Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0425_q2.pkl
Database        : Ashbya Ashbya (4796 sequences; 2346673 residues)
Timestamp       : 8 Aug 2007 at 09:39:01 GMT
Significant hits: ABR025C   440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
                  AEL111C   415421:416467,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C; Inve
                  AGL352W   47585:49186,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic
                  ABL063C   282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
                  mAEL103W  Pir protein,Syntenic homolog of Saccharomyces cerevisiae YJL158C (CIS3), YKL164C (PIR1) and YKL163W

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 41 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    ABR025C                           Mass: 20232    Score: 438    Queries matched: 9
 440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   446.24   890.47   890.43   0.04 0  12  48 1  L.SAVVTDDGK.L
12   466.77   931.52   931.48   0.04 1  34  0.35 1  K.LKLSNGHY.T + Deamidation (NQ)
14   474.26   946.50   946.45   0.05 0  25  2.7 1  D.FEPAEGAAR.S
26   694.40   1386.79   1386.64   0.14 1  32  0.48 1  K.GAFTAGSADKASTGF.S
27   717.89   1433.77   1433.66   0.11 0  93  3.7e-007 1  Y.HMSSVFEDNGALK.L
37   838.98   1675.94   1675.83   0.11 0  108  1.1e-008 1  K.LGGSTADALSAVVTDDGK.L
43   893.03   1784.05   1783.97   0.09 0  66  0.00019 1  Y.ELTLEQPGATSISVALR.A
46   959.55   1917.08   1917.01   0.07 1  68  0.00012 1  K.LGGSTADALSAVVTDDGKLK.L
49   682.77   2045.29   2045.10   0.18 2  11  53 1  L.KLGGSTADALSAVVTDDGKLK.L

 
      Proteins matching the same set of peptides:
      mABR025C                          Mass: 18217    Score: 438    Queries matched: 9
 hom. to Cwp1p,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1);

2.    AEL111C                           Mass: 35909    Score: 99     Queries matched: 2
 415421:416467,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C; Inve
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   407.25   812.49   812.49   0.01 0  40  0.052 1  R.IGAIVANR.Q
42   881.48   1760.95   1760.84   0.11 0  62  0.0005 1  Y.NLYDENIAPQCSPIK.L

 
      Proteins matching the same set of peptides:
      mAEL111C                          Mass: 33442    Score: 99     Queries matched: 2
 Pir protein,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C;
3.    AGL352W                           Mass: 58032    Score: 81     Queries matched: 3
 47585:49186,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   480.27   958.52   958.47   0.05 0  51  0.0072 1  Y.GCNEVKPR.K
20   561.82   1121.62   1121.53   0.09 0  15  20 1  E.YGCNEVKPR.K
22   601.79   1201.57   1201.47   0.10 0  25  2.5 1  Y.SWCGDSSFEK.S

 
      Proteins matching the same set of peptides:
      mAGL352W-HMM                      Mass: 55771    Score: 81     Queries matched: 3
 Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1);
      mAGL352W-NN                       Mass: 56261    Score: 81     Queries matched: 3
 Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1);
4.    ABL063C                           Mass: 42563    Score: 67     Queries matched: 2
 282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   416.27   830.53   830.52   0.01 2  29  1 4  R.KIKDSLK.L
11   463.76   925.50   925.46   0.04 0  43  0.025 1  F.ANNEHLTK.I

 
      Proteins matching the same set of peptides:
      mABL063C                          Mass: 40673    Score: 67     Queries matched: 2
 Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) and YDR055W (PST1); 1-intron
5.    mAEL103W                          Mass: 18618    Score: 59     Queries matched: 1
 Pir protein,Syntenic homolog of Saccharomyces cerevisiae YJL158C (CIS3), YKL164C (PIR1) and YKL163W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 42   881.48   1760.95   1760.84   0.11 0  62  0.0005 1  Y.NLYDQNIAPQCSPIK.L + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      AEL103W                           Mass: 18618    Score: 58     Queries matched: 1
 Pir protein,Syntenic homolog of Saccharomyces cerevisiae YJL158C (CIS3), YKL164C (PIR1) and YKL163W
6.    ADL238W                           Mass: 76138    Score: 39     Queries matched: 2
 284860:286920,forward,Syntenic homolog of Saccharomyces cerevisiae YIL108W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   416.27   830.53   830.52   0.01 2  29  1 4  R.KLKNSLK.G + Deamidation (NQ)
 27   717.89   1433.77   1434.66   -0.89 1  16  18 4  R.QREGGCGMDLAIK.K + Deamidation (NQ)

7.    AEL188W                           Mass: 54959    Score: 30     Queries matched: 1
 283414:284907,forward,Syntenic homolog of Saccharomyces cerevisiae YBR263W (SHM1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 15   480.27   958.52   958.51   0.01 0  35  0.28 2  Y.QTAVVENAK.V

8.    AER353W                           Mass: 162738   Score: 28     Queries matched: 2
 1285734:1290218,forward,Syntenic homolog of Saccharomyces cerevisiae YMR219W (ESC1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   416.27   830.53   831.45   -0.92 1  28  1.5 7  R.QFAPKLE.D
 14   474.26   946.50   947.37   -0.88 0  10  86 7  R.ESSAAQQEP.I + 2 Deamidation (NQ)

9.    AAL099C                           Mass: 168571   Score: 28     Queries matched: 1
 165817:170208,reverse,Syntenic homolog of Saccharomyces cerevisiae YPL167C (REV3)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   416.27   830.53   830.49   0.05 1  32  0.5 1  T.KDLSQLK.A

10.   AFL121W                           Mass: 94569    Score: 28     Queries matched: 1
 209373:211949,forward,Non-syntenic homolog of Saccharomyces cerevisiae YBL022C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   407.25   812.49   812.52   -0.03 1  32  0.35 2  Q.LGAIVRGK.I

11.   AER059C                           Mass: 48387    Score: 26     Queries matched: 1
 747133:748425,reverse,Syntenic homolog of Saccharomyces cerevisiae YLR392C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   416.27   830.53   830.49   0.05 1  30  0.82 2  N.KNLSQLK.L + Deamidation (NQ)

12.   AFR284W                           Mass: 123874   Score: 25     Queries matched: 1
 947124:950435,forward,Syntenic homolog of Saccharomyces cerevisiae YIL147C (SLN1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   416.27   830.53   830.49   0.05 1  29  1 4  E.KIQNSLK.L + Deamidation (NQ)

13.   AER378W                           Mass: 274418   Score: 24     Queries matched: 1
 1341098:1348333,forward,Syntenic homolog of Saccharomyces cerevisiae YIL129C (TAO3)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   416.27   830.53   830.52   0.01 2  30  0.82 2  E.KNISKIK.S + Deamidation (NQ)

14.   ABR161C                           Mass: 44223    Score: 23     Queries matched: 1
 705053:706273,reverse,Syntenic homolog of Saccharomyces cerevisiae YJR105W (ADO1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   407.25   812.49   812.49   0.01 0  24  2.1 3  F.VAALVQGR.D

15.   AGR099C                           Mass: 34550    Score: 22     Queries matched: 1
 924372:925289,reverse,Syntenic homolog of Saccharomyces cerevisiae YDR106W (ARP10)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   407.25   812.49   812.54   -0.04 1  23  2.5 4  R.LKIVVLE.N

16.   ABR155C                           Mass: 33206    Score: 21     Queries matched: 1
 691092:691967,reverse,Syntenic homolog of Saccharomyces cerevisiae YBL050W (SEC17)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   466.77   931.52   931.50   0.02 1  25  2.7 2  R.KIISNSVGN.R + Deamidation (NQ)

17.   ADR065W                           Mass: 94874    Score: 20     Queries matched: 1
 822102:824639,forward,Syntenic homolog of Saccharomyces cerevisiae YBL101C (ECM21) and YPR030W (CSR
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   407.25   812.49   812.52   -0.03 1  23  2.5 4  K.IKLVPLM.K

18.   AEL337C                           Score: 20     Queries matched: 1
 14613:17906,reverse,Syntenic homolog of Saccharomyces cerevisiae YOL034W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   416.27   830.53   830.49   0.05 2  24  3.1 8  R.QLKDLKS.E

19.   ACR089C                           Mass: 43321    Score: 20     Queries matched: 1
 518154:519323,reverse,Syntenic homolog of Saccharomyces cerevisiae YDR268W (MSW1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 27   717.89   1433.77   1434.75   -0.97 1  23  3.9 3  T.IQNIDYANRSLK.L + Deamidation (NQ)

20.   ACL132C                           Mass: 106240   Score: 19     Queries matched: 2
 120950:123814,reverse,Syntenic homolog of Saccharomyces cerevisiae YLR045C (STU2)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 45   938.02   1874.02   1874.88   -0.86 0  20  8 2  Q.MLQDQLNDVQLALNEK.T + 4 Deamidation (NQ)
53   1111.03   2220.04   2220.16   -0.11 2  9  90 1  P.PTEQPRLFHWQVLQRQR.E + 2 Deamidation (NQ)

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   455.25   908.48   908.46   0.02 0  21  4.3 1  GAQQYLTK + Deamidation (NQ)
45   938.02   1874.02   1873.93   0.09 2  21  6.6 1  NTLEEEKARAEDDILK + Deamidation (NQ)
5   394.24   786.47   785.48   1.00 1  20  9 1  VNGIKVR + Deamidation (NQ)
1   352.20   702.39   702.37   0.02 0  19  12 1  GAMSPIK
18   531.79   1061.57   1062.56   -0.99 0  18  12 1  TQSTVLTVAGS
3   367.20   732.38   732.37   0.01 0  15  26 1  QGETAVK + Deamidation (NQ)
2   361.68   721.35   721.44   -0.08 1  15  18 1  KVYSLI
32   762.48   1522.94   1522.79   0.14 1  14  28 1  NIHMIASKQRPDL + Deamidation (NQ)
30   747.37   1492.73   1492.79   -0.05 2  13  33 1  VGQGNLHKRANNGK + Deamidation (NQ)
50   1033.00   2063.99   2063.01   0.97 0  12  52 1  AQFLNPQFQTDVCKPLR + 2 Deamidation (NQ)
52   1082.04   2162.07   2162.05   0.02 2  11  51 1  TPATTQRVVHQHRGGSGGCR + Deamidation (NQ)
65   1291.15   3870.41   3870.91   -0.49 0  11  35 1  NIASTVVNQQNAGLASMDTHQLLDLFDTDNSLAQVK
8   419.24   836.46   836.47   -0.01 0  11  42 1  LHFPARP
23   626.85   1251.68   1252.54   -0.85 0  11  57 1  EAYQSAVWGGEG
40   846.96   1691.91   1692.80   -0.89 1  11  65 1  SENAIAPTKGSAAAAGYD
64   1230.82   3689.45   3689.58   -0.14 0  10  48 1  DGALVAYCEDPTIGIGGYDGLPYGSDANAQELDSEG + Deamidation (NQ)
54   741.07   2220.20   2221.00   -0.80 1  10  69 1  EAEEIAQSSASGDSVVEDDRK
39   844.94   1687.87   1688.76   -0.89 1  10  79 1  LNPDRVACQDATAQM
28   719.40   1436.78   1437.72   -0.94 1  9  83 1  TLEAIEGHGGERLG
31   757.39   1512.77   1513.76   -0.99 1  9  88 1  VESARLLPEEVGES
33   770.95   1539.88   1539.71   0.17 1  9  87 1  DWTVARGSNYQSR + Deamidation (NQ)
41   853.97   1705.92   1705.76   0.16 0  8  1.1e+002 1  TSPNGIEVESTSGDNAK + Deamidation (NQ)
34   773.91   1545.80   1545.63   0.18 0  8  1.3e+002 1  NYSSNCISSNSGVVG + 2 Deamidation (NQ)
47   967.98   1933.94   1932.98   0.95 1  7  1.4e+002 1  SPVNAKDANGWPPLFHAL
51   1048.98   2095.95   2095.04   0.91 2  7  1.5e+002 1  NANSVRTRAVAAAAGQFFNK + 3 Deamidation (NQ)
29   1459.33   1458.33   1458.83   -0.51 2  7  1.6e+002 1  ANSLTVGSWKRLK
4   392.69   783.36   784.34   -0.98 1  7  92 1  KMSQEY
38   841.90   1681.79   1680.86   0.93 1  7  1.6e+002 1  ALGYRSVPGNVAYASR + Deamidation (NQ)
44   928.52   1855.02   1855.02   0.00 1  6  1.8e+002 1  EAQVSNITAAKAVADVIR
24   652.34   1302.66   1303.64   -0.99 0  6  2.2e+002 1  IDVGCSGLIADGK
60   1434.96   2867.90   2867.25   0.65 0  5  1.8e+002 1  GEHYKPTAMYSQMHPSNDYIGTPATA + Deamidation (NQ)
17   527.31   1052.61   1052.55   0.06 0  5  1.7e+002 1  AYTPIYVNL
19   537.80   1073.58   1073.62   -0.04 2  4  3e+002 1  SKRTLGDAVK
61   1468.85   2935.69   2935.32   0.37 0  4  2.6e+002 1  EQLSAGSTDTAGSDVLSQHAPSSASSQTSK + 2 Deamidation (NQ)
59   1415.94   2829.87   2830.35   -0.48 0  4  2.7e+002 1  IGHAMALWTNDDYLQQPARPTFER + Deamidation (NQ)
25   685.88   1369.75   1369.75   0.01 0  3  3.6e+002 1  EAVLALQNQLGTI + Deamidation (NQ)
67   1350.49   4048.44   4048.01   0.43 2  3  2.3e+002 1  WQKLEAPLFSLRTMGQEIPTTENNILPQIFQMLC + 2 Deamidation (NQ)
66   1307.48   3919.41   3918.89   0.52 1  2  2.6e+002 1  TNAPLDELSIGPNALTRQLCSEESIDCFLDAIINK + 2 Deamidation (NQ)
35   809.45   1616.89   1616.66   0.22 0  2  4.4e+002 1  TSSPSMNNSSGNSALY + Deamidation (NQ)
56   1255.95   2509.88   2509.17   0.72 1  2  4.1e+002 1  SINSSSHHNIANGSGVAADGSRTNR + Deamidation (NQ)
57   1336.94   2671.87   2671.29   0.58 2  2  4e+002 1  YEIGDALGIHARNNEESVKSFLHA + 2 Deamidation (NQ)
62   1053.80   3158.39   3158.54   -0.15 2  2  4.1e+002 1  SMLNYKVHQSFTNHQYQELVNDAKHK
36   812.43   1622.85   1622.89   -0.04 1  1  5.4e+002 1  KDSPPSQLLPLLTTN
21   598.33   1194.65   1194.62   0.03 2  1  4.9e+002 1  MFRSILSRNA + Deamidation (NQ)
16   520.30   1038.59   1039.52   -0.92 0  1  4.4e+002 1  QTVPLQQPQ + 2 Deamidation (NQ)
48   984.46   1966.91   1967.86   -0.95 1  1  6.5e+002 1  GSVKDTVAEYSFEYSTEG
63   1176.82   3527.45   3527.86   -0.41 1  0  5.1e+002 1  HLFATELDTIRQVAFINDSVVGILLDSGQLSR + Deamidation (NQ)
58   1365.47   2728.92   2728.27   0.64 1  0  6.4e+002 1  DEKLQHLQLIVSNICDVSASEDAAA + 3 Deamidation (NQ)
13   471.77   941.53        
55   1213.47   2424.92        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 2
Instrument type        : ESI-QUAD-TOF
Number of queries      : 67

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 31 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.0    0.02        K.GAMSPIK.S
 17.6    0.00        N.AGLNSIK.V
 17.6   -0.03        V.KIDSLK.A
 17.6   -0.03        S.KLDSLK.E
 17.6    0.00        K.QLNSLK.R
 17.5   -0.03        KLSDIK
 17.5    0.00        S.QLSDLK.Q
 17.5    0.04        K.QLSDLQ.E
 16.5   -0.03        Q.KLSNLK.H
 15.6   -0.05        KIMALK
Top scoring peptide matches to query 2
Score greater than 26 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.0   -0.08        K.KVYSLI.S
 15.0   -0.05        K.QVYSLL.L
 14.8    0.97        S.KDSLMK.D
 14.8    0.97        T.KNSMLK.T
 12.4   -0.97        R.GAAYDGGI.D
 11.8    0.06        R.QNFSEP.L
 10.9    0.99        T.KAMDTR.S
 10.7    0.06        R.QDSAMGL.L
  9.6    0.97        K.GADFIKA.F
  9.6    0.95        KDFRR
Top scoring peptide matches to query 3
Score greater than 28 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.4    0.01        F.QGETAVK.E
 15.2    0.01        T.QGSAELK.R
 15.1    1.00        F.QGETAVK.E
 14.7    0.01        K.QGSATVGL.R
 14.4    0.01        R.QGSGSALL.D
 13.6    0.01        K.EGQTGKI.V
 12.2    0.01        G.DAETGLK.Y
 12.1    0.04        I.EADGSVR.G
 11.9   -0.02        S.SINATVK.Q
 11.1   -0.01        E.MSPATVK.Q
Top scoring peptide matches to query 4
Score greater than 17 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.8   -0.98        R.KMSQEY.L
  4.6   -0.98        R.KMYTNE.F
  3.4    0.93        R.KFFTAAV.C
  2.8   -0.04        Y.KTNMYK.M
  1.5    0.98        D.NSGYLTK.D
Top scoring peptide matches to query 5
Score greater than 31 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.0    1.00        I.VNGIKVR.G
 19.8   -0.96        S.ESARAVR.S
 17.9   -0.04        R.KSAVVRK.E
 17.9   -0.98        A.EKEKVR.I
 17.0   -0.04        Q.KGSKLVR.I
 16.4   -0.00        Y.KGAEVRK.L
 16.4    0.01        S.QKEVVGK.T
 16.4   -0.95        K.KQEEVR.H
 16.4   -0.04        K.KAVSVRK.H
 15.3   -0.00        K.KGSLINR.K
Top scoring peptide matches to query 6
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 40.0    0.01    2  AEL111C R.IGAIVANR.Q
 31.8   -0.03   10  AFL121W Q.LGAIVRGK.I
 23.9    0.01   14  ABR161C F.VAALVQGR.D
 23.2   -0.03   17  ADR065W K.IKLVPLM.K
 23.2   -0.04   15  AGR099C R.LKIVVLE.N
 16.1    0.03               G.LGPSQRR.D
 14.1   -0.98               R.NGALLQAK.E
 13.0    0.01               I.IKKGDPR.L
 12.7    0.01               P.LAGLGLNR.T
 12.0   -0.02               F.LQLKPSK.I
Top scoring peptide matches to query 7
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 32.3    0.05    9  AAL099C T.KDLSQLK.A
 30.1    0.01   13  AER378W E.KNISKIK.S
 30.1    0.05   11  AER059C N.KNLSQLK.L
 29.1    0.01    4  ABL063C R.KIKDSLK.L
 29.1    0.05   12  AFR284W E.KIQNSLK.L
 29.1    0.01    6  ADL238W R.KLKNSLK.G
 27.5   -0.92    8  AER353W R.QFAPKLE.D
 24.3    0.05   18  AEL337C R.QLKDLKS.E
 22.9    0.12               E.QDEAQLK.E
 22.4   -0.94   18  AEL337C R.QLKDLKS.E
Top scoring peptide matches to query 8
Score greater than 21 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.0   -0.01        K.LHFPARP.H
  7.4    0.14        R.NLVNCCG.R
  6.5   -0.92        K.NLVQTNF.V
  5.0    0.06        K.NLVQTNF.V
  4.8    0.05        R.EVPAGHVE.W
  4.6   -0.91        R.EAHGQQPA.G
  4.6   -0.91        R.EAHGQQPA.G
  4.6   -0.98        T.EHAPKEK.L
  4.6   -0.99        R.EHARVVGA.D
  4.6   -0.07        R.KHALLQK.F
Top scoring peptide matches to query 9
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.7    0.04    1  ABR025C L.SAVVTDDGK.L
  9.4    0.07               P.DSPASNATK.S
  6.6   -0.99               K.KATTGGTQK.T
  6.6   -0.91               I.TVEENDGK.L
  6.5    0.04               I.SLGVTDGNK.Y
  6.0    0.94               Y.IVYITPGK.T
  5.8   -0.91               P.EETVNDGK.R
  5.5   -0.87               R.TDLQDNGQ.L
  5.5   -0.91               L.TLDEDDGK.V
  4.7   -1.00               S.AFLLENGK.R
Top scoring peptide matches to query 10
Score greater than 31 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.2    0.02        A.GAQQYLTK.Y
 21.2    0.02        A.GAQQYLTK.Y
 21.2   -0.06        L.KYTRITK.L
 17.8    0.06        S.APNDYTTK.L
 10.9   -0.07        A.HVVGRLTK.E
 10.8    0.01        R.AQHLVLND.I
 10.8    0.01        R.QHAALLQQ.S
 10.0    0.02        I.VSNFDVTK.K
  9.7    0.06        G.EITCTGTK.A
  9.5   -0.06        E.KIHGLVDK.H
Top scoring peptide matches to query 11
Score greater than 27 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 43.0    0.04    4  ABL063C F.ANNEHLTK.I
 24.4   -0.94    4  ABL063C F.ANNEHLTK.I
 15.0   -0.94    4  ABL063C F.ANNEHLTK.I
 11.5    0.01               L.ALNVFFSK.S
 10.0    0.99               L.ALNVFFSK.S
  8.1   -0.93               K.EHINTQIA.A
  7.7   -0.98               S.VSQDHTIK.T
  7.0   -0.98               R.HLLNSDTK.R
  6.8    0.06               F.TYALDNTK.G
  6.0   -0.03               R.ANPELRVK.V
Top scoring peptide matches to query 12
Score greater than 39 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 33.6    0.04    1  ABR025C K.LKLSNGHY.T
 24.7    0.02   16  ABR155C R.KIISNSVGN.R
 17.2   -0.93               P.ELLSNDNK.E
 16.6   -0.93               K.NQLTTLNE.V
 16.3    0.02               R.QLISPFLD.G
 13.6   -0.01               L.AGILSEKSK.Q
 13.6    0.02   16  ABR155C R.KIISNSVGN.R
 13.6   -0.02               K.KLLSIFNP.Q
 13.6    0.03               R.QILSQTLE.L
 13.2    0.01               K.KLLDSRSN.L
Top scoring peptide matches to query 13
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 14
Score greater than 35 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.6    0.05    1  ABR025C D.FEPAEGAAR.S
 21.0    0.98               K.GAFPVLLQT.F
 11.8    0.08               K.DEQEALLQ.E
 11.3   -0.03               G.LYPAREAK.L
 11.0    0.02               K.FEPQGKQL.E
  9.9    0.99               A.KFAPEAQR.A
  9.5   -0.97               R.EMIEAALTA.T
  9.5    0.04               R.EMLAQAGAR.A
  9.5   -0.88    8  AER353W R.ESSAAQQEP.I
  7.3    0.01               R.FQSLPRAGA.Q
Top scoring peptide matches to query 15
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 50.8    0.05    3  AGL352W Y.GCNEVKPR.K
 34.8    0.01    7  AEL188W Y.QTAVVENAK.V
 21.0   -0.00               K.NRKQVNAK.C
 21.0   -0.97               K.NVGKDLNSI.S
 21.0   -0.97               K.SLQLGENTV.E
 20.8   -0.93               R.GWRVQQQG.G
 20.8   -0.93               R.GWRVQQQG.G
 20.4   -0.93    3  AGL352W Y.GCNEVKPR.K
 19.7    0.05               K.EAAARQEAI.D
 19.6   -0.95               R.QLSAVEQW.A
Top scoring peptide matches to query 16
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.1   -0.92        R.QTVPLQQPQ.S
  1.1   -0.92        R.QTVPLQQPQ.S
  0.8   -0.86        R.DNVIPYFGD.L
Top scoring peptide matches to query 17
Score greater than 17 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.06        K.AYTPIYVNL.N
  4.5   -0.89        K.SVFRGNMSR.T
  1.8   -0.82        K.MSTSGKQQAN.A
  1.2   -0.02        K.VQPTARVVAI.T
  1.1   -0.95        Y.IERSPAEPR.T
  0.8    0.08        -.MSLLFNSKN.K
  0.8   -0.91        -.MSLLFNSKN.K
Top scoring peptide matches to query 18
Score greater than 29 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.7   -0.99        R.TQSTVLTVAGS.D
 15.9   -0.06        L.FLAVDKTLR.I
 14.8    0.08        R.CGNVNKNLAA.N
 14.8   -0.90        R.CGNVNKNLAA.N
 12.3    0.10        K.QQAGAMLQNV.G
 11.2    0.08        F.QQMQQQIR.Q
  7.5    0.97        S.EKLSSSVRR.W
  6.9    0.06        K.GSIMQDILAD.V
  6.9    0.00        V.QDSVILATSK.A
  6.6   -0.93        F.DNVSTDKER.M
Top scoring peptide matches to query 19
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4   -0.04        S.SKRTLGDAVK.G
  4.3    0.01        K.DVIAGAVTGSGK.T
  3.6    0.06        R.EPTKIVNSAN.G
  2.7    1.00        I.KAKENAANVK.-
  2.0    0.02        K.TLLARACAAQ.T
  1.9   -0.97        R.LQSSKVQGQV.I
  1.8    0.02        R.EVVKIAEATD.L
  1.8    0.01        -.MSQLSAVPLK.M
  1.3   -0.96        G.AEQQSPLFR.V
  0.9    0.01        I.KAKENAANVK.-
Top scoring peptide matches to query 20
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.2    0.09    3  AGL352W E.YGCNEVKPR.K
  9.3   -0.90    3  AGL352W E.YGCNEVKPR.K
  2.0   -0.89               K.EEQQILESF.L
  2.0   -0.99               S.KDGKYLASGGK.G
  1.6    0.02               R.GLTIIYELGGS.D
  1.5    0.13               R.EQKEEMEAK.R
  0.1    0.10               K.YAQFIHNTGA.Y
Top scoring peptide matches to query 21
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2    0.03        -.MFRSILSRNA.T
  1.2    0.06        I.NKTNNTFINK.N
  1.2    0.06        I.NKTNNTFINK.N
  1.1    0.99        K.RTYPRIFQL.L
  0.8   -0.88        R.DEVQSNHPGGR.L
  0.1   -0.95        K.FMPFKSTEPL.P
  0.1   -0.88        R.CKGLNTNFEN.V
  0.0    0.02        I.TQLDKSVFTR.S
Top scoring peptide matches to query 22
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.0    0.10    3  AGL352W Y.SWCGDSSFEK.S
  7.4   -0.11               C.NVRTGALGSSLK.G
  7.2   -0.07               E.GNTKDGNLRVK.G
  7.2   -0.07               P.GSEQIRATIAR.D
  4.4    0.05               K.GQQNAPNGIASGS.S
  4.4    0.05               K.GQQNAPNGIASGS.S
  2.3   -0.07               R.QGSLKQRLANS.S
  2.2   -0.99               R.QQAQRRAEQS.K
  1.8    0.05               K.GQQNAPNGIASGS.S
  1.7    0.05               K.GQQNAPNGIASGS.S
Top scoring peptide matches to query 23
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.7   -0.85        K.EAYQSAVWGGEG.R
  7.4    0.07        E.YLGIGASSDVDR.S
  7.1    0.08        R.SNSFKAIELNAG.K
  6.1   -0.95        N.TSTPSFGATEKK.E
  6.1    0.14        R.QFVEAVMDEQG.R
  5.5   -0.04        A.APTTPATAIGPKK.S
  5.1    0.15        L.ATTNDAMVDDAK.G
  4.8    0.06        E.KYEATRQQAR.K
  4.3    0.02        R.LDHNKLQLDR.L
  4.3    0.13        A.AHYGEEYINR.Y
Top scoring peptide matches to query 24
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.5   -0.99        Y.IDVGCSGLIADGK.V
  3.3    0.05        R.AAADENPKTRET.S
  2.8    0.00        P.AAANAGSGVQNSKK.K
  1.8   -0.98        R.GSSEAEKLDRNV.V
  1.4    0.94        K.KSITDVPKTGLGS.S
Top scoring peptide matches to query 25
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.1    0.01        K.EAVLALQNQLGTI.M
  0.3    0.03        R.DKLLQAGGGAAAAEV.K
  0.0   -0.95        R.DKLLQAGGGAAAAEV.K
  0.0    0.99        K.EAVLALQNQLGTI.M
  0.0    0.00        L.NKLLEKNPMQR.I
  0.0   -0.98        L.NKLLEKNPMQR.I
  0.0   -0.95        R.NVGCVNQLLRPT.V
Top scoring peptide matches to query 26
Score greater than 28 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 32.0    0.14    1  ABR025C K.GAFTAGSADKASTGF.S
 13.6   -0.97               F.ATILDAKQVATQK.K
 13.3   -0.90               R.IRWQASGAAATEQ.L
 12.7   -0.92               L.SGMPDLKLGLNDK.G
 10.0   -0.94               K.IEIKGQKTNTQQ.A
  7.9   -0.82               A.TKFACNDEFQK.L
  6.3   -0.90               L.NVSLADLLNGDQK.A
  5.2   -0.94               F.TEKQLNRELEK.I
  4.7   -0.96               K.QFTALLRQPVTD.F
  4.5   -0.94               R.TLVSEAQQVGVRT.P
Top scoring peptide matches to query 27
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 93.1    0.11    1  ABR025C Y.HMSSVFEDNGALK.L
 82.5   -0.87    1  ABR025C Y.HMSSVFEDNGALK.L
 22.8   -0.97   19  ACR089C T.IQNIDYANRSLK.L
 16.1   -0.89    6  ADL238W R.QREGGCGMDLAIK.K
 14.9   -0.96               K.EQLAVDYLNTLR.Y
 14.3   -0.07               R.KLMSNLARLFIK.V
 13.1   -0.89               L.QMAMWEGVNQLK.S
 12.9    0.01   19  ACR089C T.IQNIDYANRSLK.L
 11.6   -0.94               G.QEGRFEVESNLK.L
 11.4   -0.01               T.IQSIQTFNNLKK.A
Top scoring peptide matches to query 28
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.2   -0.94        R.TLEAIEGHGGERLG.P
  4.7    1.00        S.LPSFIMTGSIKSR.A
  3.6   -0.05        L.SNVLAVELGPLGIR.C
  2.8    0.02        I.RVQRPSGHSSAVR.T
  2.7    0.13        G.MNHFTAFIENGR.I
  2.5   -0.96        N.AMDQLQGVHLLGR.R
  2.3    0.02        S.TKNTILKQYDGR.F
  2.3    0.98        R.KAPTPPKPVVTSGSA.I
  2.1    0.06        H.SIINQSFDSRLR.L
  2.0    0.06        S.GLWSSWLAAAYGR.L
Top scoring peptide matches to query 29
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.9   -0.51        D.ANSLTVGSWKRLK.S
  6.9   -0.38        R.DAGQNRSVVASGAVQ.E
  6.9   -0.38        R.DAGQNRSVVASGAVQ.E
  6.9   -0.42        K.DQQINKQLSLVLG.K
  6.9   -0.41        T.GENSVDQIKDVGAK.W
  6.9   -0.37        K.LCDDLIKDIQEP.S
  6.9   -0.38        R.QKEPMDKDIQNI.Q
  6.9   -0.33        C.SSSPQENASPEAQK.A
  6.0   -0.48        D.RPSGIGKNYKPSR.I
  5.9   -0.42        K.ELENSKSPSILEL.Q
Top scoring peptide matches to query 30
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.5   -0.05        G.VGQGNLHKRANNGK.D
 13.5   -0.05        G.VGQGNLHKRANNGK.D
 11.1   -0.05        S.VLPSLSQQHLADGK.R
 11.1   -0.05        S.VLPSLSQQHLADGK.R
  9.7    0.99        R.GGELKIWNVSATMS.S
  8.0    0.86        L.REIEHIVLVLSGK.G
  7.9    0.90        Y.LPDAVVKLSFFEK.F
  7.7   -0.07        G.VFSHVVEHVLQAK.R
  6.0    0.93        G.VGQGNLHKRANNGK.D
  5.5    0.09        L.VPDNSGGSGNDGFAAK.L
Top scoring peptide matches to query 31
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.2   -0.99        K.VESARLLPEEVGES.K
  1.5   -0.17        G.VNKLAGYLKPLVAK.G
Top scoring peptide matches to query 32
Score greater than 26 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.1    0.14        R.NIHMIASKQRPDL.L
 12.4    0.04        R.SAQILDLLLKAELP.D
 10.1   -0.90        K.RSEQAATKPVDLIP.V
  9.6    0.20        R.QVLIEALNLHCPD.L
  8.1    0.27        K.NILATLQNAGFDDE.D
  5.6   -0.74        K.QTQAAKACCTLNGT.Y
  5.3   -0.73        K.QQLPNGEQPNFGHG.Q
  4.8    0.05        K.MRSNLLPQKLIIP.D
  4.4    0.16        R.NNINFEFRDLKL.Q
  4.3   -0.73        K.QQLPNGEQPNFGHG.Q
Top scoring peptide matches to query 33
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.1    0.17        I.DWTVARGSNYQSR.E
  9.1    0.17        I.DWTVARGSNYQSR.E
  8.5    0.03        R.QTVAAKEAPMLRKP.D
  8.4    0.10        R.RRTSPDQVQLGPW.D
  7.5    0.02        R.TQATINKLKNIQAP.P
  6.0    0.11        K.STINALSWHENGVL.L
  6.0    0.02        A.GTRQGVIDISVPVAK.G
  3.4   -0.97        A.HPLVRLPAPNDGQK.Y
  2.0    0.04        K.DVSRVLSALGPRGVN.V
  1.7   -0.92        R.EELQLNVLQIQNV.R
Top scoring peptide matches to query 34
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.6    0.18        R.NYSSNCISSNSGVVG.K
  3.7   -0.04        K.VGGLGLNLTGADTVIF.I
  2.9    0.16        R.FYEMEQEHSSFI.R
  2.9    0.18        R.NYSSNCISSNSGVVG.K
  1.8   -0.90        R.LSHQCALDQGASFL.W
  1.7    0.08        R.LSHQCALDQGASFL.W
  1.1   -0.05        R.KLVVLREDMPSLF.A
  0.8    0.11        K.LFRNSTGADISSDY.M
  0.8    0.13        K.QQYTVLENSNSLF.G
  0.7   -0.90        R.VGPSQQNRQDSMSI.Y
Top scoring peptide matches to query 35
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.4    0.22        R.TSSPSMNNSSGNSALY.H
  1.8    0.15        A.FFQSLYANADPDTK.R
  1.4    0.17        K.APGVPPYADNACQLSG.L
  0.9   -0.92        A.YASRTGEMLAAVGHR.A
Top scoring peptide matches to query 36
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2   -0.04        R.KDSPPSQLLPLLTTN.A
  0.1    0.08        K.KKEEAAAAAAAASSSSSS.S
Top scoring peptide matches to query 37
Score greater than 32 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
108.4    0.11    1  ABR025C K.LGGSTADALSAVVTDDGK.L
 12.3    0.12               L.RSAGNWSLGLQETEK.S
 10.4    0.05               A.ENEVYGAKLWAGLVK.E
  8.1   -0.99               V.LPSLSQQHLADGKRK.L
  6.9    0.08               R.FAQVIDESLAVLQQL.S
  5.2    0.06               G.LGSSASIAVCLALAMGR.L
  4.4   -0.91               R.LNNGFSVADLRDSLR.S
  3.3    0.22               R.NPQNDESSMALLNEI.I
  2.8    0.03               H.DTKAAEAVLDQFIKK.N
  2.3    0.13               S.LGGSANVRSLSENTNR.H
Top scoring peptide matches to query 38
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.6    0.93        A.ALGYRSVPGNVAYASR.T
  5.3    0.89        D.VGFKYALPIGYSPNR.N
  4.5   -0.02        K.DEYELAMLRKACAI.T
  4.3    0.98        R.SISLNQLSTSIYPEE.L
  4.3    0.98        R.SISLNQLSTSIYPEE.L
  3.5    0.84        A.LSIHKSQGQTLNKVK.V
  3.2    0.85        R.AIAGSHGVVIGGFKVNR.S
  2.8    0.06        R.WDQDFLEVNTVVSQ.S
  2.7   -0.14        P.MAPPPRAQSPVIPPPK.S
  2.4    0.09        R.SNSLSSQGKANASNWQ.A
Top scoring peptide matches to query 39
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.8   -0.89        K.LNPDRVACQDATAQM.A
  9.8   -0.02        K.QGSIPPLAIQPVYAHP.G
  8.9    0.98        R.CIVEDVLLQIRDSK.H
  3.2    0.12        R.APDGSWAAQPPSAQPAH.V
  3.2    0.12        R.APDGSWAAQPPSAQPAH.V
  2.6   -0.04        K.EHLGRVAALLAPHGFT.L
Top scoring peptide matches to query 40
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.6   -0.89        R.SENAIAPTKGSAAAAGYD.I
  4.7   -0.90        R.LSWSPDGQHIAVPNAT.N
  2.4    0.03        R.AWLKSVGELDQSLVF.C
  1.2    0.03        K.TKTAITTEQSQKLIQ.T
  1.1    0.14        R.ESNAINQVIGQMAGATS.V
  1.1    0.14        R.ESNAINQVIGQMAGATS.V
  0.6    0.08        G.GTKPVAQPAAAADVHME.-
  0.5   -0.05        E.GIRGFYRGLSANLLR.A
Top scoring peptide matches to query 41
Score greater than 20 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3    0.16        G.TSPNGIEVESTSGDNAK.A
  7.2    0.04        A.EKLLSMDANTLTELK.N
  5.9    0.08        R.QSNQIKKTSYAQSSH.I
  5.0    0.10        R.LEGASIGGRDXDVQFL.M
  5.0    0.10        R.LEGASIGGRDXDVQFL.M
  4.5    0.16        G.VARDQQSLNSENDVK.H
  4.4   -0.01        C.WALSIHKAQGQTIPR.L
  4.1   -0.01        C.WALSIHKAQGQTIPR.L
  4.0    0.09        R.NENVLESSLSQMKAR.W
  4.0    0.09        R.NENVLESSLSQMKAR.W
Top scoring peptide matches to query 42
Score greater than 37 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 61.8    0.11    2  AEL111C  Y.NLYDENIAPQCSPIK.L
 61.8    0.11    5  mAEL103W Y.NLYDQNIAPQCSPIK.L
 46.2    0.11    5  mAEL103W Y.NLYDQNIAPQCSPIK.L
 44.9   -0.88    2  AEL111C  Y.NLYDENIAPQCSPIK.L
 44.9   -0.88    5  mAEL103W Y.NLYDQNIAPQCSPIK.L
 33.9   -0.88    5  mAEL103W Y.NLYDQNIAPQCSPIK.L
 32.6    0.11    5  mAEL103W Y.NLYDQNIAPQCSPIK.L
 28.0   -0.88    2  AEL111C  Y.NLYDENIAPQCSPIK.L
 28.0   -0.88    5  mAEL103W Y.NLYDQNIAPQCSPIK.L
 20.5    0.26                K.NSNNNNNQINQNNEQ.L
Top scoring peptide matches to query 43
Score greater than 35 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 66.1    0.09    1  ABR025C Y.ELTLEQPGATSISVALR.A
 38.9   -0.90    1  ABR025C Y.ELTLEQPGATSISVALR.A
 18.4    0.05               R.QNVYLGVAKPAGLIVIQ.A
 15.8    0.17               R.QNTELKYLNFSGNTR.F
 13.8    0.20               K.DMPSFVVPTPRNSLHS.D
 13.7    0.05               R.QNVYLGVAKPAGLIVIQ.A
 11.9    0.18               D.QAADAEQSPEPETKKR.K
 11.8    0.12               N.LNDLVAEVSTRENVPK.K
 11.0    0.21               K.ELNIKDPLFDEQWH.L
 10.8    0.22               Q.QQQAQQQSQLQNPEK.Q
Top scoring peptide matches to query 44
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.2    0.00        R.EAQVSNITAAKAVADVIR.T
  4.3   -0.95        E.EEVADLRLSLDNVQVR.G
  3.4    0.10        Q.LSSPNPESAQLSELGPTK.T
  3.0   -0.87        T.NNVNNAVAAAGAGAAAPSVSK.I
  3.0   -0.87        T.NNVNNAVAAAGAGAAAPSVSK.I
  2.9   -0.90        R.QLSAVEQWAFHQNIGK.N
  0.1    0.10        Q.LSSPNPESAQLSELGPTK.T
  0.1    0.11        T.NNVNNAVAAAGAGAAAPSVSK.I
  0.1    0.11        T.NNVNNAVAAAGAGAAAPSVSK.I
  0.1    0.25        R.EPGAGLFQGGYNMGQEAQ.K
Top scoring peptide matches to query 45
Score greater than 28 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.6    0.09               N.NTLEEEKARAEDDILK.L
 19.7   -0.86   20  ACL132C Q.MLQDQLNDVQLALNEK.T
 14.5   -0.86   20  ACL132C Q.MLQDQLNDVQLALNEK.T
 14.0    0.12   20  ACL132C Q.MLQDQLNDVQLALNEK.T
 13.9    0.09               R.FEYLFELAKVDETTGI.N
 13.7   -0.86   20  ACL132C Q.MLQDQLNDVQLALNEK.T
 13.2   -0.01               K.KAAKVLASFVKPDQMLGA.D
 12.6    0.12   20  ACL132C Q.MLQDQLNDVQLALNEK.T
 12.6   -0.86   20  ACL132C Q.MLQDQLNDVQLALNEK.T
 12.4    0.12   20  ACL132C Q.MLQDQLNDVQLALNEK.T
Top scoring peptide matches to query 46
Score greater than 29 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 67.8    0.07    1  ABR025C K.LGGSTADALSAVVTDDGKLK.L
 12.4   -0.75               K.NLQQQYVQQSPGAPDQD.S
  9.3    0.24               K.NLQQQYVQQSPGAPDQD.S
  7.0   -0.98               C.NSLLKFLNNVTDDGKLK.Q
  6.2    0.11               R.TQLESILEERNNKLTQ.L
  5.8    0.27               K.SDFHNATAISSSSYFGEP.E
  5.5    0.11               L.RSSRAQQQSLNTDGVAAK.K
  5.5    0.24               K.NLQQQYVQQSPGAPDQD.S
  5.4    0.11               R.TQLESILEERNNKLTQ.L
  5.4    0.11               R.TQLESILEERNNKLTQ.L
Top scoring peptide matches to query 47
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.4    0.95        R.SPVNAKDANGWPPLFHAL.S
  4.5    0.05        I.HKENMAYIEGLSEEQR.T
  2.9   -0.01        R.QVGVICLLAQIGCFVPC.D
  2.8   -0.22        A.SINKNLVALKGPLATPIGK.G
  2.6   -0.89        K.SPRNSPNMPGSTGGSSSVES.A
  2.5   -0.22        A.SINKNLVALKGPLATPIGK.G
  2.3    0.98        R.QVGVICLLAQIGCFVPC.D
  1.6    0.88        S.PLHRNEASGALSGLTRVR.K
  1.6   -0.11        S.PLHRNEASGALSGLTRVR.K
  1.6    0.93        K.LLAANDLELAVPGTYSTGK.P
Top scoring peptide matches to query 48
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.6   -0.95        K.GSVKDTVAEYSFEYSTEG.K
Top scoring peptide matches to query 49
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.5    0.18    1  ABR025C L.KLGGSTADALSAVVTDDGKLK.L
Top scoring peptide matches to query 50
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.5    0.97        R.AQFLNPQFQTDVCKPLR.I
  9.0   -0.21        R.VSAKTGLNVADLLPAIVDRI.P
  8.9    0.02        G.SQGINAVFAELNQGENITR.S
  7.0   -0.96        G.SQGINAVFAELNQGENITR.S
  6.1    0.09        L.MQLLESDGENNSATVPSDR.K
  2.9    0.98        E.TAAQALDESDMNIYRIPR.T
  2.9   -0.17        A.SLVPEAPPVLTSKDKVTQR.L
  2.5   -0.05        G.NSLTESRVKSDITVTEER.R
  2.5    0.97        R.AQFLNPQFQTDVCKPLR.I
  2.4   -0.99        L.SLSMREVDQATGQTATVNR.G
Top scoring peptide matches to query 51
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0    0.91        K.NANSVRTRAVAAAAGQFFNK.I
  7.0    0.91        K.NANSVRTRAVAAAAGQFFNK.I
  5.5   -0.07        R.GLIGNDSVFVQRLDDMFGL.Y
  3.4    0.84        R.GSSSSRPASHTGLTGRLLQAI.S
  3.3   -0.19        A.LGPLNERIMTLGALKDAQR.Q
  2.8   -0.13        R.ALQDERGALSGPRGMLAGLGAG.L
  2.6   -0.08        K.LGETSQTVGLNNQQLLQLH.K
  2.5    0.05        R.IGDPFSNSQGPPAFHVECH.R
  2.2    0.80        D.GMRLRGDINVLLLGDPGTAK.S
  2.0   -0.10        K.NCPPPDSNALITRLQSLLS.S
Top scoring peptide matches to query 52
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.4    0.02        L.TPATTQRVVHQHRGGSGGCR.K
  9.3    0.06        N.STYTLKVNNGDIVEDSFMK.M
  7.3    0.81        R.LGLQCAIVVLLNKVDLLPSP.A
  7.0   -0.08        A.LLDLGVQDVTGFISNKDLSK.M
  6.8   -0.94        W.ELLLDQAANEEREFENSR.R
  6.2   -0.08        D.VNEQLRNVIANKHQEGLAK.F
  6.2   -0.08        D.VNEQLRNVIANKHQEGLAK.F
  6.2   -0.08        D.VNEQLRNVIANKHQEGLAK.F
  5.7    0.03        K.FHQLNKAIANLVDDFGMVQ.F
  4.3   -0.97        L.TPATTQRVVHQHRGGSGGCR.K
Top scoring peptide matches to query 53
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.0   -0.02               H.PDDEPDSEPLRGPLGLNRDK.A
  9.0   -0.11   20  ACL132C P.PTEQPRLFHWQVLQRQR.E
  9.0   -0.11   20  ACL132C P.PTEQPRLFHWQVLQRQR.E
  9.0   -0.11   20  ACL132C P.PTEQPRLFHWQVLQRQR.E
  9.0   -0.11   20  ACL132C P.PTEQPRLFHWQVLQRQR.E
  9.0   -0.11   20  ACL132C P.PTEQPRLFHWQVLQRQR.E
  9.0   -0.11   20  ACL132C P.PTEQPRLFHWQVLQRQR.E
  6.4   -0.12               L.PANSSYQISVKVVEGSLLDSK.L
  6.4   -0.01               A.PKALPWYGDNMAWQLDVSK.S
  6.4   -0.15               L.PVGTLLKPSFFSPGQYVDLR.S
Top scoring peptide matches to query 54
Score greater than 20 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.1   -0.80        S.EAEEIAQSSASGDSVVEDDRK.A
  7.1   -0.88        D.VTTWAQEVDEMIEIDSKVK.V
  5.7    0.14        R.QKQRQQIQQEPAAQPAAQPA.A
  5.4    0.04        K.EQQRFQKLSQLYNAIIQN.A
  3.5    0.20        K.GLTDGRAELDHESPDGHSLNT.N
  3.5    0.08        R.ILWQEEENSKFLELKLEA.R
  2.3    0.09        D.WGGKIEPYIEVNMQKLEGK.A
  2.2    0.11        K.QVTELVRGFGTSPNGIEVEST.S
  2.0   -0.79        K.GLTDGRAELDHESPDGHSLNT.N
  1.8   -0.95        K.EQQRFQKLSQLYNAIIQN.A
Top scoring peptide matches to query 55
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 56
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.3    0.72        S.SINSSSHHNIANGSGVAADGSRTNR.Q
  2.3   -0.27        S.SINSSSHHNIANGSGVAADGSRTNR.Q
  1.5    0.62        -.MMLLSQPGIWLLVSLFLCSSVN.S
  0.9    0.63        R.XNVQHLKWLTQVNQLDLVELQ.N
Top scoring peptide matches to query 57
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.3    0.58        K.YEIGDALGIHARNNEESVKSFLHA.Y
  0.7   -0.57        R.LQLISKGVDGESVPDVAQARLANHR.S
Top scoring peptide matches to query 58
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.1    0.64        R.DEKLQHLQLIVSNICDVSASEDAAA.L
Top scoring peptide matches to query 59
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.8   -0.48        F.IGHAMALWTNDDYLQQPARPTFER.I
  3.8   -0.48        F.IGHAMALWTNDDYLQQPARPTFER.I
  2.8   -0.51        A.LRDELVSLVQGSDERTPEASNEMVR.R
  1.5    0.68        R.FHQPYSFGDQDPLPLNYTDPSSTSN.S
  1.5   -0.33        A.QAEGTDSSIEQPAADKHGRAMDNNQR.A
  1.4   -0.38        K.NPLEDPQREDMSIDLSEGGVSDIQNA.F
  1.2   -0.48        T.HLGLDLDNNTMEEVYYKFGLGSSTK.D
  1.0    0.48        A.LRDELVSLVQGSDERTPEASNEMVR.R
  0.8   -0.62        L.AANYLNIKPLLDAGCKVVAEMIRNR.S
  0.6   -0.62        K.LEQQKLAMWRTELELSLLDTQSAK.D
Top scoring peptide matches to query 60
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4    0.65        R.GEHYKPTAMYSQMHPSNDYIGTPATA.Y
  3.8   -0.59        K.EYYAKLNEKFLRPPDPFTLDSIVI.V
  3.6    0.54        D.IPLYAVLGNHDSFPYGQLAQENSGFK.N
  3.6    0.54        D.IPLYAVLGNHDSFPYGQLAQENSGFK.N
  3.1    0.54        D.IPLYAVLGNHDSFPYGQLAQENSGFK.N
  2.5   -0.60        Y.ENGGPLQYTDIEVPKPKATELLINVK.Y
  2.5   -0.34        K.ENVLFNSMMHQDAHEFLNFLMNAL.S
  2.5    0.36        I.KNVLLEHLSEVDPYLQNQILQYVL.-
  1.8   -0.51        I.NPLMKKCAVLVVVTSVDGFDGGDYER.A
  1.5    0.49        A.AGNQNQNAGKGGVETTQLVGGQRPGAARK.A
Top scoring peptide matches to query 61
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.9    0.37        A.EQLSAGSTDTAGSDVLSQHAPSSASSQTSK.V
  3.5    0.24        L.ETWKQTVGAELSAFKADVVQALEEQR.K
  3.3    0.23        R.YKDHYQIPLQDNLSLQGFLLGSELGS.R
  3.3   -0.76        R.LANAGEQLAWVRALPVNLWGMSFGAYT.A
  3.3   -0.76        R.LANAGEQLAWVRALPVNLWGMSFGAYT.A
  2.7   -0.68        I.NLMTADTVIIFDSDWNPQADLQAMAR.A
  2.7   -0.82        T.GNLSICNNGLSISGISGKPTRYWTVLK.D
  2.0   -0.81        I.DKLRAINDHQISQQDMNTLALVIDGK.S
  1.4   -0.60        K.MENFSDNSLLTELGSLYDMMVRANGE.I
  1.4   -0.60        K.MENFSDNSLLTELGSLYDMMVRANGE.I
Top scoring peptide matches to query 62
Score greater than 14 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.15        C.SMLNYKVHQSFTNHQYQELVNDAKHK.Y
  1.2    0.93        L.FRPTEAADPDDCFGMLAGLQHLRADPEK.L
  0.9   -0.97        K.GINEDTASEGQHGAGAQGGRREEGGSPYEEL.P
  0.7   -0.31        T.SGSLKHIIEKYPFQALLLALQCTWTNK.I
  0.4    0.69        V.THSLSGDSAPVKTPVGVTAIPVASKSVNPVDK.V
  0.1    0.88        K.MQQASLNQLTPQQRAQLQQRQQSTQQS.Q
  0.0   -0.16        K.VFLDFDNDISGEYLAEMVIKYVIHSLE.K
Top scoring peptide matches to query 63
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2   -0.41        K.HLFATELDTIRQVAFINDSVVGILLDSGQLSR.I
Top scoring peptide matches to query 64
Score greater than 22 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.2   -0.14        K.DGALVAYCEDPTIGIGGYDGLPYGSDANAQELDSEG.R
 10.2   -0.14        K.DGALVAYCEDPTIGIGGYDGLPYGSDANAQELDSEG.R
 10.2    0.81        K.QVTNWTNDEWHDYLSVNPTRDEVTHYRVDP.N
 10.2   -0.40        K.KDVDFLSRLNIMDYSLLLGIHDINLAAANSEDI.H
  8.7    0.44        R.HIVGELFKKKPTTSVNPDETVALGAAIQGGILSGEI.K
  8.5   -0.29        S.VMDYLHSAVPSAESIGFIMPCHSTPWQSHLHR.N
  8.2   -0.52        D.LTGYITEGQIFVDRQLSNKGIYPPINVLPSLSR.L
  8.2   -0.52        D.LTGYITEGQIFVDRQLSNKGIYPPINVLPSLSR.L
  8.2   -0.52        D.LTGYITEGQIFVDRQLSNKGIYPPINVLPSLSR.L
  7.9    0.57        R.MEAQGETSKDVSFTQSLLTKIVDNLQITILNIH.V
Top scoring peptide matches to query 65
Score greater than 23 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.3   -0.49        M.NIASTVVNQQNAGLASMDTHQLLDLFDTDNSLAQVK.E
  9.8    0.57        R.ANPAFVLPLQRDATGAGEEQGGQPVEMHYVQWQFV.G
  9.8   -0.42        R.ANPAFVLPLQRDATGAGEEQGGQPVEMHYVQWQFV.G
  9.8   -0.42        R.ANPAFVLPLQRDATGAGEEQGGQPVEMHYVQWQFV.G
  9.8    0.30        K.NNPITYKYIKHGQMIEIIWTILPAIILLMIAFP.S
  6.7   -0.15        K.KPLDLSQSSVARNLMNQDAAADGSNEDEDSGNNNNSS.N
  6.6    0.60        L.PFQLLDHTDDAQSEFDDRMSFVDVDYPDLIAKK.L
  6.6   -0.38        L.PFQLLDHTDDAQSEFDDRMSFVDVDYPDLIAKK.L
  6.0   -0.51        K.DINNMLDLFCATTDVADKKSTNALLTYILELGQGL.E
  6.0   -0.51        K.DINNMLDLFCATTDVADKKSTNALLTYILELGQGL.E
Top scoring peptide matches to query 66
Score greater than 15 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5    0.52        S.TNAPLDELSIGPNALTRQLCSEESIDCFLDAIINK.R
  2.5   -0.46        S.TNAPLDELSIGPNALTRQLCSEESIDCFLDAIINK.R
Top scoring peptide matches to query 67
Score greater than 15 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7    0.43        R.WQKLEAPLFSLRTMGQEIPTTENNILPQIFQMLC.N
  2.6   -0.54        R.NMDPMQSVGTGLLYNALPSAIAGSPSIQQYFATPLQPVA.G
  2.6   -0.54        R.NMDPMQSVGTGLLYNALPSAIAGSPSIQQYFATPLQPVA.G
  2.5    0.03        R.TTSMQQQQQQQQQQQQQQQQQQQQQQQQQQQQ.Q
  2.5    0.60        Q.MEQFMAGKASSGGNMFMGAGMSSGPLALGGSSGLRMSPGPAK.E
  2.4    0.43        R.WQKLEAPLFSLRTMGQEIPTTENNILPQIFQMLC.N
  2.4    0.45        R.NMDPMQSVGTGLLYNALPSAIAGSPSIQQYFATPLQPVA.G
  2.4   -0.54        R.NMDPMQSVGTGLLYNALPSAIAGSPSIQQYFATPLQPVA.G
  2.4    0.43        R.WQKLEAPLFSLRTMGQEIPTTENNILPQIFQMLC.N
  2.4   -0.55        R.WQKLEAPLFSLRTMGQEIPTTENNILPQIFQMLC.N