    Score: 543    Peptides matched: 4
 |predicted| 192aa Similar to S.cerevisiae YKL096w (CWP1) CAGL0F07579g|CAGL-IPF543|CAGL-CDS4333.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 46   858.91   1715.81   1715.80   0.01 0  133  1.2e-012 1  FSDNTYAVVNSDGSIK
 53   653.34   1957.00   1956.98   0.02 1  37  0.0037 1  LKFSDNTYAVVNSDGSIK
 54   1058.49   2114.96   2114.98   -0.01 0  197  3.1e-019 1  TGSESEGTSGFALSGSHLTYK
 68   1055.20   3162.59   3162.63   -0.04 0  176  1.7e-017 2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK

3.    mSSr1                             Mass: 19214    Score: 312    Peptides matched: 3
 |validated by us| CAGL0H06413g similar to sp|O13547 Saccharomyces cerevisiae YLR390wa CW14, start b
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
38   807.93   1613.85   1613.83   0.02 0  84  9.5e-008 1  TPPACLLACVAQVSK
59   1109.96   2217.91   2216.95   0.96 0  60  1.2e-005 1  NCLDSICPNGNSDAAYTAFK
66   909.06   2724.16   2724.17   -0.01 0  167  1.7e-016 1  QSSQCHTLNQVGCFCENENTAIK

4.    CAGL0J11748g                      Mass: 75039    Score: 252    Peptides matched: 4
 similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Saccharomyces cerevisiae YM
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   482.28   962.54   962.52   0.02 0  35  0.014 1  DALQTFLR
13   587.83   1173.64   1173.61   0.03 0  56  8.3e-005 1  WTAIGSQVQGK
40   543.62   1627.84   1627.82   0.02 1  61  1.7e-005 1  NAADGLSPAEKEWLK
44   565.30   1692.86   1692.83   0.03 0  100  2.5e-009 1  YLGTQVTDGKPETER

 
      Proteins matching the same set of peptides:
      mPlb2                             Mass: 73258    Score: 252    Peptides matched: 4
 |predicted| CAGL0J11748g similar to sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105 Sa
5.    CAGL0G09449g                      Mass: 48063    Score: 236    Peptides matched: 4
 similar to sp|P53301 Saccharomyces cerevisiae YGR189c CRH1, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   488.78   975.54   975.51   0.03 1  47  0.00083 1  RFDNPSLK
14   614.30   1226.58   1226.56   0.03 0  89  3.7e-008 1  YQQAQEDFAK
39   809.89   1617.77   1617.75   0.02 0  91  2e-008 1  ALATSFSENFTSESK
55   530.51   2118.02   2117.99   0.04 1  9  2 1  GNTATYDRGEFHGVNQPQK

 
      Proteins matching the same set of peptides:
      mCrh1p                            Mass: 45943    Score: 236    Peptides matched: 4
 |predicted| 432aa Similar to P53301 S.cerevisiae YGR189c CRH1 CAGL0G09449g|CAGL-IPF1559|CAGL-CDS237
6.    CAGL0C02211g                      Mass: 53039    Score: 168    Peptides matched: 2
 similar to sp|P32623 Saccharomyces cerevisiae YEL040w UTR2 cell wall protein, hypothetical start [C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
27   460.55   1378.62   1378.59   0.03 1  59  3.5e-005 1  DSSTKFDDYSSK
49   887.41   1772.81   1772.79   0.02 0  109  2.6e-010 1  FSFSIDSCVPMPVCK

 
      Proteins matching the same set of peptides:
      mUtr2p                            Mass: 50964    Score: 168    Peptides matched: 2
 |predicted| 462aa Similar to P32623 S.cerevisiae YEL040w UTR2 CAGL0C02211g|CAGL-IPF1070|CAGL-CDS218
7.    CAGL0I06160g                      Mass: 24169    Score: 162    Peptides matched: 2
 highly similar to sp|P47001 Saccharomyces cerevisiae YJL158c CIS3, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   551.82   1101.63   1101.60   0.03 0  88  6.1e-008 1  NDGTLQLTLK
43   847.43   1692.86   1692.84   0.02 1  74  1e-006 1  ESSCKNDGTLQLTLK

 
      Proteins matching the same set of peptides:
      mPir4p.1                          Mass: 22496    Score: 162    Peptides matched: 2
 |predicted-NN| 216aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|C
      mPir4p.2                          Mass: 22425    Score: 162    Peptides matched: 2
 |predicted-HMM| 215aa Highly similar to S.cerevisiae YJL158c (CIS3/PIR4) CAGL0I06160g|CAGL-IPF1401|
8.    CAGL0G00308g                      Mass: 39767    Score: 95     Peptides matched: 1
 similar to sp|P53334 Saccharomyces cerevisiae YGR279c SCW4, hypothetical start [Candida glabrata] C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
52   975.00   1947.98   1947.99   -0.01 0  95  6e-009 1  DASAVASDLAALSQYPTIR

 
      Proteins matching the same set of peptides:
      mCAGL0G00308g                     Mass: 38048    Score: 95     Peptides matched: 1
 |predicted| 357aa Similar to P53334 S. cerevisiae YGR279c SCW4 CAGL0G00308g|CAGL-IPF3933|CAGL-CDS29
9.    sw|P13645|K1CJ_HUMAN              Mass: 59711    Score: 86     Peptides matched: 2
 Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   545.79   1089.56   1089.52   0.03 0  51  0.00031 1  VTMQNLNDR
32   498.60   1492.76   1492.73   0.04 1  36  0.0063 1  SQYEQLAEQNRK

10.   sw|Q61414|K1CO_MOUSE              Mass: 49243    Score: 64     Peptides matched: 2
 Keratin, type I cytoskeletal 15 (Cytokeratin 15) (K15) (CK 15)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   523.30   1044.59   1044.51   0.08 0  16  1.1 3  NLLEDQDAK
 9   545.79   1089.56   1089.52   0.03 0  51  0.00031 1  VTMQNLNDR

11.   sw|P04264|K2C1_HUMAN              Mass: 66018    Score: 58     Peptides matched: 1
 Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protei
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   651.87   1301.73   1301.71   0.02 0  60  3.1e-005 1  SLDLDSIIAEVK

12.   CAGL0M08492g                      Mass: 34283    Score: 42     Peptides matched: 1
 highly similar to sp|Q03178 Saccharomyces cerevisiae YKL164c required forlerance to heat shock, sta
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   523.30   1044.59   1044.56   0.04 1  42  0.0027 1  GGILTDEKGR

 
      Proteins matching the same set of peptides:
      mPir3p                            Mass: 32307    Score: 42     Peptides matched: 1
 |predicted| 316aa Highly similar to S.cerevisiae YKL164c (Pir1) CAGL0M08492g|CAGL-IPF8003|CAGL-CDS3
13.   CAGL0M02255g                      Mass: 41661    Score: 26     Peptides matched: 1
 highly similar to tr|Q12461 Saccharomyces cerevisiae YPL152w RRD2, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   466.27   930.53   930.54   -0.01 1  26  0.11 1  ILTDKDVK

14.   CAGL0K08514g                      Score: 22     Peptides matched: 2
 similar to sp|P34244 Saccharomyces cerevisiae YKL101w serine/threonine-protein kinase, hypothetical start [Candida glabrata] Complete CDS. CAGL0K08514g|CAGL-IPF3104|CAGL-CDS0108.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   577.30   1152.58   1151.60   0.97 1  4  12 3  RFSSLTQTGR
 17   634.82   1267.63   1268.67   -1.04 1  20  0.32 2  SLYSQTSISKR

15.   CAGL0L04532g                      Score: 16     Peptides matched: 1
 highly similar to sp|P13188 Saccharomyces cerevisiae YOR168w GLN4, hypothetical start [Candida glabrata] Complete CDS. CAGL0L04532g|CAGL-IPF8133|CAGL-CDS0823.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   523.30   1044.59   1044.62   -0.02 0  18  0.69 2  LNITGTVLSK

16.   CAGL0J06930g                      Score: 16     Peptides matched: 1
 similar to tr|Q02950 Saccharomyces cerevisiae YPL118w MRP51, start by similarity [Candida glabrata] Complete CDS. CAGL0J06930g|CAGL-IPF2346|CAGL-CDS3241.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   488.78   975.54   975.52   0.02 1  16  1.1 2  KSDVAESLK

17.   CAGL0C05511g                      Score: 16     Peptides matched: 1
 highly similar to sp|P19881 Saccharomyces cerevisiae YDL236w PHO13, start by similarity [Candida glabrata] Complete CDS. CAGL0C05511g|CAGL-IPF4066|CAGL-CDS3525.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   488.78   975.54   975.51   0.04 0  16  1.1 3  CVIAGLDTK

18.   CAGL0F05643g                      Mass: 49932    Score: 15     Peptides matched: 1
 highly similar to tr|Q03940 Saccharomyces cerevisiae YDR190c RVB1, start by similarity [Candida gla
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   523.30   1044.59   1044.52   0.07 0  15  1.2 4  GLGLDDTGAAR

19.   CAGL0F08327g                      Score: 15     Peptides matched: 1
 similar to sp|P07276 Saccharomyces cerevisiae YGR258c RAD2 structure-specific nuclease of the nucleotide excision repairosome, start by similarity [Candida glabrata] Complete CDS. CAGL0F08327g|CAGL-IPF609|CAGL-CDS0452.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   488.78   975.54   975.52   0.02 0  15  1.3 4  LTTGAGSEIK

20.   CAGL0H10406g                      Score: 15     Peptides matched: 1
 similar to tr|Q07527 Saccharomyces cerevisiae YDL112w TRM3, hypothetical start [Candida glabrata] Complete CDS. CAGL0H10406g|CAGL-IPF5|CAGL-CDS0134.1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   466.27   930.53   930.53   0.00 1  15  1.6 2  IIESWKR

Peptide matches not assigned to protein hits: (no details means no match)
List sorted by Decreasing Score. Sort by Decreasing Intensity or Increasing Query # / Mr

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   538.81   1075.60   1075.57   0.03 0  13  2 1  AISTGNWSLK
3   444.70   887.38   887.42   -0.03 0  13  2.7 1  DLLCDPR
24   676.38   1350.75   1349.72   1.02 1  10  3 1  KTSTPSTGVMTIK
20   436.20   1305.57   1305.62   -0.06 1  10  3.2 1  SVCDKVLDDQK
21   436.90   1307.67   1306.59   1.08 0  10  3.1 1  VSDDSHFFPTR
12   577.30   1152.58   1152.54   0.04 1  9  4.3 1  FVDDSEKTGR
23   674.83   1347.64   1347.68   -0.04 1  8  4.1 1  LLDGVADGSMRSK
2   425.73   849.44   849.45   -0.01 1  7  8.6 1  MLRSTSR
28   695.35   1388.69   1388.65   0.04 0  5  9 1  EQQRPQTTEVSS
15   625.82   1249.62   1249.63   -0.01 0  5  9.9 1  MSGIIDASSTLR
34   503.94   1508.81   1508.63   0.18 0  5  7.6 1  QNTSNNTDSGTENK
65   1167.09   2332.17   2332.06   0.11 1  5  4.9 1  ALWTKELEDYLYCEDQEK
56   1082.01   2162.00   2161.99   0.01 1  3  7.8 1  QNGDGANVNIEDKEAAENFK
29   745.36   1488.70   1488.89   -0.19 0  3  13 1  SLPLNELPVPILGK
22   660.81   1319.60   1319.69   -0.09 1  3  16 1  VFDQAKEIGWK
42   553.29   1656.86   1657.92   -1.06 1  2  15 1  KITFLDTPGHAAFLK
30   497.94   1490.78   1490.70   0.08 1  1  19 1  ETNNLSAMPDGKSK
51   946.93   1891.84   1892.04   -0.20 0  1  14 1  IAVQVILTQAATEFFNK
36   789.88   1577.75   1577.69   0.06 0  0  21 1  SSEGNGTQVQDNSQK
1   409.73   408.73         
11   555.27   1108.52         
16   631.34   1260.66         
18   431.53   1291.56         
25   454.90   1361.68         
26   681.86   1361.70         
31   747.32   1492.62         
35   516.92   1547.75         
37   526.93   1577.76         
41   818.40   1634.79         
45   849.91   1697.80         
47   865.91   1729.80         
48   881.44   1760.87         
50   920.97   1839.92         
57   721.70   2162.07         
58   725.01   2172.02         
60   755.65   2263.92         
61   1137.07   2272.12         
62   758.73   2273.15         
63   763.73   2288.17         
64   778.09   2331.24         
67   1017.20   3048.57         
69   1062.86   3185.56         
70   1068.18   3201.50         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Data File Name         : cw0106_q3.pkl
Number of queries      : 70

Mascot:  http://www.matrixscience.com/ 

Top scoring peptide matches to query 1
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 2
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  6.8   -0.01                                        MLRSTSR
  2.6    1.04                                        EKENSSR
  2.6    1.07                                        QDSMSPGK
  2.0    1.02                                        MSRNVDK
  1.2    0.05                                        MKADEEK
Top scoring peptide matches to query 3
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 12.6   -0.03                                        DLLCDPR
 10.8   -0.13                                        LLSLWEK
  9.0   -0.09                                        LSTDSLPR
  8.7   -0.12                                        DSILTLAR
  8.6   -1.07                                        GGDSVVDLK
  8.5   -0.15                                        LESSLLVK
  7.8   -0.15                                        LDSISLIK
  7.8   -0.09                                        LDPSTSLR
  7.8   -0.09                                        IDQQEKK
  7.8   -0.11                                        LDSLAIEK
Top scoring peptide matches to query 4
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 26.4   -0.01  13                      CAGL0M02255g  ILTDKDVK
 14.9    0.00  20                      CAGL0H10406g  IIESWKR
 11.6    0.03                                        LVTEENVK
  7.2   -0.96                                        NLSMAQLR
  4.7    0.06                                        LLNQCQR
  4.3    0.05                                        IEEEQKR
  3.8    0.01                                        ILMEAINK
  3.8   -0.03                                        LLNMIVTK
  3.8   -0.04                                        ILLTESKK
  3.8   -0.00                                        LIEIKCR
Top scoring peptide matches to query 5
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 34.5    0.02   4                      CAGL0J11748g  DALQTFLR
  7.6    0.09                                        WLDSEWK
  7.6    0.04                                        WINFEVR
  6.5    0.04                                        LWNDFLR
  4.6   -0.02                                        SVLYNLVR
  2.0    1.01                                        VAKQPEYK
  1.9   -0.96                                        NWQFNKK
  1.2    1.06                                        GQIDSISDK
  0.0    1.01                                        FGIDVNIGK
Top scoring peptide matches to query 6
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 47.1    0.03   5                      CAGL0G09449g  RFDNPSLK
 15.8    0.02  16                      CAGL0J06930g  KSDVAESLK
 15.8    0.04  17                      CAGL0C05511g  CVIAGLDTK
 15.2    0.02  19                      CAGL0F08327g  LTTGAGSEIK
 13.6    0.00                                        KMEQLTVK
 12.6    0.00                                        QLFQEALK
 12.3    0.00                                        GVPATFGSLK
 12.0   -0.04                                        KIATFQLR
 11.5   -0.07                                        KVVYNLIK
 10.3    0.06                                        ICPSCVIK
Top scoring peptide matches to query 7
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 41.9    0.04  12                      CAGL0M08492g  GGILTDEKGR
 17.8   -0.02  15                      CAGL0L04532g  LNITGTVLSK
 15.7    0.08  10              sw|Q61414|K1CO_MOUSE  NLLEDQDAK
 15.5    0.07  18                      CAGL0F05643g  GLGLDDTGAAR
 12.5   -0.97                                        LDITEEAKK
 12.5   -1.01                                        EVLTTKDLK
  9.6    0.04                                        KVLESANER
  7.2    1.04                                        IIVNDDLDK
  4.1    0.05                                        NLVSELADGK
  3.7   -0.08                                        LLGGLFGIKK
Top scoring peptide matches to query 8
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 12.8    0.03                                        AISTGNWSLK
  5.6    0.03                                        LAESEMRLK
  3.1   -0.96                                        ANSLNGNFLK
  2.4   -0.03                                        AIVTFPTSIK
  1.6    0.12                                        SPSEDLGTDR
  1.2   -0.00                                        ALNLQFKDK
  1.2   -0.03                                        ALLDLFIGSK
  0.0    1.08                                        VTEEGGQVEK
Top scoring peptide matches to query 9
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 50.5    0.03   9+             sw|P13645|K1CJ_HUMAN  VTMQNLNDR
 14.4   -0.02                                        LSGTGSAGATIR
 10.4   -0.05                                        SLPFELKEK
  9.8    0.01                                        VTLFEDNPR
  8.9    1.03                                        EASDDIQRR
  6.3   -0.03                                        LGSKMGAADIK
  6.0   -0.10                                        VTKNLFQLK
  2.4    0.93                                        LLTMNVGLTK
  1.9    1.02                                        DTEIEDLVR
  1.2    1.01                                        LDMVNGWVR
Top scoring peptide matches to query 10
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 87.9    0.03   7                      CAGL0I06160g  NDGTLQLTLK
 11.8    0.95                                        DLLIKTGLTK
 11.8    1.01                                        DIREQVITK
 10.4    1.01                                        LDETILRNK
 10.2    0.98                                        IDAITVKDVK
 10.1    0.03                                        SKADSLGSPIK
 10.1    0.98                                        DLPISKSTLK
  9.8   -0.03                                        DMRILLITK
  8.5   -1.02                                        SVTVSRISVR
  7.3    0.98                                        LGKVEDVTIK
Top scoring peptide matches to query 11
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 12
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.8    0.04                                        FVDDSEKTGR
  5.5   -0.06                                        SASRAVFLFR
  4.3    0.97  14                      CAGL0K08514g  RFSSLTQTGR
  3.8    0.05                                        SHPDYELHR
  3.6    0.95                                        VYSNRSSVIK
  1.9   -0.00                                        SETTKSLTMR
  1.7   -0.04                                        KWAGAQHLSR
  1.4   -0.04                                        NKHINQLMR
  0.8   -0.08                                        NIPKIADNIR
  0.3   -0.98                                        SSGYASSSPLAK
Top scoring peptide matches to query 13
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 56.1    0.03   4                      CAGL0J11748g  WTAIGSQVQGK
 13.7   -0.01                                        SYPQQVLALR
  7.2   -0.03                                        SIKDCVIVLK
  6.2   -0.04                                        KIPHNLIDPK
  5.7    1.02                                        ELDSEQIVIK
  5.3   -0.99                                        ETKIVQGSGTR
  3.7    0.99                                        MRVIEEGVLK
  3.2    0.04                                        QMLTNPAMIR
  1.2   -0.96                                        ELQFQQLNR
  1.2   -1.03                                        DLSRMTIVLK
Top scoring peptide matches to query 14
Score greater than 26 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 88.8    0.03   5                      CAGL0G09449g  YQQAQEDFAK
  8.0   -0.05                                        KYAANEYQIK
  7.8   -1.01                                        FWTEVYQGAK
Top scoring peptide matches to query 15
Score greater than 15 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.7   -0.01                                        MSGIIDASSTLR
  2.3   -0.95                                        QESSKSQENSK
  2.1   -0.03                                        QKFIEVETEK
  2.0    0.98                                        MTNEITGVEKK
  1.5   -0.01                                        AEDIIEYNRK
Top scoring peptide matches to query 16
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 17
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
131.9    0.02   1                           mCwp1.1  TGGSFAGTVTDAGK
 19.6   -1.04  14                      CAGL0K08514g  SLYSQTSISKR
  7.9    0.06                                        SSGMSAPTTQSSK
  7.2    1.03                                        GTGDCKFLQNK
  2.5    0.01                                        STNSTIANARFS
  1.5    0.12                                        EEYWDNNNGK
  1.1    1.03                                        SAGCFEILSQR
Top scoring peptide matches to query 18
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 19
Score greater than 27 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 60.3    0.02  11              sw|P04264|K2C1_HUMAN  SLDLDSIIAEVK
 10.9    1.03                                        AQDILRNCLAK
  7.5    0.95                                        VTIISKNVNSVK
  4.3    1.10                                        LDPQESNDGKAK
  4.1    0.06                                        SLDAVQEHYLK
  2.9    0.93                                        SKITLSAVLLEK
  1.6    0.02                                        ASFRLPNAIEGK
  0.4   -1.00                                        ISVAILYSFYK
Top scoring peptide matches to query 20
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.7   -0.06                                        SVCDKVLDDQK
  6.3   -0.09                                        KTGTQDVDAIMK
  3.8    0.04                                        AENDENDEDKK
  2.2   -0.06                                        YFDSGDYALKK
  1.8   -0.13                                        TKLQSIPSSSMK
  1.3   -0.12                                        TAAENEFVGLKK
  1.1   -0.09                                        ANTGDFTDIPKK
Top scoring peptide matches to query 21
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.5    1.08                                        VSDDSHFFPTR
  4.3   -0.98                                        TLSDESKSSISR
  1.8    0.03                                        FTDLSEDTKPR
  1.6    0.08                                        MSEQAASESGRR
  1.1    0.07                                        QESSNSKAQSDK
  0.2    0.04                                        ESGAAAMSKFGPR
Top scoring peptide matches to query 22
Score greater than 15 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.9   -0.09                                        VFDQAKEIGWK
  2.6   -1.08                                        VTPDNLEMFKK
  2.3   -0.09                                        VETARCVSISAK
  2.2    0.94                                        DTIVGWDSTIGR
Top scoring peptide matches to query 23
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.5   -0.04                                        LLDGVADGSMRSK
  5.3   -0.17                                        SPSIAPINLLPVK
  2.5    0.92                                        QELFAQIKDQK
  2.4    0.96                                        EKFESLPDNLR
  1.3   -0.06                                        EEALQFLNKEK
  0.8   -1.01                                        ETDWDSIISGVK
Top scoring peptide matches to query 24
Score greater than 22 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.8    1.02                                        KTSTPSTGVMTIK
  8.6    1.03                                        NFLSSDIADKLK
  5.0    0.01                                        MSSLPKDHPVLK
  3.9   -0.01                                        LKCAETLLYLK
  3.8    0.03                                        QIPYFTNDIIK
  3.6    0.09                                        DCSMSVTLPTIK
  1.3   -0.01                                        ELLFILNQAYK
  0.7    0.05                                        CMAIRTMSLIR
  0.3    1.16                                        CNANDQESSVVK
  0.1    0.01                                        KLADDYTSVVIK
Top scoring peptide matches to query 25
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 26
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 27
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 59.4    0.03   6                      CAGL0C02211g  DSSTKFDDYSSK
  1.6    0.91                                        KGNALMVENFQK
Top scoring peptide matches to query 28
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.0    0.04                                        EQQRPQTTEVSS
  1.4   -1.04                                        IISSIEQKEESK
Top scoring peptide matches to query 29
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.9   -0.19                                        SLPLNELPVPILGK
  1.5   -0.18                                        QLISLTPAAVAHLR
Top scoring peptide matches to query 30
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.2    0.08                                        ETNNLSAMPDGKSK
Top scoring peptide matches to query 31
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 32
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 35.9    0.04   9              sw|P13645|K1CJ_HUMAN  SQYEQLAEQNRK
Top scoring peptide matches to query 33
Score greater than 25 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
126.0    0.02   1                           mCwp1.1  TGGSFAGTVTDAGKLK
  4.7    1.16                                        DWPSMNQEDMKK
  3.5    0.15                                        TETEEFEHGFQR
  0.5    0.02                                        RAYIFFGSHNGLK
  0.4    0.09                                        TSEPESFIKALCQ
Top scoring peptide matches to query 34
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.6    0.18                                        QNTSNNTDSGTENK
  0.8   -1.11                                        AGILNSAAALIQKLK
Top scoring peptide matches to query 35
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 36
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.5    0.06                                        SSEGNGTQVQDNSQK
Top scoring peptide matches to query 37
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 38
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 84.4    0.02   3                             mSSr1  TPPACLLACVAQVSK
  2.5    0.08                                        TPNVFDKSGQSSGYK
  0.5    0.08                                        MSDEVAVPPVQEGEK
Top scoring peptide matches to query 39
Score greater than 18 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 90.5    0.02   5                      CAGL0G09449g  ALATSFSENFTSESK
Top scoring peptide matches to query 40
Score greater than 18 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 61.5    0.02   4                      CAGL0J11748g  NAADGLSPAEKEWLK
  1.2   -0.95                                        NTITIPGENETSPEK
  0.7   -0.17                                        SWVVAIAVVFVVVLK
  0.5    0.96                                        LAAVAGTSTCHIVLSK
Top scoring peptide matches to query 41
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 42
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.1   -1.06                                        KITFLDTPGHAAFLK
  1.8   -1.01                                        NTLVELNLNDCLLK
Top scoring peptide matches to query 43
Score greater than 25 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 73.6    0.02   7                      CAGL0I06160g  ESSCKNDGTLQLTLK
  7.8    0.06                                        DTTNIEFFAHEIEK
  6.4    1.02                                        QRMMSALNASEDVIK
  5.5   -0.95                                        AESCKVDGTLEMNLK
  4.7    0.06                                        QEINQYEAQNDTIK
  3.7   -0.07                                        IFDIIQEIFHYKK
  2.5    1.13                                        TNISNNDNNDDDTIK
  2.3    1.06                                        KSGDEGATETSGAALGGGK
  2.1    0.05                                        ELLVSTCGKEWEDK
  2.0   -1.00                                        KYDGEQETLVGNTIK
Top scoring peptide matches to query 44
Score greater than 21 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 99.7    0.03   4                      CAGL0J11748g  YLGTQVTDGKPETER
  2.6   -0.05                                        QTADDVDIRGLLHLK
  1.8   -0.02                                        HYTIFTSVNDQIKK
Top scoring peptide matches to query 45
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 46
Score greater than 22 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
132.7    0.01   1+                          mCwp1.1  FSDNTYAVVNSDGSIK
  1.2   -0.85                                        EYDVDMEDSDDEKK
  0.3   -0.09                                        AMNSANVLPVTKASWK
Top scoring peptide matches to query 47
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 48
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 49
Score greater than 19 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
108.7    0.02   6                      CAGL0C02211g  FSFSIDSCVPMPVCK
Top scoring peptide matches to query 50
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 51
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.1   -0.20                                        IAVQVILTQAATEFFNK
Top scoring peptide matches to query 52
Score greater than 24 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 94.7   -0.01   8                      CAGL0G00308g  DASAVASDLAALSQYPTIR
  5.6    0.97                                        EGLWDDAVSFKDALLLR
  3.0   -1.01                                        VYRPLFIVEDDEELGR
Top scoring peptide matches to query 53
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 36.8    0.02   1+                          mCwp1.1  LKFSDNTYAVVNSDGSIK
Top scoring peptide matches to query 54
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
197.3   -0.01   1+                          mCwp1.1  TGSESEGTSGFALSGSHLTYK
  7.1   -0.04                                        TTSNDDPYKSFISPTSIDK
  3.7    0.83                                        SHPIVITLDNTIQKSGTYK
  2.4    0.05                                        DGASSFAGSSDSELSDIDDIK
  0.4   -0.21                                        VPTIIIAGPSYSGKTSLFHK
Top scoring peptide matches to query 55
Score greater than 18 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.4    0.04   5                      CAGL0G09449g  GNTATYDRGEFHGVNQPQK
  4.6    0.83                                        TGLIVSIFNIGCAIGGVVLSK
  3.2    0.96                                        AAAEVSMGTEITDVDLINIR
  3.1    0.08                                        GNTGKGNQITDVCGNSDEPR
  2.7    0.83                                        TGLVVSIFNIGCAIGGVILSK
  2.7    0.83                                        TGLVVSIFNIGCAIGGIVLSK
  2.6    1.01                                        YFNRAFYYTTYNNKPR
  2.5    0.83                                        TGLIVAIFNIGCAIGGITLSK
  2.4    0.87                                        LLSFVVVGGGPTGVEFAAELR
  2.2   -0.14                                        TVTHPEENIQQLIVGLLSK
Top scoring peptide matches to query 56
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.0    0.01                                        QNGDGANVNIEDKEAAENFK
  2.9   -0.08                                        LHSHDHKAPISQHVDWQK
Top scoring peptide matches to query 57
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 58
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 59
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 60.4    0.96   3                             mSSr1  NCLDSICPNGNSDAAYTAFK
Top scoring peptide matches to query 60
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 61
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 62
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 63
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 64
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 65
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.5    0.11                                        ALWTKELEDYLYCEDQEK
  0.7    0.14                                        FYCDECCGLQEAERVVGLK
Top scoring peptide matches to query 66
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
167.1   -0.01   3                             mSSr1  QSSQCHTLNQVGCFCENENTAIK
Top scoring peptide matches to query 67
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 68
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
208.4   -0.04   1                           mCwp1.1  DSQAFGLLAIHSGSPVQNTPVDSQNGALVLK
176.2   -0.04   2                           mCwp1.2  DSQAFGLLAIHSGSPVQNTPVNSENGALVLK
Top scoring peptide matches to query 69
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 70
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide