Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0422_q2.pkl
Database        : Ashbya Ashbya (4796 sequences; 2346673 residues)
Timestamp       : 27 Jul 2007 at 14:15:44 GMT
Significant hits: ABR025C  440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
                  AGL352W  47585:49186,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic
                  ABL063C  282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
                  AFR711C  1745290:1746975,reverse,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
                  ADR019C  739205:739837,reverse,Syntenic homolog of Saccharomyces cerevisiae YER011W (TIR1) and YIL011W (TIR3
                  AER058W  746106:746834,forward,Syntenic homolog of Saccharomyces cerevisiae YLR390W-A (CCW14)

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 37 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    ABR025C                           Mass: 20232    Score: 396    Queries matched: 8
 440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   365.66   729.31   729.37   -0.06 0  14  15 1  R.GYVTYK.G
3   384.19   766.36   766.40   -0.03 0  30  0.25 1  S.TGFSISR.G
9   462.73   923.44   923.43   0.01 0  35  0.077 1  K.GAFTAGSADK.A
18   540.29   1078.57   1078.53   0.04 0  45  0.0091 1  S.SVFEDNGALK.L
41   838.94   1675.87   1675.83   0.05 0  148  4.4e-013 1  K.LGGSTADALSAVVTDDGK.L
57   987.43   1972.85   1972.87   -0.01 0  45  0.0088 1  R.SASMYHMSSVFEDNGALK.L
66   1110.04   2218.06   2218.15   -0.09 0  37  0.045 1  S.SSPYELTLEQPGATSISVALR.A
77   1229.48   2456.95   2457.13   -0.18 0  43  0.019 1  K.GNSGFYPVGSSSPYELTLEQPGAT.S

 
      Proteins matching the same set of peptides:
      mABR025C                          Mass: 18217    Score: 396    Queries matched: 8
 hom. to Cwp1p,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1);

2.    AGL352W                           Mass: 58032    Score: 139    Queries matched: 4
 47585:49186,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   535.24   1068.47   1068.43   0.04 0  42  0.017 1  Y.FACGSNEER.A
22   580.30   1158.58   1158.54   0.04 0  55  0.00092 1  K.LFGYLCGSDK.K
30   653.37   1304.73   1304.67   0.06 0  19  3.5 1  K.LSYLLNEYYK.A
33   708.92   1415.82   1415.75   0.07 0  24  1.2 1  A.ATSSSGEVPEIVIK.G

 
      Proteins matching the same set of peptides:
      mAGL352W-NN                       Mass: 56261    Score: 139    Queries matched: 4
 Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1);
3.    ABL063C                           Mass: 42563    Score: 111    Queries matched: 2
 282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   494.80   987.58   987.56   0.02 0  38  0.052 1  K.LSGDLVISGK.Q
34   716.41   1430.80   1430.74   0.06 0  79  4.2e-006 1  K.TANDIVISNTNLR.S + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      mABL063C                          Mass: 40673    Score: 111    Queries matched: 2
 Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) and YDR055W (PST1); 1-intron
4.    AFR711C                           Mass: 58053    Score: 71     Queries matched: 1
 1745290:1746975,reverse,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
52   952.98   1903.94   1903.94   0.01 0  71  1.9e-005 1  K.VTAPDCEALQSGMIVVSK.D

 
      Proteins matching the same set of peptides:
      mAFR711C                          Mass: 55938    Score: 71     Queries matched: 1
 weak sim. with Fig2,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
5.    ADR019C                           Mass: 20820    Score: 61     Queries matched: 1
 739205:739837,reverse,Syntenic homolog of Saccharomyces cerevisiae YER011W (TIR1) and YIL011W (TIR3
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
73   1172.01   2342.01   2342.13   -0.12 0  61  0.00019 1  K.LLAGNFPTEADYEAIDFETVK.N

 
      Proteins matching the same set of peptides:
      mADR019C-HMM                      Mass: 19120    Score: 61     Queries matched: 1
 weak hom. to ScTip1,Syntenic homolog of YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog
      mADR019C-NN                       Mass: 19048    Score: 61     Queries matched: 1
 weak hom. to ScTip1,Syntenic homolog of YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog
6.    AER058W                           Mass: 22944    Score: 52     Queries matched: 1
 746106:746834,forward,Syntenic homolog of Saccharomyces cerevisiae YLR390W-A (CCW14)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
24   592.78   1183.55   1183.50   0.05 0  52  0.0015 1  K.CFSSICPEGK.A

 
      Proteins matching the same set of peptides:
      mAER058W                          Mass: 20648    Score: 52     Queries matched: 1
 Hom. to Ssr1/Ccw14,Syntenic homolog of Saccharomyces cerevisiae YLR390W-A (CCW14)
7.    ACL170W                           Mass: 21437    Score: 27     Queries matched: 2
 61182:61754,forward,NOHBY312; No homolog in Saccharomyces cerevisiae
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   359.49   1075.46   1075.53   -0.07 0  15  9.3 2  R.AGSSSTGIGSRP.T
 19   547.27   1092.53   1092.53   0.00 0  12  17 3  R.QGSLVSGSTGSL.S + Deamidation (NQ)

8.    AFR071W                           Mass: 182081   Score: 23     Queries matched: 1
 547832:552565,forward,Syntenic homolog of Saccharomyces cerevisiae YKR031C (SPO14)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 41   838.94   1675.87   1675.82   0.06 1  25  0.94 2  L.RSAGNWSLGLQETEK.S + Deamidation (NQ)

9.    ACR160C                           Mass: 48918    Score: 22     Queries matched: 1
 634978:636270,reverse,Syntenic homolog of Saccharomyces cerevisiae YOR209C (NPT1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   384.19   766.36   766.35   0.01 0  24  0.93 2  R.ASFGIGTN.F + Deamidation (NQ)

10.   ADL027W                           Mass: 38950    Score: 19     Queries matched: 1
 652349:653359,forward,Non-syntenic homolog of Saccharomyces cerevisiae YAL018C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   359.49   1075.46   1075.54   -0.08 1  19  3.6 1  Y.DQRSLSSQR.T

11.   ACL196W                           Mass: 36771    Score: 19     Queries matched: 1
 18017:19021,forward,Syntenic homolog of Saccharomyces cerevisiae YLR354C (TAL1) and YGR043C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   535.24   1068.47   1068.44   0.03 0  19  3.1 2  R.FALNDDAMAT.E + Deamidation (NQ)

12.   ABR207W                           Mass: 278567   Score: 18     Queries matched: 2
 789505:796713,forward,Syntenic homolog of Saccharomyces cerevisiae YHR165C (PRP8)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   384.19   766.36   766.36   0.00 1  13  12 6  R.TFGRANT.E + Deamidation (NQ)
 34   716.41   1430.80   1430.80   -0.01 1  14  12 4  R.LPFSAVLSIEKLN.D + Deamidation (NQ)

13.   AGL351W                           Mass: 60203    Score: 18     Queries matched: 1
 49757:51424,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 30   653.37   1304.73   1304.67   0.06 1  19  3.5 1  K.LSYLLNKYYQ.E + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      mAGL351W                          Mass: 58200    Score: 18     Queries matched: 1
 Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1);
14.   AER027W                           Mass: 83653    Score: 18     Queries matched: 1
 685709:687967,forward,Syntenic homolog of Saccharomyces cerevisiae YBR142W (MAK5)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   494.80   987.58   987.56   0.02 0  21  2.5 2  K.LSATVLQGLS.R

15.   ABL020W                           Mass: 70409    Score: 18     Queries matched: 1
 359099:360931,forward,Syntenic homolog of Saccharomyces cerevisiae YMR100W (MUB1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   547.27   1092.53   1092.59   -0.06 1  19  3.5 1  R.SVLSNRASFI.I

16.   AEL092W                           Mass: 71836    Score: 17     Queries matched: 1
 452738:454603,forward,NOHBY507; No homolog in Saccharomyces cerevisiae'
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
49   933.44   1864.86   1864.85   0.01 1  17  4.5 1  S.NTTNTTNGNNNKSGTIGR.L + 2 Deamidation (NQ)

17.   ACR009W                           Mass: 78755    Score: 17     Queries matched: 1
 371964:374006,forward,Syntenic homolog of Saccharomyces cerevisiae YEL062W (NPR2)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
44   872.97   1743.92   1743.86   0.07 0  20  2.9 1  R.NIPPFLNSSDVAEEVL.R + Deamidation (NQ)

18.   ACL014C                           Mass: 60992    Score: 17     Queries matched: 1
 333900:335474,reverse,Syntenic homolog of Saccharomyces cerevisiae YMR004W (MVP1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
28   637.85   1273.70   1273.64   0.05 1  20  3.1 1  E.LSNQWNKADAK.I

19.   AFR566C                           Mass: 190647   Score: 16     Queries matched: 1
 1449776:1454926,reverse,Syntenic homolog of Saccharomyces cerevisiae YMR229C (RRP5)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   384.19   766.36   766.39   -0.02 0  20  2.4 3  V.TGFISNK.D + Deamidation (NQ)

20.   ABR170W                           Mass: 52077    Score: 16     Queries matched: 2
 721305:722693,forward,Syntenic homolog of Saccharomyces cerevisiae YJR122W (CAF17)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 27   425.54   1273.61   1273.78   -0.17 1  (5) 98 8  D.AVKFLNGLITAK.L
 28   637.85   1273.70   1273.78   -0.08 1  17  5.5 2  D.AVKFLNGLITAK.L

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
21   567.33   1132.65   1132.65   -0.00 1  17  6.9 1  QFDLALKLGK + Deamidation (NQ)
5   422.70   843.39   843.48   -0.09 1  15  11 1  ETTKIPR
26   623.80   1245.59   1245.50   0.10 0  15  10 1  FNQDASCFSAV + Deamidation (NQ)
15   517.27   1032.53   1032.53   0.00 1  15  11 1  VNIRNSSSR + Deamidation (NQ)
75   1214.05   2426.08   2426.22   -0.13 1  15  7.5 1  QHSIYDQLVGKLMNNEPLPTK + 2 Deamidation (NQ)
4   416.67   831.33   831.41   -0.08 0  14  14 1  SALQQSQA
7   439.21   876.40   876.46   -0.06 0  13  14 1  AENITTTK
31   682.34   1362.67   1362.64   0.03 0  13  15 1  DWFDEHFVLR
54   963.49   1924.96   1925.01   -0.06 0  13  13 1  MTVAHLQLAMADAVVLNK + Deamidation (NQ)
72   1144.48   2286.95   2287.08   -0.13 0  13  15 1  YYHMSTVQQNTLAAFVNLGK + 3 Deamidation (NQ)
85   1017.84   3050.51   3050.47   0.04 1  12  11 1  QKFEDSLSPQIIVDFHSHNNPENQVK + Deamidation (NQ)
27   425.54   1273.61   1273.61   -0.01 0  10  27 1  NVDNSIANDIAK + Deamidation (NQ)
56   981.51   1961.01   1961.00   0.01 1  9  31 1  TVMVSTEQLAILNANKNL + 3 Deamidation (NQ)
63   1091.98   2181.95   2181.95   0.00 0  9  35 1  NHLPQHYANMSQEAMPAEL + 2 Deamidation (NQ)
43   870.89   1739.76   1739.80   -0.04 0  9  37 1  HGAVEVDFAQEVQAAAP + 2 Deamidation (NQ)
78   1306.03   2610.05   2609.33   0.71 0  9  40 1  LNDLLAQHSVSSLSEPPATLYTPR + Deamidation (NQ)
68   1118.03   2234.05   2234.17   -0.12 0  8  32 1  DVSIQELLQTFTPPKPHAGR + Deamidation (NQ)
39   791.88   1581.74   1581.74   -0.00 1  8  39 1  WRAAHDLDWDAAR
69   745.75   2234.22   2234.14   0.08 0  7  48 1  VALDEELAALDAHIASVQDAIA
48   932.97   1863.92   1863.85   0.06 1  7  46 1  DGIQQAGYMTRNSHGTK + Deamidation (NQ)
36   771.96   1541.90   1541.87   0.03 1  7  63 1  LIEIYPTLKQPVQ + Deamidation (NQ)
92   1230.77   3689.29   3689.84   -0.55 1  7  47 1  SDHEYIQFPLVQGMGFVTAIYYNLVPKLYSPV + 2 Deamidation (NQ)
93   1234.11   3699.29   3698.72   0.57 1  6  49 1  DGEAPVTNFVSDKSPSHYAHLYASNDVQGSHVIR + 2 Deamidation (NQ)
90   1176.78   3527.32   3527.69   -0.37 1  6  55 1  LEDENAQPLVQGLFPKEGNADTVFAINYFTAI + 4 Deamidation (NQ)
23   581.31   1160.60   1160.66   -0.06 1  6  74 1  FLEGIIRNAK + Deamidation (NQ)
45   882.90   1763.79   1763.92   -0.14 0  6  64 1  WSLIIPTPPFQEAHK + Deamidation (NQ)
80   1379.50   2756.99   2756.43   0.56 1  6  85 1  PRPPRTSSQVSLASSSSIQSSLVEQK + Deamidation (NQ)
61   1032.96   2063.92   2063.90   0.02 0  6  62 1  MQLLESDGENNSATVPSDR + 2 Deamidation (NQ)
8   457.18   912.35   912.53   -0.18 1  5  78 1  KSPDILLQ
35   766.88   1531.74   1531.67   0.07 0  5  82 1  MLQNNELEPDTVE + Deamidation (NQ)
71   1140.92   2279.82   2280.08   -0.26 0  5  1.2e+002 1  DVVFTSIQDQFLQEVPEQR + 3 Deamidation (NQ)
47   927.91   1853.81   1853.07   0.74 0  4  95 1  LGQQLAAGATALLSLASLR
42   846.90   1691.79   1691.88   -0.10 1  4  94 1  SKQTFGQLAESLDLR
86   1032.18   3093.51   3093.40   0.12 1  4  59 1  QAINLYKNSKPVDSEEMQETDDEAPQI + 2 Deamidation (NQ)
14   515.24   1028.46   1028.59   -0.13 0  4  1.2e+002 1  LSIAEELVR
76   1221.91   2441.81   2442.07   -0.26 1  4  1.7e+002 1  QENISLRGYVENILASENNMGS + 5 Deamidation (NQ)
83   1445.02   2888.02   2887.25   0.77 1  4  1.5e+002 1  SSCNTDTRLSPFTSSMTLNTVHNNTV + 4 Deamidation (NQ)
55   976.42   1950.83   1950.87   -0.03 0  3  1.2e+002 1  QPWWEQNNIISALYW + 4 Deamidation (NQ)
13   501.75   1001.49   1001.55   -0.06 0  3  1.5e+002 1  AVASPTTTVR
25   402.20   1203.59   1203.57   0.02 1  3  1.5e+002 1  QVKDQNEQSK + Deamidation (NQ)
40   801.89   1601.77   1601.80   -0.03 1  3  1.4e+002 1  APRPPDAGMGHQRGR
46   889.91   1777.80   1777.01   0.78 0  3  1.3e+002 1  FYLVTVGSTLGILAPAR
65   738.69   2213.04   2212.96   0.08 1  3  1.2e+002 1  LASTNRGSANGGGSSTMESGTSGAG
97   1291.09   3870.26   3869.98   0.28 1  2  1.2e+002 1  LSDQSVLLNFLKFLYNDCLVNEILQWNIISEK + 2 Deamidation (NQ)
59   1003.91   2005.81   2005.93   -0.12 1  2  2.1e+002 1  CVVSECVEAIKDAGIDLQ + Deamidation (NQ)
62   1059.92   2117.83   2118.01   -0.18 1  2  2.4e+002 1  NEQKAVPQAAPLLESSEYSG + Deamidation (NQ)
37   774.43   1546.84   1546.75   0.08 1  2  2e+002 1  HLARFSNGNPFGTK + 2 Deamidation (NQ)
32   692.43   1382.84   1383.57   -0.73 1  1  2.4e+002 1  KGQWYCPECR + Deamidation (NQ)
50   938.95   1875.88   1875.93   -0.05 1  1  1.9e+002 1  NHQQALNSTPHVRFGIG + Deamidation (NQ)
67   744.01   2229.02   2229.17   -0.15 1  1  1.8e+002 1  RVIFVTCFLSGLFCLLQGV + Deamidation (NQ)
20   561.32   1120.62   1120.59   0.03 0  1  2.3e+002 1  GPAAPAEAAAPAK
29   641.32   1280.63   1280.55   0.08 0  1  2.3e+002 1  FNGGNDVGMANGK + Deamidation (NQ)
38   528.25   1581.72   1581.90   -0.18 0  0  2.3e+002 1  STTAASVPVILAEVPK
6   435.77   869.52   869.42   0.11 0  0  2.2e+002 1  VFFDTLE
51   947.90   1893.79   1893.00   0.78 1  0  2.6e+002 1  YELRNGPIIWLAYIAT + Deamidation (NQ)
88   1073.12   3216.33   3215.72   0.61 1  0  2.1e+002 1  ITDIQQLETSFSLSQSAVVRVLLDVIPNK + 3 Deamidation (NQ)
89   1088.81   3263.41   3263.51   -0.10 0  0  1.8e+002 1  IMDDYHTQTVPAAAAVASTSATVAEELNGNSK + 2 Deamidation (NQ)
87   1046.84   3137.49   3137.42   0.07 0  0  1.5e+002 1  MDEFVTAEDLVHEYSVLQEPDSVVNWS
1   432.70   431.70        
10   938.45   937.44        
11   960.94   959.94        
53   962.47   1922.92        
58   663.99   1988.94        
60   1032.45   2062.88        
64   728.38   2182.13        
70   747.39   2239.15        
74   1212.75   2423.49        
79   1374.72   2747.42        
81   931.16   2790.45        
82   1415.32   2828.62        
84   1008.13   3021.38        
91   1180.11   3537.31        
94   1265.16   3792.45        
95   1266.43   3796.26        
96   1288.11   3861.32        
98   1320.42   3958.24        
99   1332.75   3995.24        
100   1345.09   4032.24        
101   1373.16   4116.45        
102   1386.74   4157.19        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 102

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 23 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.6   -0.06    1  ABR025C R.GYVTYK.G
  9.7   -0.09               A.ADAAGVVK.R
  8.2   -0.05               K.QGAQVVQ.T
  7.8   -0.02               K.QQYYK.L
  7.5   -0.16               Y.GVVKVTK.D
  7.2   -0.13               L.VTGKPTK.D
  7.2   -0.10               F.WAKPTK.K
  6.9   -0.09               E.QKQTPK.Q
  6.3   -0.06               V.EKYYK.L
  6.3   -0.02               E.EQYYK.E
Top scoring peptide matches to query 3
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 29.6   -0.03    1  ABR025C S.TGFSISR.G
 23.9    0.01    9  ACR160C R.ASFGIGTN.F
 19.8   -0.02   19  AFR566C V.TGFISNK.D
 13.5   -0.00               K.TGFGCIL.N
 13.5   -0.01               R.TFRGTW.L
 12.7    0.00   12  ABR207W R.TFGRANT.E
  9.4    0.00               R.TGFTGER.W
  9.3   -0.02               L.ASFLSNK.K
  9.1   -0.02               C.FNLSMR.G
  7.5    0.01               R.AAYVQDT.L
Top scoring peptide matches to query 4
Score greater than 23 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.2   -0.08        R.SALQQSQA.D
  9.2   -0.09        S.RDLSANR.F
  7.9   -0.09        F.RDIWNK.N
  7.9   -0.10        S.RDLWSR.C
  7.8   -0.10        R.TGILSLDN.T
  7.0   -0.10        E.RNPSMVK.Y
  6.3   -0.04        K.RDAENVQ.L
  6.3   -0.04        K.RDAENVQ.L
  6.1   -0.11        S.SSSVSIPR.I
  6.0   -0.09        L.RDEGISR.D
Top scoring peptide matches to query 5
Score greater than 22 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.0   -0.09        E.ETTKIPR.F
  8.4   -0.06        V.TKDNLPR.F
  8.0   -0.09        Y.SAITSPLR.T
  7.5   -0.06        R.PSTSSLPR.T
  7.5   -0.07        K.SRQSLPR.V
  7.0   -0.06        M.SPSIDIGR.F
  7.0   -0.00        R.QSMEPPR.S
  6.9   -0.10        D.SAIRIQR.A
  6.6   -0.03        V.SQRAEPR.Y
  6.2   -0.03        R.SARQQRP.V
Top scoring peptide matches to query 6
Score greater than 13 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4    0.11        K.VFFDTLE.L
Top scoring peptide matches to query 7
Score greater than 24 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.4   -0.06        A.AENITTTK.Y
 11.0   -0.02        K.GAVSKEASE.E
 11.0   -0.02        R.INSSAVTGE.R
 10.7   -0.06        Q.NSLLTSNK.D
 10.7    0.01        S.QEGVDSSR.A
 10.7    0.04        R.WQVDGSGE.V
  8.9   -0.04        K.NAQMTIKA.S
  4.7   -0.02        N.QGEESSLK.A
  4.7   -0.07        L.FTPNGTLK.L
  4.7   -0.06        R.IFLAIAND.V
Top scoring peptide matches to query 8
Score greater than 17 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4   -0.18        K.KSPDILLQ.A
  5.4   -0.22        T.SPKDIILK.L
  5.4    0.78        G.TPLNLLIK.K
  4.9   -0.07        R.ADAAHAARM.Q
  4.2    0.78        QPLSLLLK
Top scoring peptide matches to query 9
Score greater than 26 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.2    0.01    1  ABR025C K.GAFTAGSADK.A
 11.6   -0.07               L.LSHPLTEK.T
 11.0   -0.00               D.AGHPSGPSSK.R
 10.4    0.02               I.FQGQDISK.L
 10.4   -0.02               Y.TVIYNGEK.I
 10.3   -0.03               S.KGNDLYSK.G
  9.5    0.01               N.EVHPEGEK.V
  9.3    0.03               K.EMMANIKS.G
  9.3   -0.02               R.VYISNLSQ.D
  9.0   -0.07               Y.KFGLGSSTK.D
Top scoring peptide matches to query 10
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 11
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 12
Score greater than 36 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 37.9    0.02    3  ABL063C K.LSGDLVISGK.Q
 21.1    0.02   14  AER027W K.LSATVLQGLS.R
 14.4    0.00               E.ISEVRGLSK.K
 13.8    0.04               K.AEAEAITRK.T
 11.6    0.09               R.LSGENTSLAP.Q
 10.3    0.00               F.LSVIGSSLGR.Q
  9.8    0.04               N.ISNVQTGIR.T
  9.8    0.04               N.ISNVQTGIR.T
  9.8    0.05               R.LSETNVPKT.Y
  9.6    0.05               K.LSDNSLLGLG.T
Top scoring peptide matches to query 13
Score greater than 14 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.1   -0.06        L.AVASPTTTVR.E
  1.4   -0.03        R.GEGLLGLVNM.G
  1.1   -0.11        D.SLRAVLSTR.L
  0.1    0.03        R.LGGDRPVEC.K
Top scoring peptide matches to query 14
Score greater than 16 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.0   -0.13        D.LSIAEELVR.Y
  2.8   -0.09        K.LQHHQPRL.N
  2.6   -0.09        D.LHNGAHGVPK.D
  2.2   -0.11        K.LFSTKSHLP.S
  1.9   -0.11        E.LFSMYLKK.L
  1.7   -0.13        R.LPPGIYKLQ.F
  1.2   -0.15        K.LDTVVKILE.C
  1.1   -0.09        K.IFSGLPPAVQ.E
  0.7   -0.04        R.RWAPIGSQN.Y
  0.7   -0.04        R.RWAPIGSQN.Y
Top scoring peptide matches to query 15
Score greater than 26 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.6    0.00        F.VNIRNSSSR.L
 12.2    0.04        K.DVLEELRC.R
 12.2    0.05        R.DVLELLNCG.N
 12.2   -0.02        K.DVLQIAQVF.D
  9.3    0.05        R.KQAEGEQSR.P
  9.1    0.07        P.LNVQGEDQK.D
  8.1   -0.05        R.DVITTLKFP.T
  8.1    0.04        K.TLLLSDQGEG.S
  8.1    0.07        K.VNLSNLAEGD.S
  3.5    0.05        R.DVLNFTTSH.R
Top scoring peptide matches to query 16
Score greater than 34 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 41.8    0.04    2  AGL352W Y.FACGSNEER.A
 19.1    0.03   11  ACL196W R.FALNDDAMAT.E
 13.6   -0.02               R.FAENNIGRF.A
 10.2    0.02               K.FACVECRQ.Q
  6.4   -0.03               R.KHINNGSNGQ.F
  6.3   -0.02               K.FATDWNKST.R
  5.8   -0.05               R.ELFTLSCVT.F
  5.7   -0.03               R.SYQGSQPRF.L
  5.7    0.04               K.FESEPNSSAT.Y
  5.3    0.07               R.NYQNDDQAT.I
Top scoring peptide matches to query 17
Score greater than 29 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.5   -0.08   10  ADL027W Y.DQRSLSSQR.T
 15.4   -0.07    7  ACL170W R.AGSSSTGIGSRP.T
 11.6   -0.07               L.DEMADVLRK.T
 11.6   -0.09               L.DESLSELKR.V
 11.6   -0.05               L.DTEINSLQR.M
 11.6   -0.05               L.NDTLNTLQR.D
 11.6   -0.06               T.NEDIGMIVGK.K
 11.6   -0.08               R.NRFLELHF.D
  7.1   -0.02               N.YYSDMNKR.G
  6.2   -0.13               R.QITASVTFLP.E
Top scoring peptide matches to query 18
Score greater than 30 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 45.0    0.04    1  ABR025C S.SVFEDNGALK.L
 14.5    0.01               S.VSNFLSDGIK.W
 14.4    0.14               K.KEDQDEDSL.S
 10.7    0.01               G.SAATNNFLIK.H
  9.0   -0.02               K.SVYQEVLLK.F
  8.9   -0.03               K.SFQKSELLK.I
  8.7    0.04               Q.NAFENIDKK.Q
  8.3   -0.01               N.SVFQINMIK.W
  6.9    0.02               K.LQFINQTIT.V
  6.9    0.17               K.TGDINDSNQD.A
Top scoring peptide matches to query 19
Score greater than 26 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.0   -0.06   15  ABL020W R.SVLSNRASFI.I
 12.3   -0.04               S.QTSSLSVSKR.I
 12.1    0.00    7  ACL170W R.QGSLVSGSTGSL.S
 11.4   -0.06               K.ADILYKTNR.F
 11.2    0.03               R.VSLSNRTNNS.N
 11.0    0.03               R.VSLSNRTNNS.N
 11.0    0.03               R.VSLSNRTNNS.N
  9.7   -0.05               R.EGIVPHTLNL.Q
  9.3   -0.02               W.NAISQAYVAR.I
  9.1   -0.05               K.SVINVPVEHV.P
Top scoring peptide matches to query 20
Score greater than 13 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8    0.03        E.GPAAPAEAAAPAK.V
Top scoring peptide matches to query 21
Score greater than 26 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.5   -0.00        Q.QFDLALKLGK.L
 12.9   -0.00        E.KTAVIPTQFK.I
 11.0    0.14        K.QTQKCLPEE.I
 10.9    0.01        F.FSNRALANLK.L
  8.9    0.05        Q.NLESLAEKTK.S
  7.4    0.08        K.QLFDALPLSQ.Y
  5.6    0.14        K.QTQKCLPEE.I
  3.8    0.08        K.IDFISALPEE.V
  2.5    0.07        K.QFNDPLIGTK.V
  2.4    0.06        R.LMLSLADAGSR.L
Top scoring peptide matches to query 22
Score greater than 30 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 55.2    0.04    2  AGL352W K.LFGYLCGSDK.K
 14.3    0.00               K.IKNEQDPTLT.F
  9.8    0.01               R.LPMHSYLGQL.A
  8.7    0.00               K.LEVLDLQDNT.L
  7.9    0.04               K.TMLMEVHGEI.M
  7.1    0.00               K.IKNEQDPTLT.F
  5.7    0.01               K.MGYKLFATAGT.A
  5.7   -0.08               R.ISRILDLTQT.V
  5.2    0.06               R.MDHPHHALTT.E
  4.8   -0.03               K.KINIIGSDGEL.Y
Top scoring peptide matches to query 23
Score greater than 18 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.1   -0.06        G.FLEGIIRNAK.G
  5.9    0.01        P.CTQGPGKVVSK.S
  5.0    0.04        G.RNCQIGANVK.I
  4.0    0.04        R.RNPNFVTGGAQ.I
  3.8    0.05        R.GCINDVQNIK.N
  3.7   -0.03        D.SMNQLQKLAK.I
  3.0   -0.01        Q.QPFLDDVKAK.A
  2.9    0.04        I.ESVGVEVEDAK.I
  2.6    0.03        A.NFEIDLPDAK.I
  2.2   -0.00        R.MSVGRQASTPK.T
Top scoring peptide matches to query 24
Score greater than 22 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 52.3    0.05    6  AER058W K.CFSSICPEGK.A
  6.6    0.01               A.HLQQVEADNK.E
  2.1    0.07               K.RSNAISCSSSN.S
  2.1   -0.12               R.VPPSRLAALFN.S
  2.1   -0.07               T.PLSPAEARDTK.V
  1.8   -0.04               L.HGNISLVSNNK.Y
  0.9   -0.06               G.CFGGFGLSLVK.E
  0.3    0.10               R.QYMNSPSNEN.S
  0.3   -0.14               L.RVEQLEIIGK.E
  0.3   -0.01               K.YFQWQLLQG.V
Top scoring peptide matches to query 25
Score greater than 15 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0    0.02        N.QVKDQNEQSK.L
  2.4   -0.06        K.KLNNQTILPY.I
  2.4   -0.06        K.KLNNQTILPY.I
  1.8   -0.08        Y.QLQSTVLLSSK.T
  0.8   -0.06        K.KLNNQTILPY.I
Top scoring peptide matches to query 26
Score greater than 22 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.7    0.10        R.FNQDASCFSAV.S
  8.6   -0.01        R.NFKNTIGHLNS.M
  5.6   -0.08        K.FDQLALAARLE.K
  5.2    0.01        R.DQVPRSDWML.I
  4.6   -0.00        D.EDQRLVNSQR.V
  3.2   -0.15        H.VYKLAANNILK.F
  2.4   -0.08        P.EGPRSVNFIVK.A
  1.6   -0.05        R.VAGNVLKTLSNE.Q
  1.0    0.07        K.QPFHETSRQD.L
  0.8   -0.05        K.DFKPLEADRR.V
Top scoring peptide matches to query 27
Score greater than 22 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.4   -0.01               A.NVDNSIANDIAK.F
 10.4   -0.01               A.NVDNSIANDIAK.F
  8.6   -0.08               A.SKLNTVAQQGVK.K
  8.6   -0.08               A.SKLNTVAQQGVK.K
  7.3   -0.01               P.DDVETGIVPAMK.L
  6.1   -0.05               K.IGMIIGIENDAK.T
  5.1   -0.10               L.LVNFGALGGEVAK.N
  4.8   -0.17   20  ABR170W D.AVKFLNGLITAK.L
  4.0    0.05               K.QAQSESNTGPGAQ.G
  4.0   -0.12               S.AMDTIVAVTILK.N
Top scoring peptide matches to query 28
Score greater than 31 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.9    0.05   18  ACL014C E.LSNQWNKADAK.I
 17.4   -0.08   20  ABR170W D.AVKFLNGLITAK.L
 11.6    0.04               R.EANLNSLVRVTG.V
 10.6   -0.05               V.ISTIQSLLTGIK.Q
  9.5    0.06               L.IESVGVEVEDAK.I
  8.7   -0.01               L.LVNFGALGGEVAK.N
  8.6    0.10               D.DHLGSYAPNTAK.K
  8.2    0.04               Y.DDVETLLRDAK.R
  8.1    0.04               K.IGMIIGIENDAK.T
  8.0    0.08               A.NVDNSIANDIAK.F
Top scoring peptide matches to query 29
Score greater than 13 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.7    0.08        T.FNGGNDVGMANGK.T
  0.7    0.08        T.FNGGNDVGMANGK.T
Top scoring peptide matches to query 30
Score greater than 25 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.3    0.06    2  AGL352W K.LSYLLNEYYK.A
 19.3    0.06   13  AGL351W K.LSYLLNKYYQ.E
 11.4   -0.04               R.YSLLLNTQKLL.Q
  4.3    0.08               R.QAFQKLELPTE.R
  1.0    0.12               R.NGAQGSSLLLTDE.V
  0.3    0.02               L.ISYLVPRSDQK.A
Top scoring peptide matches to query 31
Score greater than 24 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.8    0.03        I.DWFDEHFVLR.R
 10.7    0.03        G.WETSQEVEKAR.K
  9.3    0.09        H.ADDSSAEGRENGR.N
  4.4    0.04        R.NNELAEFENAVI.H
  4.4    0.07        F.DAQTGSDREVQR.I
  4.4    0.18        R.WNVYNAYSNDD.F
  3.6    0.03        D.EDGPAFDGLRMR.N
  3.4   -0.04        D.WVQDYLRNIR.Y
  3.1   -0.07        R.LEILSNQRYIL.L
  2.5   -0.07        R.QFLFRPKDVGR.N
Top scoring peptide matches to query 32
Score greater than 14 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5   -0.73        P.KGQWYCPECR.Q
  1.4    0.17        K.LQAGSQFQGGLYL.-
  1.4    0.17        K.LQAGSQFQGGLYL.-
  0.4    0.16        R.SLIDQMAQNLLH.L
  0.4    0.16        R.SLIDQMAQNLLH.L
  0.3    0.13        K.IPDIEGTVNMVPV.D
Top scoring peptide matches to query 33
Score greater than 27 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.2    0.07    2  AGL352W ATSSSGEVPEIVIK
 12.7    0.02               R.IKTELLVQWSSL.T
  8.4    0.11               R.QLVEEVARELCA.R
  5.6    0.03               E.LLNNKLLGDSTVK.A
  0.9   -0.01               A.SVVVENKLISSIK.T
  0.9    0.12               K.WVEPGEVVSTNVT.S
Top scoring peptide matches to query 34
Score greater than 31 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 78.5    0.06    3  ABL063C K.TANDIVISNTNLR.S
 54.2    0.06    3  ABL063C K.TANDIVISNTNLR.S
 42.0    0.06    3  ABL063C K.TANDIVISNTNLR.S
 14.1   -0.01   12  ABR207W R.LPFSAVLSIEKLN.D
 12.6    0.04               R.GNDLNTWLKTIR.G
 12.6    0.03               S.TKNQIDTLIDIR.K
  9.8    0.11               A.DATINVWRGDER.W
  9.4   -0.01               L.ELASSSLTKLGIGR.L
  8.8    0.11               Q.PTSVDDSIVDDLR.N
  8.5    0.10               K.VSLMVSSINPSQAP.Q
Top scoring peptide matches to query 35
Score greater than 16 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4    0.07        R.MLQNNELEPDTVE.E
  3.3    0.08        K.DQLQGSISQSGFTY.T
  3.1   -0.06        R.KLASSSSLNSSEPLL.L
  2.5    0.02        K.ENELAAQDKLVAET.E
  2.4   -0.06        K.DLETSARTTALELL.T
  1.9   -0.07        T.FPQLARAASTAAATR.L
  1.7   -0.05        R.HSYVRASTGESIII.V
  1.5    0.01        R.QDLERQLLTANET.I
  1.5    0.01        R.QDLERQLLTANET.I
  1.5   -0.02        S.GYQLTGNHSSINIK.G
Top scoring peptide matches to query 36
Score greater than 19 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.9    0.03        R.LIEIYPTLKQPVQ.C
  6.9    0.05        R.NAVLLVFANKQDLP.E
  6.9    0.05        R.NAVLLVFANKQDLP.E
  6.5    0.12        N.TELKYLNFSGNTR.F
  6.4    0.16        V.ANSPTNVSHLIQMK.L
  6.4    0.15        A.FRQTVHSLTHCR.F
  5.8   -0.77        V.YAWGNGQQYQLGR.K
  5.4   -0.79        H.GHFMANINNNAGPGK.G
  5.4   -0.79        H.GHFMANINNNAGPGK.G
  5.4   -0.79        H.GHFMANINNNAGPGK.G
Top scoring peptide matches to query 37
Score greater than 14 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5    0.08        K.HLARFSNGNPFGTK.I
Top scoring peptide matches to query 38
Score greater than 13 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5   -0.18        F.STTAASVPVILAEVPK.L
Top scoring peptide matches to query 39
Score greater than 16 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.2   -0.00        G.WRAAHDLDWDAAR.A
  2.6   -0.10        V.LNFELLPQPPKER.A
  2.2    0.07        R.RCDEGVPFCALCV.K
  2.2   -0.09        V.SSGTYIRSLVSDIGK.A
  2.0    0.11        R.LMSSNTENNLGSSPQ.K
  1.6    0.11        R.NAMDNASKNAGEMIN.K
  0.7   -0.16        F.STTAASVPVILAEVPK.L
Top scoring peptide matches to query 40
Score greater than 15 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9   -0.03        K.APRPPDAGMGHQRGR.Q
  2.8   -0.11        R.APRTNLLVAVSYGQL.I
  2.6   -0.03        K.LASSKGKPVAGDGASNSG.H
  2.2   -0.06        K.LPNDTNALLIDVFTG.R
  2.2   -0.03        D.RPAESNADKTASEVK.S
  1.7   -0.05        V.ALRTMHQIQNHPR.K
  1.6   -0.13        P.ARTGLLPHAQAPATAK.H
  1.4    0.08        K.SQRNLQLNCHWGS.C
  1.4    0.08        K.SQRNLQLNCHWGS.C
  1.4    0.04        K.LPNYYTQIMEGSSV.P
Top scoring peptide matches to query 41
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
147.8    0.05    1  ABR025C K.LGGSTADALSAVVTDDGK.L
 24.5    0.06    8  AFR071W L.RSAGNWSLGLQETEK.S
  9.6   -0.02               A.ENEVYGAKLWAGLVK.E
  9.1    0.02               R.FAQVIDESLAVLQQL.S
  8.9    0.03               K.KIEQYINIEKPNW.K
  7.8   -0.01               C.SSGSDISVGIVLAALCK.N
  7.2    0.07               T.TAENTRLNAQLSDDK.M
  7.2    0.07               T.TAENTRLNAQLSDDK.M
  7.2   -0.08               L.IFLQNGLSISTKDLK.V
  7.2    0.03               K.NDSDQLLSKLVSMVGA.H
Top scoring peptide matches to query 42
Score greater than 16 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4   -0.10        A.SKQTFGQLAESLDLR.V
  3.2   -0.01        K.KLATTPTPYAAGNDNAS.I
  3.2   -0.01        K.KLATTPTPYAAGNDNAS.I
  0.9   -0.10        V.LGERPGSEGAADIPPVK.K
  0.8    0.05        K.NTVVDGDLETINNGTQ.Q
  0.7    0.04        P.QSFNATICCVSFMK.R
  0.7   -0.05        R.SKFANTLTDDPLGSLN.D
  0.7   -0.00        A.SQSSCVDERISATPR.S
  0.5   -0.10        N.HRQLLQNLDPSIQK.R
  0.3   -0.08        A.LLTDKENETPTYLR.R
Top scoring peptide matches to query 43
Score greater than 21 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6   -0.04        K.HGAVEVDFAQEVQAAAP.K
  8.5    0.02        K.SGQNAVQYGKDAGNAAMG.Y
  7.9   -0.09        D.ASWVLEYIEQEFAR.K
  5.3   -0.03        R.QVDPQPTPPMTVSPSGT.M
  5.0   -0.06        LDVNFNSSASICNATK
  4.5   -0.14        Y.RPFGVNDIVQNLPNR.V
  3.0   -0.14        Y.RPFGVNDIVQNLPNR.V
  1.4   -0.21        K.NLQTVLPGLSQVTKLE.A
  0.9   -0.18        K.NITKVMQLSLTISYK.S
  0.7   -0.00        R.NEALQQVIDRDENGH.F
Top scoring peptide matches to query 44
Score greater than 26 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.7    0.07   17  ACR009W R.NIPPFLNSSDVAEEVL.R
 17.8    0.07   17  ACR009W R.NIPPFLNSSDVAEEVL.R
 11.9    0.02               G.TEELAVKISDEGGGIAR.S
 11.5   -0.03               K.TEELWPLIQPHLGVI.I
 10.4    0.06               K.INITSLLNSRGGTGEDP.Y
 10.2    0.07               R.MVELQAQVHFQLDSV.G
 10.2    0.07               R.MVELQAQVHFQLDSV.G
 10.2    0.07               R.MVELQAQVHFQLDSV.G
  9.1    0.12               R.EQEPTEISNENIEVI.P
  8.7    0.12               R.EQEPTEISNENIEVI.P
Top scoring peptide matches to query 45
Score greater than 15 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.1   -0.14        M.WSLIIPTPPFQEAHK.D
  1.9    0.69        K.IGITTNILKPNILQLL.G
  1.9   -0.29        K.IGITTNILKPNILQLL.G
  1.7    0.08        R.LGALNQNDSGNNSQNASG.Y
  1.7    0.08        R.LGALNQNDSGNNSQNASG.Y
  1.2   -0.06        R.EPKAQADAAHGAAVQAAGT.G
  1.1   -0.04        K.LSNYVYITDNAYTVE.E
  1.1   -0.03        R.TESVTSSTANNAPQSLR.D
  1.1   -0.18        L.VDITEHVRQLASQLR.A
  1.0   -0.04        K.VPNRSSPSEGHLMGEAP.L
Top scoring peptide matches to query 46
Score greater than 15 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.78        Q.FYLVTVGSTLGILAPAR.L
  2.3   -0.16        Y.TELRLPTIPEEVEPR.D
  1.3   -0.23        R.GLYSVETMSLLIVLKL.R
  1.3   -0.07        Q.YDGILSGYLPNSHSVR.T
  1.2   -0.11        R.ALLPDATEELHVLQQT.L
  1.2   -0.11        R.ALLPDATEELHVLQQT.L
  1.1   -0.07        K.LAAAERQATSSCSLADK.S
  1.1   -0.08        S.LNPKEVSAQFESTQAK.L
  0.9   -0.09        R.RPAQPTSTQTPPETPVA.S
  0.9   -0.09        R.RPAQPTSTQTPPETPVA.S
Top scoring peptide matches to query 47
Score greater than 14 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4    0.74        L.LGQQLAAGATALLSLASLR.F
  1.4   -0.13        E.SAQEPKPASAEADLLAQK.D
  1.1   -0.08        R.DNFLNYRSLAAADNIR.S
  0.5    0.76        K.IGTLQLALVCRHFGIR.F
Top scoring peptide matches to query 48
Score greater than 20 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.3    0.06        R.DGIQQAGYMTRNSHGTK.I
  6.6   -0.06        K.ELLEDPAAAQKAVNLPW.Q
  6.1   -0.05        D.QVSVLNRNLPPVPDCR.F
  4.9    0.01        K.VMSNYNLGPNGAIVTSLN.L
  3.4    0.11        K.WNNFKQGSPEQNDAAR.A
  3.2    0.11        K.WNNFKQGSPEQNDAAR.A
  3.2    0.11        K.WNNFKQGSPEQNDAAR.A
  3.1    0.09        R.RNSGNNTNSSNSTLAPSGS.S
  2.3    0.05        K.FAPVNNLSTLEAACSPSS.P
  2.0   -0.01        V.SNGRNQEDQLLLHQGR.G
Top scoring peptide matches to query 49
Score greater than 23 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.4    0.01   16  AEL092W S.NTTNTTNGNNNKSGTIGR.L
 17.4    0.01   16  AEL092W S.NTTNTTNGNNNKSGTIGR.L
  9.3    0.01   16  AEL092W S.NTTNTTNGNNNKSGTIGR.L
  8.9   -0.02               M.SGGVDSSVCAALYAHFPK.V
  8.1    0.01   16  AEL092W S.NTTNTTNGNNNKSGTIGR.L
  8.1    0.01   16  AEL092W S.NTTNTTNGNNNKSGTIGR.L
  7.3    0.01   16  AEL092W S.NTTNTTNGNNNKSGTIGR.L
  7.3    0.01   16  AEL092W S.NTTNTTNGNNNKSGTIGR.L
  7.2   -0.06               K.LNYNLTDIMVANDGAIK.N
  7.0    0.07               R.SISSEQGETCQGMPNLAG.L
Top scoring peptide matches to query 50
Score greater than 14 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2   -0.05        K.NHQQALNSTPHVRFGIG.R
Top scoring peptide matches to query 51
Score greater than 13 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4    0.78        R.YELRNGPIIWLAYIAT.F
Top scoring peptide matches to query 52
Score greater than 26 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 71.1    0.01    4  AFR711C K.VTAPDCEALQSGMIVVSK.D
  9.4   -0.15               G.NRPVLTLPHLMLSVVSK.C
  3.2   -0.13               L.TVAITDPVAEIRHEILK.H
  3.0    0.09               V.AEAGASIQAEDVNNDPFR.V
  2.1   -0.08               D.SSPLLICWFANVLGISK.Y
  1.5   -0.04               I.SAIHGITFRNFSLPESK.T
  1.3    0.04               H.ISFSENVSFIDSKESSK.D
  1.1    0.02               K.LSALNSQLEELITQNQT.L
  0.9    0.08               K.LSANSPGVTADAGAIEDGSAT.K
  0.3   -0.05               H.LSAEAVGQLQELIQDYK.D
Top scoring peptide matches to query 53
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 54
Score greater than 18 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.8   -0.06        Q.MTVAHLQLAMADAVVLNK.I
  4.4    0.02        -.MAPSEHQIYQHIQLTK.W
  3.1    0.02        D.SSVRQTMELMLPFSGNK.L
  2.9   -0.07        W.RNPIGEIISVLNPYPDK.L
  1.0   -0.06        Q.LVDQYIVVTLKFNNTR.Y
  0.6   -0.08        L.LYLLNYILFVHYEPK.G
  0.5   -0.78        R.EETELVEAMINNGDMDD.W
  0.5    0.20        R.EETELVEAMINNGDMDD.W
Top scoring peptide matches to query 55
Score greater than 16 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.4   -0.03        K.QPWWEQNNIISALYW.Y
  2.9   -0.06        I.EQLNSQLGTGSNSTDMIR.A
  2.9   -0.06        I.EQLNSQLGTGSNSTDMIR.A
  2.8   -0.08        K.NTAVVDQIEASCRAYRP.V
  2.3   -0.08        K.LSASARQEEEQLQLAYD.F
  2.3   -0.08        K.LSASARQEEEQLQLAYD.F
  1.9   -0.01        K.DPQTDMPEGVSLVGQVYD.G
  1.9    0.02        E.EFECNSVLQEHSQDVK.H
  1.9   -0.19        K.LIGLFLVSEIWNFYTH.L
  1.9    0.70        A.VQAVVLAVTVHLAAEVFGK.D
Top scoring peptide matches to query 56
Score greater than 20 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.9    0.01        K.TVMVSTEQLAILNANKNL.M
  7.1    0.13        R.IHDGENFVEQMTEVGKQ.Y
  5.9    0.03        I.YDQLVGKLMNNEPLPTK.V
  3.2    0.05        R.AGETVALTAAAGGTDEAKVET.G
  1.3    0.10        K.ELNDENDQLNSKVEVLT.S
  1.3    0.10        K.ELNDENDQLNSKVEVLT.S
  0.9    0.04        R.QQDTELVDLLNAIRFGE.V
Top scoring peptide matches to query 57
Score greater than 27 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 44.9   -0.01    1  ABR025C R.SASMYHMSSVFEDNGALK.L
 12.1    0.02               P.EDRSNNASHSENEDAVAK.Y
 11.2   -0.02               E.MIGGTNEDDFSDAVNFIK.E
  7.9    0.02               P.EDRSNNASHSENEDAVAK.Y
  7.3   -0.02               V.DLEDAVQNPDQEDNIKK.L
  7.3   -0.02               V.DLEDAVQNPDQEDNIKK.L
  7.3   -0.02               V.DLEDAVQNPDQEDNIKK.L
  5.2   -0.26               D.IKISPTVDLLYGIDNALK.S
  4.1   -0.12               W.CVRVTSSTTYSMVGALNK.L
  2.9   -0.17               L.LQVQSSTTAYNGGLVHAVK.Q
Top scoring peptide matches to query 58
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 59
Score greater than 14 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.12        R.CVVSECVEAIKDAGIDLQ.R
  1.3   -0.08        I.NQRTEEVNAQNEAQMLK.K
  1.3   -0.08        I.NQRTEEVNAQNEAQMLK.K
  1.2   -0.19        K.SYLAKAVATEANSTFFSIS.S
  1.0   -0.16        K.FRCSVCYVTVVLQGTAF.T
  0.7    0.71        K.DRVGAGFMTVVLLIPFITG.S
  0.7    0.80        R.EMDRPIDDTVKSLLQFV.V
  0.7    0.76        R.GHPANRSLVTANIQAALVTA.N
  0.7    0.76        R.GHPANRSLVTANIQAALVTA.N
  0.7   -0.23        R.GHPANRSLVTANIQAALVTA.N
Top scoring peptide matches to query 60
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 61
Score greater than 13 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.8    0.02        L.MQLLESDGENNSATVPSDR.K
  0.2   -0.07        R.NPTEPHLVDLDKQCGVEL.P
  0.1   -0.13        R.IQGQPYSVTSDVWSLGLTL.L
  0.1   -0.13        R.IQGQPYSVTSDVWSLGLTL.L
Top scoring peptide matches to query 62
Score greater than 13 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5   -0.18        K.NEQKAVPQAAPLLESSEYSG.G
  0.9    0.73        V.EIAANVVLPDNGNAWHKLR.S
  0.5    0.77        K.KLVTLAIGDGANDIAMIQSAD.I
  0.5   -0.26        V.EIAANVVLPDNGNAWHKLR.S
Top scoring peptide matches to query 63
Score greater than 20 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6    0.00        R.NHLPQHYANMSQEAMPAEL.N
  7.3    0.00        K.YYHSGALQADNEQNSTAALE.L
  7.3    0.00        K.YYHSGALQADNEQNSTAALE.L
  6.5   -0.23        K.AQLLLYTPSREHFGIVPLE.A
  4.5   -0.13        N.LLNMLDNESYPYRGAIANK.K
  3.8   -0.13        N.LLNMLDNESYPYRGAIANK.K
  3.5    0.73        R.VAAAFDIVAALPVSERGLALAAG.G
  3.5   -0.13        R.ELKNQAISFNDYVLQSAQL.R
  3.3   -0.23        F.KLPGFRPNQLEAVNATLQGK.D
  3.1   -0.28        K.AIFVDNNLLEKLVKPVQEI.P
Top scoring peptide matches to query 64
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 65
Score greater than 14 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8    0.08        R.LASTNRGSANGGGSSTMESGTSGAG.S
  1.1   -0.03        M.AIGYSMYIERPVPDTTSAKN.K
  0.3   -0.07        D.LASFQKYWHTWFVGLSSR.F
Top scoring peptide matches to query 66
Score greater than 26 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 36.9   -0.09    1  ABR025C S.SSPYELTLEQPGATSISVALR.A
 11.3   -0.14               L.HLLREELQLNVLQIQNVR.R
  9.1   -0.03               G.ITNESIMPPTEDLLFLNNR.A
  6.5   -0.06               Y.DRSVALQHYSSQQPFVISR.A
  3.9   -0.05               V.IALDPHENERILDMAAAPGGK.T
  3.7   -0.05               R.ELALQIFGVARELMEFHSQ.T
  2.6   -0.09               D.LEELKQNTDGAEFIGNLSLK.I
  2.4   -0.14               L.HLLREELQLNVLQIQNVR.R
  2.1   -0.16               G.FLVGGASLKPEFVDIINSRR.-
  1.7   -0.11               S.QIIASVFMLSYYEKVVATR.I
Top scoring peptide matches to query 67
Score greater than 13 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.0   -0.15        K.RVIFVTCFLSGLFCLLQGV.G
  0.7   -0.02        M.TTTVEAGAIQDPVAGNVADENR.Q
Top scoring peptide matches to query 68
Score greater than 21 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3   -0.12        P.DVSIQELLQTFTPPKPHAGR.V
  8.0    0.02        K.EGDINESTRMFAYAFLISNG.R
  7.7    0.01        R.NADINSSWYSLLKPYDFTV.R
  4.7   -0.08        V.AVSEAACGGLLSSFLVSVPGASR.W
  4.0   -0.11        K.IGMLNDNIITSLTNLLNYNV.D
  4.0   -0.09        L.RQENGTPIPVIHSAAVGSSASR.L
  3.9   -0.10        N.PASLCRNSIWNHLLIHFR.E
  3.7   -0.12        F.NSVLCVLGGALSVAAFSVKDAR.L
  3.2   -0.15        H.SVDLHPSLDLIVSAGRDSVVR.V
  2.7   -0.02        V.LGMLPLQVSGFYFYVNGGDR.K
Top scoring peptide matches to query 69
Score greater than 19 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.3    0.08        R.VALDEELAALDAHIASVQDAIA.H
  5.8    0.08        S.ADDILPPLEANASILSSVHSGK.E
  5.4    0.19        K.EGDINESTRMFAYAFLISNG.R
  3.1   -0.79        K.EGDINESTRMFAYAFLISNG.R
  1.7    0.06        K.IGMLNDNIITSLTNLLNYNV.D
  1.3   -0.68        R.WLDYNDCWLAAEWGHPSD.N
  1.1    0.05        R.AVAHTVADSLQPGLPHKPLPAD.L
  0.6    0.03        R.KQLIEVITNIHSTMPLLDPA.C
  0.6    0.10        K.TDWLPATIITESVQQHLPNA.A
  0.3    0.18        R.NADINSSWYSLLKPYDFTV.R
Top scoring peptide matches to query 70
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 71
Score greater than 17 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.9   -0.26        L.DVVFTSIQDQFLQEVPEQR.L
  4.3    0.63        A.PDEILQLHDVFSAAELGRLR.A
  3.7   -0.26        L.DVVFTSIQDQFLQEVPEQR.L
  1.8   -0.39        K.AGGLFSPLLERLAEQEAGGAPVV.S
  1.7   -0.24        K.PTNQIQYSTFLSSIDNFFR.E
  1.6   -0.33        R.ALKFSPLGGLLAVANDSGSFGCV.T
  1.6   -0.39        F.VDVILGNVTNPLHEYINNKK.Q
  1.4    0.52        R.KIAILTSLLVYAVGMFVQLGSG.H
  1.4   -0.44        F.VITLAPSQRPTGINSPSSATRK.I
  0.7    0.54        K.GTDTAAFYGLHILLVHILGRI.E
Top scoring peptide matches to query 72
Score greater than 19 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.5   -0.13        L.YYHMSTVQQNTLAAFVNLGK.S
 12.5   -0.13        L.YYHMSTVQQNTLAAFVNLGK.S
  5.6   -0.11        F.HNVSRPQEEFHTYTIDWK.M
  5.6   -0.11        F.HNVSRPQEEFHTYTIDWK.M
  5.4   -0.06        R.QQYGKVETFGNGDEAVQTSID.G
  5.1   -0.06        R.QQYGKVETFGNGDEAVQTSID.G
  4.8   -0.05        K.LFEQINNDYNNNVISATSVQ.R
  4.0   -0.13        L.YYHMSTVQQNTLAAFVNLGK.S
  2.7   -0.01        D.EMNAYHSDESVQQFMRWK.I
  2.1    0.09        S.SDSQGGSQQDSDGTGQQNFSPR.D
Top scoring peptide matches to query 73
Score greater than 19 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 60.9   -0.12    5  ADR019C K.LLAGNFPTEADYEAIDFETVK.N
  2.3   -0.30               K.DEALLIPELYGGTLQLSLLRK.S
  0.2   -0.15               F.LLVEGSRIDHAAHQNDPAAQAK.E
  0.2   -0.15               F.LLVEGSRIDHAAHQNDPAAQAK.E
  0.1   -0.06               R.LQSGQTPIVKANLYDDYGMDN.F
Top scoring peptide matches to query 74
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 75
Score greater than 19 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.6   -0.13        I.QHSIYDQLVGKLMNNEPLPTK.V
  9.1   -0.13        I.QHSIYDQLVGKLMNNEPLPTK.V
  9.1   -0.13        I.QHSIYDQLVGKLMNNEPLPTK.V
  5.3   -0.09        K.GNVSYYEAEATSINPQRNTVTI.K
  4.7    0.63        L.VIPFILFAVLGTLFAILFLYR.Y
  4.0   -0.19        D.LFACLFAYCSVINALQPLVVK.F
  3.3   -0.13        I.QHSIYDQLVGKLMNNEPLPTK.V
  3.3   -0.13        I.QHSIYDQLVGKLMNNEPLPTK.V
  3.1   -0.21        G.LPQFDAEQLVELIGKLVELDR.Q
  2.5   -0.15        K.NAGAADSRVAAEASIQIEVLEALQ.A
Top scoring peptide matches to query 76
Score greater than 15 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6   -0.26        K.QENISLRGYVENILASENNMGS.R
  2.4    0.72        K.QENISLRGYVENILASENNMGS.R
  2.4    0.72        K.QENISLRGYVENILASENNMGS.R
  1.1    0.49        K.DLDLNATIKLPNLECLVQFLI.D
  1.1   -0.49        K.DLDLNATIKLPNLECLVQFLI.D
  1.0    0.59        R.ARPADVEAVAAVSALGKVMNQDGTA.L
  0.6    0.54        R.GTIADGAPIVPISAQLKYNIDAVN.E
Top scoring peptide matches to query 77
Score greater than 19 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.5   -0.18    1  ABR025C K.GNSGFYPVGSSSPYELTLEQPGAT.S
  3.8    0.67               P.PPVGLEPPASQTPNQEQVIKTPK.T
  3.8    0.67               P.PPVGLEPPASQTPNQEQVIKTPK.T
  3.8    0.67               P.PPVGLEPPASQTPNQEQVIKTPK.T
  2.3    0.68               A.IDPFELVNQPVELKVDSIGQSK.Y
  1.8    0.66               K.NTEKQPVQPVPQSSTLVHGLPLS.S
  1.8    0.66               K.NTEKQPVQPVPQSSTLVHGLPLS.S
  1.7    0.71               K.QFPIPNFLAMINIDAALDKNPD.R
  1.6    0.75               P.PRPVPVTPSEPTPCPEDQQPTK.V
  1.3    0.66               K.NTEKQPVQPVPQSSTLVHGLPLS.S
Top scoring peptide matches to query 78
Score greater than 21 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6    0.71        S.LNDLLAQHSVSSLSEPPATLYTPR.D
  8.6    0.71        S.LNDLLAQHSVSSLSEPPATLYTPR.D
  8.1   -0.15        Q.DCIELDESMLSIRTDSPAGYNPK.F
  8.1   -0.27        S.LNDLLAQHSVSSLSEPPATLYTPR.D
  5.8   -0.15        K.LYQQGGAAPGGAAPGGFPGAGAAAPGADGPT.V
  5.8   -0.17        R.ALYIDFWMLGDAARELPDNSWQ.K
  5.8   -0.31        S.KPFSLVVFSSGFTANGINWVDGIR.M
  5.7   -0.15        K.KPGAAEGDLPTLFSGLFSQTAQDSDG.L
  5.4    0.72        R.YDLGSLSPKNLFNLEDVEPLAFK.L
  5.4   -0.06        K.AGQSLSSSSDEFYEAHEHAAGTSTAA.G
Top scoring peptide matches to query 79
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 80
Score greater than 18 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.9    0.56        A.PRPPRTSSQVSLASSSSIQSSLVEQK.S
  5.9    0.56        A.PRPPRTSSQVSLASSSSIQSSLVEQK.S
  5.9   -0.42        A.PRPPRTSSQVSLASSSSIQSSLVEQK.S
  5.5   -0.47        R.DFLKYEFYQNLNIIGGLLLVLNTG.A
  5.2   -0.42        A.PRPPRTSSQVSLASSSSIQSSLVEQK.S
  4.9   -0.40        Q.FSTPALRPTIYDENEVLMSSFLVK.R
  4.5    0.51        R.DFLKYEFYQNLNIIGGLLLVLNTG.A
  4.5    0.51        K.QVVIACVGSRLLISLAFPSLQQQLD.N
  4.4    0.73        K.DEEQPEIETVPLTEEEQIEKELQ.E
  4.3    0.74        R.ASYYGTGDRLYNFFQYPLPQGGNGA.G
Top scoring peptide matches to query 81
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 82
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 83
Score greater than 14 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.5    0.77        R.SSCNTDTRLSPFTSSMTLNTVHNNTV.R
  3.5   -0.36        A.RQNAASGDYGQLHTLEDEGALLALSTR.T
  3.4    0.62        A.RQNAASGDYGQLHTLEDEGALLALSTR.T
  3.4    0.62        A.RQNAASGDYGQLHTLEDEGALLALSTR.T
  1.7    0.59        A.CNHILVSDEDFKQLTSPSISVVIQR.A
  1.5   -0.11        M.GNSTQNKQIDSSASTDAGCQDCANDDK.S
  1.5   -0.11        M.GNSTQNKQIDSSASTDAGCQDCANDDK.S
  1.5   -0.11        M.GNSTQNKQIDSSASTDAGCQDCANDDK.S
  1.5   -0.11        M.GNSTQNKQIDSSASTDAGCQDCANDDK.S
  1.5   -0.11        M.GNSTQNKQIDSSASTDAGCQDCANDDK.S
Top scoring peptide matches to query 84
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 85
Score greater than 17 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.7    0.04        R.QKFEDSLSPQIIVDFHSHNNPENQVK.D
 11.7    0.04        R.QKFEDSLSPQIIVDFHSHNNPENQVK.D
 11.7    0.04        R.QKFEDSLSPQIIVDFHSHNNPENQVK.D
  7.7    0.04        R.QKFEDSLSPQIIVDFHSHNNPENQVK.D
  3.5    0.12        S.LAINDDEEEKPSWASSVDESIWSNLSK.T
  1.9   -0.78        D.EDEAESAQGDEAGXAGGSEVDTVRQSMSDK.L
  1.7    0.04        R.QKFEDSLSPQIIVDFHSHNNPENQVK.D
  1.3    0.10        R.IIETNSYPILCDDWGADEEQALIKGAQ.T
Top scoring peptide matches to query 86
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.2    0.12        R.QAINLYKNSKPVDSEEMQETDDEAPQI.D
  3.6    0.12        R.QAINLYKNSKPVDSEEMQETDDEAPQI.D
  3.6    0.12        R.QAINLYKNSKPVDSEEMQETDDEAPQI.D
  2.4   -0.08        A.EKAIFIFVNDTLPPTAALMFAVYQEHK.D
  2.1    0.12        R.QAINLYKNSKPVDSEEMQETDDEAPQI.D
  1.6    0.12        R.QAINLYKNSKPVDSEEMQETDDEAPQI.D
  1.6    0.12        R.QAINLYKNSKPVDSEEMQETDDEAPQI.D
Top scoring peptide matches to query 87
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2    0.07        -.MDEFVTAEDLVHEYSVLQEPDSVVNWS.R
Top scoring peptide matches to query 88
Score greater than 13 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2    0.61        N.ITDIQQLETSFSLSQSAVVRVLLDVIPNK.Q
Top scoring peptide matches to query 89
Score greater than 13 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2   -0.10        T.IMDDYHTQTVPAAAAVASTSATVAEELNGNSK.S
Top scoring peptide matches to query 90
Score greater than 17 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3   -0.37        R.LEDENAQPLVQGLFPKEGNADTVFAINYFTAI.G
  6.0   -0.17        L.NQIMQNAMAMAFQEQVHDQLDPSVMEEFNK.E
  4.1   -0.36        K.YHGEWNQLTGNQIGILFAQAEMQSYFKEPK.L
  4.1   -0.36        K.YHGEWNQLTGNQIGILFAQAEMQSYFKEPK.L
  4.1   -0.36        K.YHGEWNQLTGNQIGILFAQAEMQSYFKEPK.L
  4.1   -0.36        K.YHGEWNQLTGNQIGILFAQAEMQSYFKEPK.L
  2.6   -0.37        R.LEDENAQPLVQGLFPKEGNADTVFAINYFTAI.G
  1.9    0.50        R.WELGTEVAQQQVGVVVTRDSNIISVSLDGTLNV.F
  1.3   -0.45        A.QEFHNLDDCIIKNVPNLLIIAMTCVSNLIK.Q
  1.3   -0.45        A.QEFHNLDDCIIKNVPNLLIIAMTCVSNLIK.Q
Top scoring peptide matches to query 91
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 92
Score greater than 17 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.7   -0.55        K.SDHEYIQFPLVQGMGFVTAIYYNLVPKLYSPV.G
  3.7    0.71        K.SVDGSNSDSSTNIANQLANPSTEGRDQHAPESQVSS.E
  3.7    0.71        K.SVDGSNSDSSTNIANQLANPSTEGRDQHAPESQVSS.E
  3.3    0.48        K.RPLSSVTLNLSDERQLSMQLQDLIANNSDLGTR.L
  3.3    0.48        K.RPLSSVTLNLSDERQLSMQLQDLIANNSDLGTR.L
  3.3    0.48        K.RPLSSVTLNLSDERQLSMQLQDLIANNSDLGTR.L
  3.3    0.48        K.RPLSSVTLNLSDERQLSMQLQDLIANNSDLGTR.L
  1.5   -0.55        K.SDHEYIQFPLVQGMGFVTAIYYNLVPKLYSPV.G
  1.4   -0.52        K.GEDSFQLTSLLRSSMFTEENRPTISLTELPYK.E
  0.7    0.55        W.SGIDGSMVLTHMPPGNTYTASSHFGDVLRSANQNK.S
Top scoring peptide matches to query 93
Score greater than 18 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3    0.57        P.DGEAPVTNFVSDKSPSHYAHLYASNDVQGSHVIR.L
  6.3    0.57        P.DGEAPVTNFVSDKSPSHYAHLYASNDVQGSHVIR.L
  6.3    0.49        K.KPITEAYLLPDELVQPADQKGTGSAKPPNTSTSQD.T
  6.3    0.49        K.KPITEAYLLPDELVQPADQKGTGSAKPPNTSTSQD.T
  6.3   -0.49        K.KPITEAYLLPDELVQPADQKGTGSAKPPNTSTSQD.T
  5.7    0.69        -.MATYQQPFNEFSTVTGGGFDSQASAGRPGSTGGQSTA.T
  5.7    0.69        -.MATYQQPFNEFSTVTGGGFDSQASAGRPGSTGGQSTA.T
  5.7    0.69        -.MATYQQPFNEFSTVTGGGFDSQASAGRPGSTGGQSTA.T
  5.5   -0.52        K.LVLLFYNSGVGARQEQQYYAALEPLNLPTGDMQ.G
  5.5   -0.52        K.LVLLFYNSGVGARQEQQYYAALEPLNLPTGDMQ.G
Top scoring peptide matches to query 94
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 95
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 96
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 97
Score greater than 14 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.1    0.28        R.LSDQSVLLNFLKFLYNDCLVNEILQWNIISEK.N
  2.1    0.28        R.LSDQSVLLNFLKFLYNDCLVNEILQWNIISEK.N
  2.1    0.28        R.LSDQSVLLNFLKFLYNDCLVNEILQWNIISEK.N
  2.1    0.28        R.LSDQSVLLNFLKFLYNDCLVNEILQWNIISEK.N
  1.6    0.43        K.NHVPNDMLAFQVAGRSYPVYLGAEDAAEHAGLSLQE.V
  1.1    0.34        L.LGQLCPETPHNPLHWNHQLELPLSNPRTALEQK.V
  1.0    0.56        R.GGETIMNVEMSENSRYSVESTFTGEQELPIWDPH.V
  1.0    0.56        R.GGETIMNVEMSENSRYSVESTFTGEQELPIWDPH.V
Top scoring peptide matches to query 98
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 99
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 100
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 101
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 102
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide