Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0422_q1.pkl
Database        : Ashbya Ashbya (4796 sequences; 2346673 residues)
Timestamp       : 27 Jul 2007 at 14:09:07 GMT
Significant hits: ABR025C       440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
                  ABL063C       282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
                  mADR019C-HMM  weak hom. to ScTip1,Syntenic homolog of YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 33 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    ABR025C                           Mass: 20232    Score: 292    Queries matched: 8
 440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   365.66   729.31   729.37   -0.06 0  5  83 2  R.GYVTYK.G
15   531.76   1061.50   1061.48   0.02 0  34  0.066 1  D.DFEPAEGAAR.S
16   540.29   1078.56   1078.53   0.03 0  16  4.4 1  S.SVFEDNGALK.L
48   987.48   1972.94   1972.87   0.08 0  40  0.0095 1  R.SASMYHMSSVFEDNGALK.L
59   1110.04   2218.06   2218.15   -0.09 0  58  0.00012 1  S.SSPYELTLEQPGATSISVALR.A
66   1229.47   2456.93   2457.13   -0.20 0  39  0.016 1  K.GNSGFYPVGSSSPYELTLEQPGAT.S
70   1372.97   2743.92   2744.28   -0.36 0  32  0.07 1  K.GNSGFYPVGSSSPYELTLEQPGATSIS.V
82   1062.16   3183.45   3183.57   -0.13 0  69  6.3e-006 1  K.GNSGFYPVGSSSPYELTLEQPGATSISVALR.A

 
      Proteins matching the same set of peptides:
      mABR025C                          Mass: 18217    Score: 292    Queries matched: 8
 hom. to Cwp1p,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1);

2.    ABL063C                           Mass: 42278    Score: 123    Queries matched: 4
 282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   494.79   987.57   987.56   0.01 0  32  0.13 1  K.LSGDLVISGK.Q
32   691.93   1381.85   1381.79   0.06 0  47  0.0033 1  F.QALPVVNNIVTSK.L
 34   738.40   1474.79   1474.82   -0.03 0  5  45 10  P.GASLMGAFAAVAIALL.-
39   801.42   1600.82   1600.78   0.04 0  47  0.0024 1  K.VGGDVTFANNEHLTK.I

 
      Proteins matching the same set of peptides:
      mABL063C                          Mass: 40388    Score: 123    Queries matched: 4
 Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) and YDR055W (PST1); 1-intron
3.    mADR019C-HMM                      Mass: 19120    Score: 41     Queries matched: 2
 weak hom. to ScTip1,Syntenic homolog of YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 41   815.88   1629.75   1629.74   0.01 0  2  74 7  P.TEADYEAIDFETVK.N
62   1171.99   2341.97   2342.13   -0.16 0  39  0.012 1  K.LLAGNFPTEADYEAIDFETVK.N

 
      Proteins matching the same set of peptides:
      mADR019C-NN                       Mass: 19048    Score: 41     Queries matched: 2
 weak hom. to ScTip1,Syntenic homolog of YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog
      ADR019C                           Mass: 20820    Score: 40     Queries matched: 2
 739205:739837,reverse,Syntenic homolog of Saccharomyces cerevisiae YER011W (TIR1) and YIL011W (TIR3
4.    AGL352W                           Mass: 57291    Score: 27     Queries matched: 2
 47585:49186,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
25   653.36   1304.71   1304.67   0.05 0  20  1.6 1  K.LSYLLNEYYK.A
33   708.92   1415.83   1415.75   0.08 0  7  31 1  A.ATSSSGEVPEIVIK.G

 
      Proteins matching the same set of peptides:
      mAGL352W-NN                       Mass: 55520    Score: 27     Queries matched: 2
 Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1);
5.    AER027W                           Mass: 83425    Score: 22     Queries matched: 1
 685709:687967,forward,Syntenic homolog of Saccharomyces cerevisiae YBR142W (MAK5)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   494.79   987.57   987.56   0.01 0  24  0.7 2  K.LSATVLQGLS.R

6.    ACR050C                           Mass: 53304    Score: 18     Queries matched: 1
 447221:448648,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL145W (RPT1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
34   738.40   1474.79   1474.72   0.06 1  20  1.4 1  R.WELISRLCPNSTG.A

7.    ABL024W                           Mass: 81266    Score: 17     Queries matched: 1
 353685:355889,forward,Syntenic homolog of Saccharomyces cerevisiae YMR102C and YKL121W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   872.91   871.90   871.47   0.44 0  19  5.4 1  R.ELGGVGLLD.W

8.    ABR124C                           Mass: 66844    Score: 17     Queries matched: 2
 621679:623466,reverse,Non-syntenic homolog of Saccharomyces cerevisiae YBR021W (FUR4) and YIR028W (
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   384.18   766.35   766.36   -0.01 0  15  4.9 4  R.TSVGWAF.V
 75   1445.02   2888.02   2887.35   0.66 1  3  52 7  R.GSIICAILAWCICPWNLMSSSSRFTE.T

9.    ADL339W                           Mass: 48843    Score: 16     Queries matched: 1
 110772:112085,forward,Syntenic homolog of Saccharomyces cerevisiae YPR068C (HOS1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   384.18   766.35   766.35   0.00 0  16  3.6 1  R.TGYQIAD.E

10.   AER025C                           Mass: 331315   Score: 16     Queries matched: 2
 675431:684166,reverse,Syntenic homolog of Saccharomyces cerevisiae YOL081W (IRA2) and YBR140C (IRA1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 34   738.40   1474.79   1474.83   -0.04 0  18  2 2  V.SLDLIELLGDIFK.I
 60   1118.02   2234.02   2234.16   -0.14 0  2  57 7  K.IGMLNDNIITSLTNLLNYNV.D

11.   AER241W                           Mass: 101246   Score: 16     Queries matched: 1
 1082034:1084592,forward,Syntenic homolog of Saccharomyces cerevisiae YDR356W (NUF1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   839.45   1676.88   1676.87   0.00 1  16  2.9 1  C.NSLLKFLNNVTDDGK.L

12.   AEL271C                           Mass: 39698    Score: 16     Queries matched: 1
 131544:132635,reverse,Syntenic homolog of Saccharomyces cerevisiae YPR180W (AOS1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 24   637.85   1273.68   1273.70   -0.02 0  16  4.1 2  L.LVNFGALGGEVAK.N

13.   ACR045W                           Mass: 61092    Score: 16     Queries matched: 1
 439721:441412,forward,Syntenic homolog of Saccharomyces cerevisiae YJL008C (CCT8)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
49   992.45   1982.88   1983.04   -0.16 1  17  2.1 1  T.QNNLSDIERAIDGGVAAIK.G

14.   ACR064W                           Mass: 78774    Score: 15     Queries matched: 1
 472524:474653,forward,Syntenic homolog of Saccharomyces cerevisiae YKL155C (RSM22)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   384.18   766.35   766.44   -0.09 0  15  4.6 2  V.THQLLR.Q

15.   ABR053C                           Mass: 58720    Score: 15     Queries matched: 1
 492259:493806,reverse,Syntenic homolog of Saccharomyces cerevisiae YMR015C (ERG5)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   384.18   766.35   766.34   0.01 0  15  4.9 4  R.TADMAMK.I

16.   ADL321W                           Mass: 78877    Score: 15     Queries matched: 1
 130698:132791,forward,Syntenic homolog of Saccharomyces cerevisiae YBR102C (EXO84)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   384.18   766.35   766.39   -0.04 0  15  4.9 4  N.TSVMTTK.S

17.   AGL170W                           Mass: 41820    Score: 15     Queries matched: 1
 379968:381104,forward,Syntenic homolog of Saccharomyces cerevisiae YDR161W (TCI1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
69   1302.88   2603.75   2603.34   0.41 1  15  3.9 1  K.IGGCGKFFTLGQVVGGQHGLNTLMIG.I

18.   AGR053W                           Mass: 22511    Score: 14     Queries matched: 1
 814474:815088,forward,Syntenic homolog of Saccharomyces cerevisiae YDR121W (DPB4)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 39   801.42   1600.82   1600.82   -0.00 1  14  4.6 2  A.VQTAEQDPRVMLSK.D

19.   AFR016W                           Mass: 62985    Score: 14     Queries matched: 1
 463845:465521,forward,Syntenic homolog of Saccharomyces cerevisiae YBL019W (APN2)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   422.70   843.39   843.48   -0.09 1  14  8.1 2  E.ETTKIPR.F

20.   AER075W                           Mass: 40166    Score: 14     Queries matched: 2
 777320:778378,forward,Syntenic homolog of Saccharomyces cerevisiae YLR405W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   422.70   843.39   843.46   -0.08 0  8  35 10  A.TIAGPMVR.Y
30   682.34   1362.66   1362.64   0.03 0  6  34 1  I.DWFDEHFVLR.R

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
24   637.85   1273.68   1273.78   -0.09 1  16  4 1  AVKFLNGLITAK
5   422.70   843.39   843.46   -0.07 1  15  6.5 1  TLRSDPR
7   432.69   863.37   863.45   -0.08 0  13  8.5 1  FQNQVTK
9   439.20   876.38   876.44   -0.05 1  13  9.5 1  ACIIDKSGA
38   793.92   1585.82   1585.81   0.01 1  13  6.5 1  ARALELQGEDGNVSK
17   567.33   1132.64   1132.64   0.00 1  12  11 1  FSNRALANLK
35   766.87   1531.72   1531.79   -0.07 0  12  8.9 1  YSIVPEQAGVEVNK
28   672.39   1342.76   1342.68   0.07 0  10  14 1  QTELNDLVQQR
55   1091.97   2181.93   2182.06   -0.14 0  9  13 1  IHAYEDQVPLQLMDFAHR
46   963.89   1925.77   1924.98   0.79 0  8  21 1  QAFGSLIGASLTAAYNWR
75   1445.02   2888.02   2887.35   0.66 1  8  16 1  CDVCTYSFVPGIEWNSLERVLSDQK
29   678.88   1355.75   1355.73   0.02 1  8  22 1  AQEELAEKALAAL
20   592.78   1183.54   1183.69   -0.16 1  8  24 1  RVEQLEIIGK
89   1234.09   3699.25   3699.72   -0.47 1  7  9.4 1  IWVFGEAGIQDELQLMGYETMGGADERLDAPFAA
44   870.87   1739.73   1739.85   -0.12 0  7  22 1  ASWVLEYIEQEFAR
60   1118.02   2234.02   2234.14   -0.12 1  7  18 1  ESFISTTIKDSTAVPESGPLR
19   584.26   1166.51   1166.54   -0.03 0  6  36 1  QDSAMGLLWF
41   815.88   1629.75   1629.81   -0.06 1  6  32 1  AAALVNKASAGSGHFTE
71   1379.52   2757.02   2757.29   -0.27 1  6  30 1  LNFEKTQFLCSLCEEPLIEDDSGK
43   846.89   1691.77   1691.83   -0.06 1  5  34 1  REPCLLNAGPAPEPAAS
2   365.66   729.31   729.37   -0.06 0  5  73 1  EQATGPK
14   523.30   1044.59   1044.48   0.10 1  5  57 1  NYANRHDR
13   501.75   1001.48   1001.61   -0.13 1  5  60 1  LGLSRLLCK
58   738.68   2213.03   2212.96   0.07 1  5  28 1  LASTNRGSANGGGSSTMESGTSGAG
22   623.80   1245.58   1245.57   0.02 0  5  50 1  AYGDVNGYQFL
64   1214.53   2427.04   2426.31   0.74 1  5  30 1  HNVQHLKWLTQVNQLDLVEL
95   1345.07   4032.19   4031.79   0.39 0  4  12 1  YAEAYGAVGVITYSDSCDDGNVTTVHGYAPYPFGPAAHP
26   1306.48   1305.47   1305.69   -0.22 0  4  85 1  ARPELDEIAPVP
54   1044.90   2087.78   2088.06   -0.28 1  4  66 1  KLTFLHTYHHGATALLCY
56   1091.99   2181.96   2182.05   -0.09 0  3  45 1  IFASNDSTVAYSVSQDHTIK
23   629.84   1257.67   1257.65   0.03 0  3  75 1  TPAISGTIQEEL
47   978.90   1955.78   1955.96   -0.17 1  3  79 1  ARIEGVLAAQHYVYCTY
40   808.88   1615.74   1615.86   -0.12 1  3  67 1  QMIVGETGGLSGQVKL
63   806.74   2417.21   2417.20   0.01 0  2  40 1  AIMVAGVGFMTDSYDIFAINLGI
68   1283.49   2564.96   2565.29   -0.33 1  2  80 1  LFLEKLGPEFWDLVQPYTFHS
37   791.89   1581.76   1581.87   -0.12 0  2  79 1  VTITDLLARPDAALN
52   1032.96   2063.91   2063.95   -0.04 0  2  69 1  EIDASATTTLAGVDDDSLDR
72   1387.54   2773.06   2772.32   0.74 0  2  71 1  TAEVFISLGNLQENESETQEMLYK
10   938.48   937.48   937.57   -0.09 1  1  1.1e+002 1  PLNKTPLR
61   1140.91   2279.80   2280.08   -0.28 1  1  1.1e+002 1  INDLDIHPSNRVAYSVSEDH
85   1176.76   3527.26   3526.85   0.41 0  1  49 1  GSVELLGNMAYLDPTQLSASLSIIVPEIVGVLND
31   684.85   1367.68   1367.68   -0.00 1  1  1.1e+002 1  LHSFKNPADDPK
78   1017.84   3050.49   3051.28   -0.80 1  1  39 1  EDEAESAQGDEAGPAGGSEVDTVRQSMSDK
11   973.34   972.33   972.55   -0.22 0  1  2.2e+002 1  ASALELGVLT
65   1221.89   2441.77   2441.03   0.74 0  1  1.2e+002 1  YYSNCTESDHISSDVPGTPVSPS
74   1415.30   2828.59   2828.41   0.18 1  0  73 1  HASTVEDVFKNILSGQIDWPSFPNK
67   1265.47   2528.92   2529.28   -0.36 1  0  1.1e+002 1  VVRGTEGYIFPTDYLSLSANAEK
1   375.16   374.15        
4   414.19   826.36        
6   428.75   855.49        
18   581.30   1160.59        
21   402.20   1203.58        
27   663.30   1324.59        
36   528.24   1581.71        
45   961.98   1921.95        
50   1028.97   2055.92        
51   1032.44   2062.86        
53   1032.96   2063.91        
57   728.38   2182.11        
73   943.11   2826.32        
76   1458.75   2915.48        
77   1008.13   3021.36        
79   1032.17   3093.49        
80   1053.43   3157.26        
81   1058.75   3173.23        
83   1088.79   3263.36        
84   1115.13   3342.38        
86   1180.10   3537.27        
87   1212.42   3634.25        
88   1230.75   3689.24        
90   1266.41   3796.21        
91   1276.73   3827.17        
92   1288.09   3861.24        
93   1291.08   3870.22        
94   1320.41   3958.20        
96   1374.39   4120.15        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 96

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 12 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 17 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.1   -0.06               M.EQATGPK.W
  4.5   -0.06    1  ABR025C R.GYVTYK.G
  4.1   -0.06               Y.FATYTK.L
  3.5   -0.11               FNPPKK
  2.8   -0.10               V.LRDQAK.L
  2.2   -0.09               I.GVLDAAGK.F
  2.2   -0.02               K.SLSNFY.T
  1.8   -0.15               K.LRMVVL.H
  1.8   -0.15               K.RIMVVL.D
  1.8   -0.11               R.RLMTPI.T
Top scoring peptide matches to query 3
Score greater than 28 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.4    0.00    9  ADL339W R.TGYQIAD.E
 15.4   -0.09               R.THQIRI.H
 15.4   -0.09   14  ACR064W V.THQLLR.Q
 15.1    0.01   15  ABR053C R.TADMAMK.I
 15.1    0.00               K.TEGNSFL.I
 15.1   -0.01    8  ABR124C R.TSVGWAF.V
 15.1   -0.04   16  ADL321W N.TSVMTTK.S
 15.1    0.07               R.TVSENDC.V
 15.1    0.00               R.TVSQADF.P
 15.1   -0.05               S.TVSSAFR.Q
Top scoring peptide matches to query 4
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 5
Score greater than 28 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.1   -0.07               R.TLRSDPR.V
 14.2   -0.09   19  AFR016W E.ETTKIPR.F
 14.1   -0.06               C.TSSSPLPR.A
  8.9   -0.14               R.VCKIVAIV.G
  8.9   -0.06               K.LVRADDVG.A
  8.8   -0.10               F.IAVRTER.L
  8.7   -0.02               I.TPDELNR.N
  8.4   -0.10               A.TEIGIRR.I
  8.2   -0.08               K.TIGDALAAL.L
  7.8   -0.08   20  AER075W A.TIAGPMVR.Y
Top scoring peptide matches to query 6
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 7
Score greater than 25 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.3   -0.08        A.FQNQVTK.E
 11.7   -0.03        R.FQKEDPT.F
  9.8   -0.06        L.FLPGCATR.G
  9.5   -0.08        P.FAGNSQLK.E
  9.5   -0.11        G.FQGGTKVK.G
  8.5   -0.01        R.CIQLMQE.Q
  8.0   -0.04        Q.FLEENGR.S
  7.3   -0.05        L.FQSANAAR.T
  6.5   -0.09        Q.KFAQNTR.K
  6.2   -0.08        V.FGADLVSR.F
Top scoring peptide matches to query 8
Score greater than 23 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.8    0.44    7  ABL024W R.ELGGVGLLD.W
  9.8    0.49               R.CLSLPNPE.S
  8.4    0.45               R.VAWVGNVQ.G
  8.4    0.43               R.NKVSSQPL.G
  7.8    0.50               K.DLQRDPE.L
  6.8    0.46               Q.ANGNRNAR.D
  4.8   -0.53               T.NEVNELR.D
  4.6    0.44               K.IENVLVDA.D
  4.1    0.41               E.DLINKNR.D
  4.1    0.44               K.LSESNIPI.I
Top scoring peptide matches to query 9
Score greater than 25 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.9   -0.05        R.ACIIDKSGA.I
 12.4   -0.07        M.SSLGSTPTK.L
 11.6   -0.11        N.SVTEKVSK.A
 11.6   -0.11        N.SLSSIVGSK.A
 11.4   -0.05        K.SSIWLGSAG.E
 10.7   -0.05        I.VMGNLTDK.R
 10.0   -0.07        R.SISGSSIVQ.K
  9.9   -0.13        S.EIPLHLR.N
  9.5   -0.13        L.IELPHIR.V
  8.7   -0.03        D.TEGRSPCK.N
Top scoring peptide matches to query 10
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5   -0.09        F.PLNKTPLR.N
  1.1   -0.03        Y.RAPQDPVR.A
Top scoring peptide matches to query 11
Score greater than 13 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.7   -0.22        R.ASALELGVLT.D
Top scoring peptide matches to query 12
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 31.7    0.01    2  ABL063C K.LSGDLVISGK.Q
 24.3    0.01    5  AER027W K.LSATVLQGLS.R
 12.9    0.02               R.MSGRAILLAG.G
 12.5    0.00               F.LSVIGSSLGR.Q
 10.0   -0.03               G.LLYLPEIK.Y
  9.7   -0.01               K.LLAMGVKEK.N
  9.6   -0.04               V.LATVTVTRK.M
  9.2    0.01               T.LLGSDVGISK.A
  8.8    0.00               Y.LIDGSSRIK.T
  8.3    0.09               D.REPCLNEK.T
Top scoring peptide matches to query 13
Score greater than 17 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.9   -0.13        I.LGLSRLLCK.V
Top scoring peptide matches to query 14
Score greater than 17 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.0    0.10        Y.NYANRHDR.T
  4.2   -0.02        T.SLRLLNSSR.N
  3.6    0.10        R.TGFRYMDR.L
  1.1    0.06        Q.TGLEIPEMR.Y
Top scoring peptide matches to query 15
Score greater than 23 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 34.0    0.02    1  ABR025C D.DFEPAEGAAR.S
  8.6   -0.08               T.VYEAIIAQR.N
  8.1   -0.13               K.YVLLLLLES.D
  4.6   -0.03               K.ARLMAAGEMI.K
  4.4   -0.03               K.FDPISEEII.N
  4.3    0.04               K.ARGDISAEED.V
  2.8    0.00               G.PDCIMALSGR.L
  1.6    0.08               -.MDPLDVEDE.V
  0.7   -0.11               K.NFVKSLEIL.R
  0.1   -0.04               K.DIYPLENAK.P
Top scoring peptide matches to query 16
Score greater than 22 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.5    0.03    1  ABR025C S.SVFEDNGALK.L
  8.6   -0.00               S.VSNFLSDGIK.W
  2.8    0.06               R.LEGAMDSPFL.D
  0.0    0.03               G.YGIENIENK.R
Top scoring peptide matches to query 17
Score greater than 16 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.9    0.00        F.FSNRALANLK.L
  2.5    0.05        R.LMLSLADAGSR.L
  2.0   -0.00        Y.LSMLLSARSR.F
  1.0    0.07        K.IDFISALPEE.V
  0.4    0.10        E.EEWLSLNDK.D
  0.4   -0.05        G.LFEVSLKGLK.D
Top scoring peptide matches to query 18
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 19
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3   -0.03        R.QDSAMGLLXF.I
  5.8   -0.00        D.SSGSEDRASSGK.E
  5.8   -0.01        R.TMAQSASISANS.S
  4.5    0.04        R.QTAAPFSSDDE.L
  1.1    0.03        R.HFSCPAFSTGN.A
  0.9   -0.12        R.KSTLAALICFT.V
Top scoring peptide matches to query 20
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.8   -0.16        L.RVEQLEIIGK.E
  5.0   -0.14        M.PTLQWLLASR.R
  4.2    0.05        R.SSSLGSSSPSDSS.S
  3.3   -0.13        G.TPGRVLDLASR.K
  2.3   -0.07        V.GCFGGFGLSLVK.E
Top scoring peptide matches to query 21
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 22
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8    0.02        R.AYGDVNGYQFL.V
  1.4    0.00        R.NGSSQLGPDTALS.L
  0.9    0.03        T.EACSDLEPPSAK.A
  0.6    0.12        G.DGMGQHDDSER.I
Top scoring peptide matches to query 23
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.03        K.TPAISGTIQEEL.W
  2.0   -0.02        V.TSLLFDPALPGK.A
  1.8    0.02        K.VVPATPKTASSNS.P
  0.8    0.16        L.TDKMCTDWMK.N
  0.1    0.07        C.TPEQVEGEIEK.C
Top scoring peptide matches to query 24
Score greater than 26 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.8   -0.09               D.AVKFLNGLITAK.L
 15.6   -0.02   12  AEL271C L.LVNFGALGGEVAK.N
 13.0   -0.04               Q.SLTIQSSPKVSK.E
 10.9    0.04               E.LSNQWNKADAK.I
 10.2    0.05               V.EDYQHAVVVSK.N
  9.3    0.03               Y.DDVETLLRDAK.R
  8.3   -0.00               S.MQQSRIVVEGK.T
  8.0    0.01               K.ADDVIPLHVPAQ.S
  7.8    0.00               H.SLDRHVGSYLK.M
  5.9    0.01               T.MLKNDIGDAGLK.T
Top scoring peptide matches to query 25
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.8    0.05    4  AGL352W K.LSYLLNEYYK.A
 10.5    0.04               E.FTPEGIASRAEK.T
 10.1   -0.02               V.FKMVLPLLNCK.Q
  3.9    0.01               L.ISYLVPRSDQK.A
  3.4    0.02               L.QFSNLRTGNLR.L
Top scoring peptide matches to query 26
Score greater than 15 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.7   -0.22        R.ARPELDEIAPVP.E
  2.5   -0.27        L.NLPVLFYNAKK.I
  1.1    0.73        I.NLPKLAAEPQPK.K
Top scoring peptide matches to query 27
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 28
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3    0.07        L.QTELNDLVQQR.H
 10.0    0.07        T.GGLQTEDLVQQR.L
  8.5    0.05        L.ISTEVLDVPSQR.A
  4.2    0.12        R.AGATGTAISFFTEA.N
  4.1    0.03        R.WNKTVIDALVQG.A
  4.0    0.07        E.MGLEPLVEVSNR.E
  1.9    0.02        H.SQKYPPLVFHK.Y
  0.7    0.07        T.AGNTMEPLIEIR.S
  0.4    0.04        L.ERASQELVGLNK.E
Top scoring peptide matches to query 29
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.8    0.02        R.AQEELAEKALAAL.R
  6.7   -0.03        A.STGVDGVGILAIVR.E
  6.7    0.04        E.LEQSLVQTDPAR.V
  6.3    0.10        H.TNPSDLRPDDAR.I
  2.8    0.01        K.SGNGFVSHLLRGI.E
  2.6    0.03        T.SDLASLSAPRSPR.V
  2.3    0.03        A.TTLALPAGGAGSGAGR.K
  1.6    0.06        S.EWVQDLKADPR.V
  1.6    0.07        K.SIPFQYFLDNL.L
  0.9   -0.03        M.WPSSLAWKILR.I
Top scoring peptide matches to query 30
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.2    0.03   20  AER075W I.DWFDEHFVLR.R
  3.5   -0.02               A.IDQLSSGVFQNR.R
  2.6   -0.04               R.LEDSELIFELR.D
  1.0    0.09               H.ADDSSAEGRENGR.N
  0.4    0.06               L.NTDNPEEEFIR.L
  0.4   -0.05               K.WDDVLIYQKAL.V
  0.1    0.02               S.GEDLFNPKNSDK.K
Top scoring peptide matches to query 31
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.9   -0.00        G.LHSFKNPADDPK.V
  0.7   -0.05        A.PINCSIVPGARNK.L
  0.7   -0.08        H.RAPTLIGEWVAR.H
  0.3    0.04        K.LNPPEANNGQAPF.S
  0.1   -0.06        D.GDVLEQPLVKDR.I
  0.1   -0.15        A.LFQRPPLISAVK.R
  0.1   -0.02        Y.LVWKCPNALNGPG.-
  0.1   -0.04        I.QCPNAKPELQIK.N
  0.1    0.01        R.VISESNPHQSGTL.Y
  0.1   -0.00        R.RAPAFADALGPDAP.Y
Top scoring peptide matches to query 32
Score greater than 24 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.8    0.06    2  ABL063C F.QALPVVNNIVTSK.L
  8.9    0.06               K.QALLIPGQTSNKL.L
  8.6    0.02               K.KALAIFVPVPSLAG.Y
  5.7    0.22               R.SPQKGVSAWEMY.K
  5.3    0.22               K.KANSISSSSSSSPSG.I
  4.6    0.11               R.QNSKAVFVPPAGPA.F
  4.3    0.15               L.AAIGLHTGRDEDK.V
  3.8    0.16               L.GALATNSTSLYER.L
  3.8    0.21               R.ALQPSQFGMLCTS.D
  2.8    0.12               K.AKLLLVDHELEC.I
Top scoring peptide matches to query 33
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.8    0.08    4  AGL352W ATSSSGEVPEIVIK
  4.1   -0.06               G.GASVFRTVLLLLK.S
Top scoring peptide matches to query 34
Score greater than 32 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.8    0.06    6  ACR050C R.WELISRLCPNSTG.A
 18.2   -0.04   10  AER025C V.SLDLIELLGDIFK.I
 12.0    0.13               K.ESLVMDNNQEIPS.G
 11.9    0.08               K.WLELQRSMFEH.N
 11.5   -0.00               R.WMFLIDGLAISIP.T
  9.9    0.10               K.GEELFYDSSKTSI.E
  8.8    0.08               R.WELSEVDNTLRN.E
  5.8    0.02               R.LVTDLKLCDDNVK.L
  5.5    0.05               K.VDITDTSSVELSPL.G
  4.6   -0.03    2  ABL063C P.GASLMGAFAAVAIALL.-
Top scoring peptide matches to query 35
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.7   -0.07        I.YSIVPEQAGVEVNK.Q
  5.5    0.05        D.EEEEAGDQLDELR.E
  4.0   -0.05        I.EAENGGAGVFNINLK.D
  2.7   -0.12        S.WNFIKLEDIQVK.Q
  0.5   -0.09        R.KLASSSSLNSSEPLL.L
  0.3   -0.16        L.SRLLTTALTINAMK.K
  0.1   -0.01        G.QCGSRLHYDQLGR.D
Top scoring peptide matches to query 36
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 37
Score greater than 13 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.12        R.VTITDLLARPDAALN.N
  0.1    0.01        Y.QVQANISEHENASR.M
Top scoring peptide matches to query 38
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.7    0.01        R.ARALELQGEDGNVSK.F
  4.0   -0.04        N.LNAIRSNGTSPTLSR.R
  2.1   -0.11        R.VAKLTDIILGSGTLVS.C
  0.9   -0.05        L.KVLAFLAGPCTQGPGK.V
Top scoring peptide matches to query 39
Score greater than 30 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 47.0    0.04    2  ABL063C K.VGGDVTFANNEHLTK.I
 14.2   -0.00   18  AGR053W A.VQTAEQDPRVMLSK.D
 10.6   -0.01               L.SLNITLHPSYFGPR.M
  9.6   -0.78               R.GCEQHGGEGAFPDDSP.F
  9.3   -0.01               R.KSLLSVLNAYGWHN.E
  5.7   -0.07               K.SLLNTPVFVVGRATQ.E
  4.0   -0.04               R.QSLAITGDLCAVARAL.T
  1.8   -0.11               R.TQLSLNLGVFRLQI.S
  0.7   -0.03               C.SAVAAGNDAAASSILRK.I
  0.6   -0.01               A.VNDSIVANEVVMRR.L
Top scoring peptide matches to query 40
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6   -0.12        R.QMIVGETGGLSGQVKL.R
  1.6   -0.06        M.AENRTLIAVIADEDS.I
Top scoring peptide matches to query 41
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
  5.7   -0.06                    R.AAALVNKASAGSGHFTE.V
  4.4   -0.07                    R.AYSVLGFIANAYVWG.Y
  3.8   -0.05                    R.LLTLHAGSEEYGAQAA.A
  3.4   -0.04                    A.VNYTNGIPTMDLHR.S
  2.5   -0.13                    A.VNGAAAGSVFLLENLR.F
  2.2   -0.05                    R.DHGEPMLARVVAQHA.R
  2.1   -0.01                    E.GAGFYVNATMEPFAR.Y
  2.1   -0.05                    R.LPQLGLSAEHGCFMK.D
  2.1   -0.10                    L.RTITTYDAHGVLQR.F
  2.1    0.01    3  mADR019C-HMM P.TEADYEAIDFETVK.N
Top scoring peptide matches to query 42
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.9    0.00   11  AER241W C.NSLLKFLNNVTDDGK.L
  7.6   -0.05               K.LPFESVIDLVGPRHV.L
Top scoring peptide matches to query 43
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4   -0.06        R.REPCLLNAGPAPEPAAS.P
  1.7   -0.12        A.SKQTFGQLAESLDLR.V
Top scoring peptide matches to query 44
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.4   -0.12        D.ASWVLEYIEQEFAR.K
Top scoring peptide matches to query 45
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 46
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3    0.79        G.QAFGSLIGASLTAAYNWR.A
  2.7    0.74        E.TYLDFSGLGELINSIRK.G
  2.6    0.75        R.SVLIQHPNKVSVSSASSSV.S
  2.4    0.63        R.KIAVVVVAYPATPLIESR.V
  2.3    0.74        A.SKDPLVTPHELTVQFSK.F
  2.1    0.73        R.QIIKLIDSLPGVDVSAEE.Q
  1.6    0.02        K.DSQEDGDTTLESDEPSTT.E
  1.2    0.77        L.YDGPSTKPISVSYIRSR.V
  1.0    0.77        R.LKLDGFALNADMIYITQ.N
  0.8    0.76        K.KILWPTLNYQIPDNPN.S
Top scoring peptide matches to query 47
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6   -0.17        R.ARIEGVLAAQHYVYCTY.N
  0.8   -0.09        M.SDHEAPVEVQEDFEVVQ.E
Top scoring peptide matches to query 48
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 40.1    0.08    1  ABR025C R.SASMYHMSSVFEDNGALK.L
 10.3   -0.10               T.AGTKGTHFSLLNIMNELK.K
  1.5   -0.02               S.DADVEESLEQLQDNKLK.V
  1.5   -0.18               V.LILGLDNAGKTTFLEQLK.A
  0.5   -0.01               V.AGSIAEAGAQQAGDLMQDLK.T
  0.1    0.01               Q.EMQGDSVWHSVSENIKK.I
  0.1    0.10               E.DDEDEDADPIIENENIK.L
Top scoring peptide matches to query 49
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.0   -0.16   13  ACR045W T.QNNLXDIERAIDGGVAAIK.G
  1.8   -0.05               L.QGWLAHWSMTTFIDYK.T
Top scoring peptide matches to query 50
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 51
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 52
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.04        N.EIDASATTTLAGVDDDSLDR.D
  1.1    0.76        R.KGEAVSGLHAVVAGSVSGLVAR.S
  0.5   -0.16        N.LGVLECWALYQSDALKAGK.L
Top scoring peptide matches to query 53
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 54
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.7   -0.28        K.KLTFLHTYHHGATALLCY.T
  3.7   -0.31        R.RLTPVPSAYPPVVTGDVTGY.T
  1.4   -0.25        R.NAVWFGGSLLAQTAEFKSY.C
  0.4   -0.26        R.RFLGDSVPIFFTEIGMPY.D
  0.1    0.72        L.FAGPSSTLPCLFGVLGSHAAR.Y
Top scoring peptide matches to query 55
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.1   -0.14        S.IHAYEDQVPLQLMDFAHR.Y
  7.4   -0.03        V.GNDEWDEIFSGFGNNSPGLK.Q
  5.7    0.72        E.KFLTTFGLDPTTIFDLKPK.D
  5.5   -0.17        I.IDPVTGDELEGNDVEGVLAIK.S
  5.1   -0.16        L.FATFFNAYPATGSFSRSALK.A
  5.0   -0.23        E.PSTNIAKQVISSEPTAQVANK.S
  4.2   -0.12        F.DSQILENKEDATICLSFEK.N
  4.2    0.79        H.SIEFQNIAHVSNIFAHINK.I
  4.1    0.71        R.VAAAFDIVAALPVSERGLALAAG.G
  3.6   -0.18        R.NGEDVVMASAQVVPGDIVQVR.V
Top scoring peptide matches to query 56
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.2   -0.09        V.IFASNDSTVAYSVSQDHTIK.T
  0.3   -0.08        F.SFGAAKPADGTGSAPAFGGFGANK.Q
Top scoring peptide matches to query 57
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 58
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8    0.07        R.LASTNRGSANGGGSSTMESGTSGAG.S
Top scoring peptide matches to query 59
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 58.5   -0.09    1  ABR025C S.SSPYELTLEQPGATSISVALR.A
  3.3    0.01               T.VTEHPQHELSSALLEEDER.K
  1.3   -0.09               D.LEELKQNTDGAEFIGNLSLK.I
  1.1   -0.19               T.VFAVFIQVLLLNMCRLPSR.E
  0.3   -0.03               N.SEGPQFDEQTVAGLLEKSQR.L
  0.2   -0.11               K.FSTILDTLGLDQPRWSELK.S
  0.1   -0.03               A.REEFDETITEISVSGHTLR.I
Top scoring peptide matches to query 60
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.6   -0.12               Y.ESFISTTIKDSTAVPESGPLR.V
  4.1   -0.12               R.VALDEELAALDAHIASVQDAIA.H
  3.3    0.11               R.AVSATSCGCSSAANGAGSRCTACTV.S
  2.9   -0.20               N.DSVLELLSNREPLAAELLPR.S
  2.2   -0.03               L.DPGKLYALYAFQGPDPSHCR.L
  1.7   -0.13               L.DSYDAHLVVLHRAIQDNLR.H
  1.6   -0.14   10  AER025C K.IGMLNDNIITSLTNLLNYNV.D
  1.5   -0.05               K.WNPDATSIELNPYITALTSE.I
  1.2   -0.18               H.SVDLHPSLDLIVSAGRDSVVR.V
  1.2    0.74               S.AAKAGVDALSNVLAVELGPLGIR.C
Top scoring peptide matches to query 61
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.3   -0.28        R.INDLDIHPSNRVAXSVSEDH.S
  0.2   -0.21        K.LCPDFYSTGTCFILGCQLYH.E
Top scoring peptide matches to query 62
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 39.3   -0.16    3  mADR019C-HMM K.LLAGNFPTEADYEAIDFETVK.N
  0.5   -0.23                    T.LLAGCPGALFAGSGFLRDEHGVR.R
Top scoring peptide matches to query 63
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.4    0.01        R.AIMVAGVGFMTDSYDIFAINLGI.T
  2.0   -0.15        R.LTSLNPDIIFVGANVSGYALKIL.N
  1.5   -0.01        V.AMVINEGFEGLAVVFYMCIIAK.R
  0.1    0.01        A.ADIPTFVGEGRCDLGITGVDQVR.E
Top scoring peptide matches to query 64
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8    0.74        R.XNVQHLKWLTQVNQLDLVEL.Q
  3.0    0.78        I.VSRWLCELEATEPVAVLDGLAR.C
  3.0    0.71        D.VAFLVVGDPFGATTHTDLVLRAK.K
  3.0    0.80        R.DLTSNEIVAIKVVNLEDTDEPI.D
  2.9    0.73        L.LTHLAKFGIPTDGYAVPIINMR.I
  2.8    0.74        L.TFIFTNLEFTFLLHIGLSASR.R
  2.8    0.75        G.TPPGHASLVMKLADDFLVISTSK.E
Top scoring peptide matches to query 65
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.6    0.74        R.YYSNCTESDHISSDVPGTPVSPS.I
Top scoring peptide matches to query 66
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 38.9   -0.20    1  ABR025C K.GNSGFYPVGSSSPYELTLEQPGAT.S
Top scoring peptide matches to query 67
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4   -0.36        Y.VVRGTEGYIFPTDYLSLSANAEK.D
Top scoring peptide matches to query 68
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.33        K.LFLEKLGPEFWDLVQPYTFHS.A
  1.1    0.49        R.LFVQLPLESLAILVSAVVFGFRF.I
  0.9    0.71        R.SSFLLALDTDQHPISLEDKAHNN.W
  0.6   -0.47        A.AAPGQLTLRQINELYASIGGLRPK.K
Top scoring peptide matches to query 69
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.9    0.41   17  AGL170W K.IGGCGKFFTLGQVVGGQHGLNTLMIG.I
  2.5   -0.47               K.YGSVLENVVYDPVTRVVDYEDSS.I
  1.7    0.47               S.EQLAEVLTHMLSSSLGEMSACLVR.V
  1.7    0.61               K.AVHASECPGFDGEIGDHFSSDWKL.L
  1.7    0.54               S.EQGETCQGMPNLAGLVLDACTQGIR.S
  1.6    0.54               R.STRSSEYLLCSLWCLVSMYLSY.S
  1.6   -0.25               K.VEYEQYLANTGQEDDNGSDDDNN.D
Top scoring peptide matches to query 70
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 31.9   -0.36    1  ABR025C K.GNSGFYPVGSSSPYELTLEQPGATSIS.V
Top scoring peptide matches to query 71
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6   -0.27        L.LNFEKTQFLCSLCEEPLIEDDSGK.K
  4.7   -0.30        K.RFLSPAFGVANGYMYWFNWAITF.A
  4.4   -0.30        K.ILNYGATIYSWTIDGEEQLWLSDA.A
  4.3    0.73        R.CDTASSAAPELLLSTSLETNYSRDGR.W
  4.0    0.69        F.LELFFSSSACFFNSFTLSFLFFR.L
  3.5    0.60        K.LLVLNAANASTDLTSGLDDQELVWKA.L
  2.6   -0.45        N.NLEELLNAEGTTVVPAVNQVELHIR.L
  2.6   -0.26        G.ELDTVTEESRVQELYDCFPIESR.T
  2.3    0.61        L.ILLYIVITVVFYYQGFIDDNYW.-
  2.2    0.57        R.LAVVNLSDNAFGLRTIEALEQYIAH.A
Top scoring peptide matches to query 72
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5    0.74        D.TAEVFISLGNLQENESETQEMLYK.Q
Top scoring peptide matches to query 73
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 74
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4    0.18        F.HASTVEDVFKNILSGQIDWPSFPNK.E
Top scoring peptide matches to query 75
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.9    0.66               W.CDVCTYSFVPGIEWNSLERVLSDQK.V
  7.1    0.49               K.MQVDSNVQTRPLQLAHKEVDAIPVTV.N
  4.5    0.71               R.DPQPETSKRPADSEPETAQEAPEPPAN.K
  3.8    0.56               K.LGVSSSSPASSALLFDRQPSPTSAASSAPL.A
  3.6    0.61               R.VHTLEELHQQQTGEDIALDIIDELE.L
  3.2    0.54               R.ESQGTVIVVSSGLSQMGHPALAAYASSKI.A
  2.9    0.66    8  ABR124C R.GSIICAILAWCICPWNLMSSSSRFTE.T
  2.8    0.65               N.AQDESQLFELPQLYTCLYQEVQSR.Y
  2.7    0.51               K.IQCRPIFSSIVSLFAEHNDLKFAVPG.G
  2.5    0.59               G.DSEIELFEDLSLEEQIAQLHNFLR.A
Top scoring peptide matches to query 76
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 77
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 78
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8   -0.80        D.EDEAESAQGDEAGXAGGSEVDTVRQSMSDK.L
Top scoring peptide matches to query 79
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 80
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 81
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 82
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 69.1   -0.13    1  ABR025C K.GNSGFYPVGSSSPYELTLEQPGATSISVALR.A
  0.6    0.70               F.ITSAPGKVIIFGEHSAVYNKPAIAASVSSLR.T
Top scoring peptide matches to query 83
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 84
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 85
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.9    0.41        R.GSVELLGNMAYLDPTQLSASLSIIVPEIVGVLND.S
Top scoring peptide matches to query 86
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 87
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 88
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 89
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.4   -0.47        K.IWVFGEAGIQDELQLMGYETMGGADERLDAPFAA.D
  6.9    0.48        W.DLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGK.D
  6.9   -0.61        P.RRPAVGASAGTLPHGSEDVGADLLMYLATSPYASAAK.Q
  6.9   -0.50        K.SPNKNNGSLPQPPAFPMGMPPMFGGFPPFPFPGMI.P
Top scoring peptide matches to query 90
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 91
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 92
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 93
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 94
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 95
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4    0.39        R.YAEAYGAVGVITYSDSCDDGNVTTVHGYAPYPFGPAAHP.S
  2.8   -0.73        G.YGGSMFMPTMPQQQLQQQVAPQQTAQAALQEAELER.Y
  2.7   -0.67        K.QVFENNFSVDSMSPSIDIGRFSSGSSTELLFSLDGYT.G
Top scoring peptide matches to query 96
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide