Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0420_q2.pkl
Database        : Ashbya Ashbya (4796 sequences; 2346673 residues)
Timestamp       : 25 Jul 2007 at 12:38:02 GMT
Significant hits: AFR711C      1745290:1746975,reverse,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
                  ABL063C      282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
                  mAGL352W-NN  Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); 
                  ABR025C      440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
                  AEL111C      415421:416467,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C; Inve
                  ADR019C      739205:739837,reverse,Syntenic homolog of Saccharomyces cerevisiae YER011W (TIR1) and YIL011W (TIR3
                  ADL021W      671422:672810,forward,Non-syntenic homolog of Saccharomyces cerevisiae YOL030W

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 41 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    AFR711C                           Mass: 58053    Score: 300    Queries matched: 3
 1745290:1746975,reverse,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
21   659.86   1317.71   1317.68   0.03 0  78  1.2e-005 1  K.SGGVSVEAVSEGLK.V
42   933.43   1864.85   1864.87   -0.02 0  103  3.8e-008 1  K.LDYEQYVDVFYHFK.S
43   952.96   1903.90   1903.94   -0.04 0  119  8.7e-010 1  K.VTAPDCEALQSGMIVVSK.D

 
      Proteins matching the same set of peptides:
      mAFR711C                          Mass: 55938    Score: 300    Queries matched: 3
 weak sim. with Fig2,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)

2.    ABL063C                           Mass: 42563    Score: 294    Queries matched: 6
 282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   439.70   877.38   877.40   -0.02 0  35  0.23 1  K.FDVNNNR.Y
15   587.81   1173.60   1173.58   0.02 0  7  1.6e+002 1  V.TFANNEHLTK.I
19   653.35   1304.69   1304.66   0.03 0  81  6.5e-006 1  K.TVGNSLALSSNDK.I
25   691.92   1381.82   1381.79   0.03 0  60  0.00074 1  F.QALPVVNNIVTSK.L
27   723.37   1444.73   1444.69   0.04 0  14  32 1  G.GDVTFANNEHLTK.I
33   801.41   1600.80   1600.78   0.02 0  108  1.1e-008 1  K.VGGDVTFANNEHLTK.I

 
      Proteins matching the same set of peptides:
      mABL063C                          Mass: 40673    Score: 294    Queries matched: 6
 Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) and YDR055W (PST1); 1-intron
3.    mAGL352W-NN                       Mass: 56261    Score: 250    Queries matched: 4
 Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1);
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   611.83   1221.65   1221.62   0.03 0  51  0.0061 1  R.YTQVVDELQK.Y
26   708.90   1415.78   1415.75   0.03 0  48  0.013 1  -.ATSSSGEVPEIVIK.G
51   1139.90   2277.79   2277.93   -0.14 0  29  0.8 1  R.ADFYGFNVYSWCGDSSFEK.S
56   812.68   2435.03   2435.01   0.01 1  128  1e-010 1  K.CMMDALSCVVNDSVDKEDYGK.L

 
      Proteins matching the same set of peptides:
      AGL352W                           Mass: 58032    Score: 247    Queries matched: 4
 47585:49186,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic
4.    ABR025C                           Mass: 20232    Score: 245    Queries matched: 4
 440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   462.71   923.41   923.43   -0.02 0  53  0.0026 1  K.GAFTAGSADK.A
 5   474.23   946.44   946.45   -0.01 0  8  1.2e+002 9  D.FEPAEGAAR.S
35   838.92   1675.83   1675.83   0.00 0  128  1.1e-010 1  K.LGGSTADALSAVVTDDGK.L
50   1110.02   2218.02   2218.15   -0.13 0  56  0.002 1  S.SSPYELTLEQPGATSISVALR.A

 
      Proteins matching the same set of peptides:
      mABR025C                          Mass: 18217    Score: 245    Queries matched: 4
 hom. to Cwp1p,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1);
5.    AEL111C                           Mass: 35909    Score: 123    Queries matched: 2
 415421:416467,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C; Inve
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   502.75   1003.48   1003.48   0.00 0  59  0.0011 1  K.DPVTAVSCR.S
53   1151.95   2301.89   2302.06   -0.17 0  68  0.00011 1  L.SGSFYNLYDENIAPQCSPIK.L

 
      Proteins matching the same set of peptides:
      mAEL111C                          Mass: 33442    Score: 123    Queries matched: 2
 Pir protein,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C;
6.    ADR019C                           Mass: 20820    Score: 67     Queries matched: 1
 739205:739837,reverse,Syntenic homolog of Saccharomyces cerevisiae YER011W (TIR1) and YIL011W (TIR3
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
54   1171.99   2341.97   2342.13   -0.16 0  68  0.00011 1  K.LLAGNFPTEADYEAIDFETVK.N

 
      Proteins matching the same set of peptides:
      mADR019C-HMM                      Mass: 19120    Score: 67     Queries matched: 1
 weak hom. to ScTip1,Syntenic homolog of YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog
      mADR019C-NN                       Mass: 19048    Score: 67     Queries matched: 1
 weak hom. to ScTip1,Syntenic homolog of YER011W (TIR1) and YIL011W (TIR3) and Non-syntenic homolog
7.    ADL021W                           Mass: 50313    Score: 60     Queries matched: 2
 671422:672810,forward,Non-syntenic homolog of Saccharomyces cerevisiae YOL030W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
22   679.84   1357.67   1357.64   0.03 0  61  0.00063 1  R.EFGEVSSIFSEK.M
 51   1139.90   2277.79   2278.00   -0.21 0  0  7.1e+002 2  R.FNTECSYNANYLQHVFATV.D + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      mADL021W                          Mass: 48492    Score: 60     Queries matched: 2
 Gas-family,forward,Non-syntenic homolog of Saccharomyces cerevisiae YOL030W
8.    AGL017W                           Mass: 113425   Score: 30     Queries matched: 1
 689404:692424,forward,Syntenic homolog of Saccharomyces cerevisiae YPL009C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   462.71   923.41   923.51   -0.10 2  32  0.32 2  L.KFTKGESK.I

9.    AGL305W                           Mass: 114468   Score: 27     Queries matched: 1
 128699:131872,forward,Syntenic homolog of Saccharomyces cerevisiae YJR091C (JSN1) and YPR042C (PUF2
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   523.28   1044.54   1044.47   0.07 0  29  1 1  G.GTDVDGQPQK.L + Deamidation (NQ)

10.   AAL040W                           Mass: 50223    Score: 24     Queries matched: 1
 272459:273781,forward,Syntenic homolog of Saccharomyces cerevisiae YDR312W (SSF2) and YHR066W (SSF1
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   523.28   1044.54   1044.59   -0.05 1  27  1.8 2  K.TGNVSLKVAR.T + Deamidation (NQ)

11.   ADR367C                           Mass: 31867    Score: 24     Queries matched: 1
 1359231:1360082,reverse,Syntenic homolog of Saccharomyces cerevisiae YAL034W-A (MTW1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 21   659.86   1317.71   1318.57   -0.86 0  25  2.6 2  R.QLFGDAAEDAAPD.H

12.   AGL304W                           Mass: 34142    Score: 22     Queries matched: 1
 132225:133103,forward,Syntenic homolog of Saccharomyces cerevisiae YER106W (MAM1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   439.70   877.38   877.43   -0.05 0  24  2.8 2  Q.FDVNVQR.K + Deamidation (NQ)

13.   ADL046C                           Mass: 169242   Score: 22     Queries matched: 2
 603394:607818,reverse,Syntenic homolog of Saccharomyces cerevisiae YGL173C (KEM1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   474.23   946.44   945.52   0.93 0  26  2.2 1  K.GAFPVLLQT.F + Deamidation (NQ)
 36   841.89   1681.77   1682.73   -0.96 0  4  3.1e+002 4  P.DNSNQLSGTNFANGIK.G + 4 Deamidation (NQ)

14.   AFR415C                           Mass: 48152    Score: 21     Queries matched: 1
 1177993:1179243,reverse,Syntenic homolog of Saccharomyces cerevisiae YJR062C (NTA1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   439.70   877.38   877.43   -0.05 1  24  2.8 2  E.FDVNRDL.-

15.   AEL004W                           Mass: 53814    Score: 19     Queries matched: 1
 630125:631552,forward,Syntenic homolog of Saccharomyces cerevisiae YDL001W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   439.70   877.38   876.41   0.97 1  20  7.8 4  Y.TDWRGDK.R

16.   AEL104W                           Mass: 121592   Score: 18     Queries matched: 2
 431236:434493,forward,Syntenic homolog of Saccharomyces cerevisiae YJL157C (FAR1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   497.21   992.40   992.47   -0.07 1  8  1e+002 8  A.AKEGFNNGR.F + Deamidation (NQ)
 9   514.27   1026.53   1026.62   -0.09 1  13  28 2  L.KIIQQQLR.S + Deamidation (NQ)

17.   AGR043W                           Mass: 410449   Score: 18     Queries matched: 2
 787126:798063,forward,Syntenic homolog of Saccharomyces cerevisiae YDR150W (NUM1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   497.21   992.40   991.49   0.90 0  8  1e+002 9  Y.QTASTVTAGR.V + Deamidation (NQ)
18   629.83   1257.64   1257.68   -0.04 2  18  11 1  R.TPQRRLQPYV.L + Deamidation (NQ)

18.   ACR130W                           Mass: 64142    Score: 18     Queries matched: 1
 577065:577718;577720:578778,forward,Syntenic homolog of Saccharomyces cerevisiae YOR239W (ABP140);
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 21   659.86   1317.71   1317.69   0.02 1  20  7.6 3  V.SGGVSSLRQADLK.D + Deamidation (NQ)

19.   ADR357C                           Mass: 129526   Score: 17     Queries matched: 2
 1337109:1340504,reverse,Syntenic homolog of Saccharomyces cerevisiae YOR330C (MIP1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   474.23   946.44   946.50   -0.05 0  9  1.1e+002 6  K.LSINAIDTT.T
 10   523.28   1044.54   1044.64   -0.11 1  13  37 5  G.VRFAAQLLK.Q

20.   AAL164C                           Score: 17     Queries matched: 1
 55223:57427,reverse,Syntenic homolog of Saccharomyces cerevisiae YLL008W (DRS1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   462.71   923.41   923.51   -0.10 2  20  5.9 3  R.QYKKTQK.D + Deamidation (NQ)

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
30   765.86   1529.71   1530.68   -0.97 0  17  15 1  SEEPQAPASSEQGSK
40   909.49   1816.96   1816.79   0.17 0  15  25 1  QFNETYIADVTEEEK + 2 Deamidation (NQ)
6   497.21   992.40   991.46   0.93 0  14  25 1  QLECNSLK + Deamidation (NQ)
9   514.27   1026.53   1026.62   -0.09 1  14  23 1  RVVQAVIDK
28   755.87   1509.72   1509.68   0.04 0  13  40 1  EMILMQQQMMAR + Deamidation (NQ)
32   774.89   1547.77   1546.86   0.91 1  11  57 1  SAITKATSLLTGQQK + Deamidation (NQ)
46   970.95   1939.89   1939.91   -0.02 0  11  57 1  FTQEEQDAIVNYVAPSK + 2 Deamidation (NQ)
16   603.30   1204.58   1204.55   0.03 0  11  68 1  ESSHPLNDVAH
13   543.81   1085.61   1085.56   0.05 0  10  72 1  QEISLIDPAT
1   365.66   729.30   728.45   0.85 1  10  81 1  KAANVVK
2   419.70   837.40   837.41   -0.01 0  10  58 1  ACSLLFAG
31   766.86   1531.70   1531.64   0.06 2  10  86 1  TDKGQNFCRNEY + Deamidation (NQ)
47   1003.89   2005.77   2004.91   0.87 0  8  1.1e+002 1  LFIMDLTAQGTMVESNSF + 2 Deamidation (NQ)
14   559.84   1117.67   1118.60   -0.93 0  8  1.3e+002 1  AVTLLSCDIK
11   531.75   1061.49   1060.55   0.95 0  8  1.3e+002 1  LLEMLALNSG + Deamidation (NQ)
36   841.89   1681.77   1680.88   0.89 1  7  1.4e+002 1  RNPQLLGDLGAEELR + Deamidation (NQ)
41   927.90   1853.78   1852.91   0.87 2  7  1.5e+002 1  AREQGTLSSLAEFRCK + Deamidation (NQ)
20   436.43   1306.27   1306.65   -0.38 0  7  1.5e+002 1  NMSVIAHVDHGK
7   501.74   1001.47   1001.55   -0.08 0  7  1.7e+002 1  AVASPTTTVR
24   690.36   1378.71   1379.59   -0.89 1  6  1.7e+002 1  DGKFGHLACFDN
45   963.88   1925.74   1925.04   0.70 2  5  2.3e+002 1  KPQEILQNVQDLKKEI + 3 Deamidation (NQ)
29   758.35   1514.68   1514.74   -0.05 0  4  2.7e+002 1  AYQTSTLTLESTVT + Deamidation (NQ)
37   882.87   1763.73   1764.00   -0.27 1  4  3e+002 1  IVILSVADTGSSVKFTK
44   960.95   1919.89   1919.83   0.06 1  4  3.2e+002 1  FGKSIYDFMCNNGNPR + Deamidation (NQ)
39   595.62   1783.83   1782.98   0.84 1  3  3.8e+002 1  ILPSSRAAVLQTSGSSLP
38   892.33   1782.64   1782.96   -0.32 0  3  3.9e+002 1  IPNNLPTIGPSTHPPTK
52   1140.89   2279.76   2280.29   -0.53 0  3  3.7e+002 1  NILESVTLLARPGEMVLVLGR + Deamidation (NQ)
23   684.84   1367.67   1368.64   -0.96 0  3  3.7e+002 1  GTTAQTASTSTGSLS
12   537.77   1073.53   1073.59   -0.06 1  3  4.4e+002 1  IIRDDPFAK
49   1044.89   2087.76   2086.91   0.85 1  2  4.2e+002 1  NTLPWTKEYMNGAFDNW + Deamidation (NQ)
48   1041.96   2081.91   2082.06   -0.15 1  2  4.8e+002 1  ATPHQFPRGVNFNVQIAGK + 2 Deamidation (NQ)
34   815.87   1629.73   1628.83   0.91 1  2  5.2e+002 1  HADGKVTGTDFVLNR
62   1122.75   3365.24   3364.69   0.55 2  1  4.6e+002 1  EPGVAGGFCLFSNVAVAAQNILKNYPESVRR + 2 Deamidation (NQ)
59   1302.86   2603.71   2603.07   0.64 1  1  5.7e+002 1  ETTFDAQLQQMRQQEAGNSSDTI + 6 Deamidation (NQ)
60   1434.87   2867.73   2868.25   -0.53 0  0  5.7e+002 1  ISGNDFETEVDELSFNCYVNNVFR + Deamidation (NQ)
55   1208.51   2415.00        
57   1221.87   2441.73        
58   1254.47   2506.93        
61   1103.51   3307.50        
63   1176.75   3527.21        
64   1180.07   3537.20        
65   1230.74   3689.20        
66   1234.07   3699.19        
67   1288.06   3861.16        
68   1291.06   3870.16        
69   1386.70   4157.07        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1 Da
Fragment Mass Tolerance: ± 0.2 Da
Max Missed Cleavages   : 2
Instrument type        : ESI-QUAD-TOF
Number of queries      : 69

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.7    0.85        K.KAANVVK.G
  9.1    0.89        T.EALAGLR.K
  8.0    0.89        R.EAALVAR.N
  7.3    0.86        Q.TVALPTK.G
  7.3    0.82        T.LSALVVK.R
  6.8    0.89        G.EALAAVR.D
  6.6    0.86        K.SLALPTK.I
  6.5    0.90        Y.AEPSVVK.Y
  6.4    0.85        R.VTIAGIR.Q
  5.3    0.92        K.EAPSRLG.F
Top scoring peptide matches to query 2
Score greater than 21 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.6   -0.01        K.ACSLLFAG.G
  9.4   -0.12        R.APKPRAKA.A
  7.8   -0.99        V.AFTDTER.L
  7.2   -0.04        I.ASPLHNAK.I
  6.5    0.03        K.AGAPSASMF.K
  6.4    0.08        R.SGSEAQMQ.Q
  3.9   -0.06        T.HRLAQGR.E
  3.4    0.03        R.FCVAQAAA.R
  1.9    0.99        R.SNYKPTQ.Q
  0.9   -0.03        R.AFQGTKSV.N
Top scoring peptide matches to query 3
Score greater than 39 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 34.8   -0.02    2  ABL063C K.FDVNNNR.Y
 24.0   -0.05   14  AFR415C E.FDVNRDL.-
 24.0   -0.05   12  AGL304W Q.FDVNVQR.K
 19.5    0.97   15  AEL004W Y.TDWRGDK.R
 16.4   -0.07               M.MMVARVAT.A
 15.8    0.95               N.RNSASVNK.A
 14.5   -0.08               K.KKYPVDQ.N
 13.4    0.03               R.FNYFQGT.S
 12.4   -0.09               E.VYVNEVR.F
 12.0    0.00               K.ASRSNVDQ.K
Top scoring peptide matches to query 4
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 53.3   -0.02    4  ABR025C K.GAFTAGSADK.A
 32.5   -0.10    8  AGL017W L.KFTKGESK.I
 19.9   -0.10   20  AAL164C R.QYKKTQK.D
 18.4    0.01               K.QFDNSEGK.S
 17.4   -0.03               S.KSSVSCQK.H
 17.1   -0.10               Y.KFGLGSSTK.D
 16.6    0.08               K.GCNDGSADK.F
 16.4   -0.02               Y.SGKFGADDK.D
 15.2    0.90               E.KGYIDLSK.R
 15.1   -0.07               E.VNYASRSK.F
Top scoring peptide matches to query 5
Score greater than 28 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.6    0.93   13  ADL046C K.GAFPVLLQT.F
 13.9    0.95               K.KFPDPKNT.R
 13.4   -0.03               K.FEPQGKQL.E
 13.4    0.04               K.VMSQQPQQ.T
  9.5    0.89               K.DIKSGKVVT.T
  8.8   -0.05   19  ADR357C K.LSINAIDTT.T
  8.6    1.00               K.IMQPEVQT.R
  8.6    0.01               K.IMQPEVQT.R
  8.2   -0.01    4  ABR025C D.FEPAEGAAR.S
  8.1    0.98               R.IVETAPSET.P
Top scoring peptide matches to query 6
Score greater than 26 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.5    0.93               L.QLECNSLK.D
 12.3   -0.05               R.ACDSVLSQI.M
 10.7   -0.06               F.QGTMNNSIK.C
 10.5   -0.12               T.SSGLYLPEK.N
  9.4    0.93               F.NALAQFNGR.R
  9.4   -0.09               W.WWQLFGR.R
  8.7   -0.05               K.QGTSSAARSQ.G
  8.4   -0.07   16  AEL104W A.AKEGFNNGR.F
  8.3    0.90   17  AGR043W Y.QTASTVTAGR.V
  8.1   -0.04               K.ETRESSNGL.P
Top scoring peptide matches to query 7
Score greater than 18 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.6   -0.08        L.AVASPTTTVR.E
  5.1    0.95        K.RIQEILND.A
  4.7    0.01        R.VPNRANVAC.L
  3.9    0.01        R.LGGDRPVEC.K
  3.4    0.95        K.HFLEILQT.Y
  2.1   -0.04        R.RGNLSKQPT.H
  2.1   -0.04        K.RNRVPLSC.T
  1.4   -0.03        K.QHFLIAIC.R
  0.4    0.90        R.RATVVTLQN.I
  0.1    0.00        R.HQLESLSST.D
Top scoring peptide matches to query 8
Score greater than 31 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 58.5    0.00    5  AEL111C K.DPVTAVSCR.S
 15.1   -0.14               K.LVSKKHVPP.S
 13.4   -0.07               V.LVSLVASCR.I
 11.5    0.08               K.PDEAAACNR.L
 10.3   -0.07               C.VLEAARSMK.D
  9.1    0.01               G.DPSGRSTER.T
  8.6   -0.09               A.DPVFSKAIK.V
  7.2   -0.10               E.DPRIKTFK.E
  6.9    0.08               K.DPSLVEDDD.P
  5.5    0.00               R.PDAQSMKAR.L
Top scoring peptide matches to query 9
Score greater than 24 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.9   -0.09               E.RVVQAVIDK.V
 13.1   -0.14               E.IGALKRTIR.D
 13.1   -0.09   16  AEL104W L.KIIQQQLR.S
 13.1   -0.09   16  AEL104W L.KIIQQQLR.S
 13.1   -0.09               R.LIKQQELR.R
 10.7   -0.98               P.PEQAGNRQK.E
 10.4   -0.13               L.LKLQLEKR.R
 10.4   -0.06               I.LLQKNQQR.M
 10.4   -0.06               V.LQIQNVRR.L
 10.4    0.02               Q.NAPAQELGAR.C
Top scoring peptide matches to query 10
Score greater than 41 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 29.0    0.07    9  AGL305W G.GTDVDGQPQK.L
 26.5   -0.05   10  AAL040W K.TGNVSLKVAR.T
 18.7    0.07    9  AGL305W G.GTDVDGQPQK.L
 17.8    0.03               R.TDGVKAPNGVS.S
 13.5   -0.11   19  ADR357C G.VRFAAQLLK.Q
 12.3   -0.03               R.ANSVLAWKR.E
 11.8   -0.99               R.EKDATQIEI.N
 11.7    0.02               V.GADEKIQER.T
 11.7    0.02               Q.ITASQGSPER.D
 11.7   -0.02               V.NKEQEIKR.I
Top scoring peptide matches to query 11
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.6    0.95        R.LLEMLALNSG.D
  2.8    0.98        R.GEAKSTPRSE.L
  0.8    0.95        R.TNSVTAQLNL.I
  0.5   -0.04        R.TLAPGGYLSPS.I
Top scoring peptide matches to query 12
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6   -0.06        A.IIRDDPFAK.H
  0.0    0.90        A.IAKQIPGFAK.L
Top scoring peptide matches to query 13
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3    0.05        K.QEISLIDPAT.S
  9.6    0.01        R.AWTVVNLQR.G
  4.6    0.12        K.NGPEVTPAEAT.A
  3.5   -0.01        K.TRAEINRLI.R
  2.6    0.03        R.RIATGGADNLV.K
  2.3    0.08        A.EKAEQPQQK.E
  2.3    0.01        K.QKLSELGLPT.A
  1.9    0.05        V.QQQRQLQR.Q
  1.9    0.05        V.QQQRQLQR.Q
  1.9   -0.93        V.QQQRQLQR.Q
Top scoring peptide matches to query 14
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.7   -0.93        T.AVTLLSCDIK.K
  5.5    0.15        K.EAANTNIEQK.L
  4.8    0.04        R.SIAVFLNILAG.L
  4.3   -0.83        K.EAANTNIEQK.L
  4.2   -0.83        K.EAANTNIEQK.L
  4.1   -0.83        R.SLADNQAGNVK.N
  3.0    0.15        K.EAANTNIEQK.L
  2.9    0.15        K.EAANTNIEQK.L
  1.8   -0.92        K.RLTTLETNAT.L
  1.6    0.17        K.DGNVSAQGQDK.T
Top scoring peptide matches to query 15
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.2    0.02    2  ABL063C V.TFANNEHLTK.I
  5.8   -0.96    2  ABL063C V.TFANNEHLTK.I
  5.8   -0.96    2  ABL063C V.TFANNEHLTK.I
  3.3    0.08               K.EPITADGNEQT.A
  1.9    1.00               K.EDNILNVKQT.L
  1.2   -0.90               K.EPITADGNEQT.A
Top scoring peptide matches to query 16
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.5    0.03        K.ESSHPLNDVAH.F
  7.5    0.92        K.LVINEYQRLG.K
  7.3    0.92        P.LLVSVYGGPGSR.T
  6.7    0.99        N.QYFAQAYKGK.L
  6.0   -0.98        N.HNNQRGGYFL.-
  6.0   -0.98        N.HNNQRGGYFL.-
  6.0   -0.98        N.HNNQRGGYFL.-
  5.3    0.93        K.QPVLLDIYSR.E
  3.9    0.94        L.PQVFGSVRASR.L
  3.9    0.93        K.IIVAQAIQFNS.K
Top scoring peptide matches to query 17
Score greater than 30 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 50.5    0.03    3  mAGL352W-NN R.YTQVVDELQK.Y
 34.2   -0.96    3  mAGL352W-NN R.YTQVVDELQK.Y
 14.1    0.07                   R.YDNVVIRCPS.K
  7.5   -0.03                   A.APSHVVGISVTR.V
  7.5    1.00                   A.NQFVVVRTTR.V
  6.8    0.00                   K.YTQGNSLLLIV.D
  6.0    0.05                   R.YEASVRQLQQ.K
  5.3    0.94                   N.LIIHIDQLQK.Q
  5.2   -0.92                   K.EKLTCVCEGK.D
  4.9   -0.01                   K.YTQISAAEKIV.K
Top scoring peptide matches to query 18
Score greater than 25 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.4   -0.04   17  AGR043W R.TPQRRLQPYV.L
 10.9    0.01               R.AVTGIIHNFGQT.P
  9.3   -0.98               R.AVTGIIHNFGQT.P
  6.4    0.02               Y.GTYIAINEYSK.R
  4.8   -0.02               K.DSPLNLLKPFN.P
  4.5    0.97               K.LNPSLNQGSAKK.L
  4.4   -0.06               S.KVLEGAERAASK.R
  4.2   -0.12               S.KLVTLAQTEKK.G
  3.8    0.04               R.DDICEALLRGP.E
  3.8    0.01               R.AVTGIIHNFGQT.P
Top scoring peptide matches to query 19
Score greater than 29 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 80.6    0.03    2  ABL063C K.TVGNSLALSSNDK.I
 60.3   -0.95    2  ABL063C K.TVGNSLALSSNDK.I
 11.3    0.06               R.QTIDIASLSQID.R
  6.9    0.02               M.SIGPHELPPGSSK.Q
  6.7    0.19               K.DNDGGLNEDELN.V
  5.2   -0.95               K.IKNGSKESSVQE.S
  4.3   -0.01               E.TVGSQFLDPTLK.S
  4.0    0.14               E.AEGNVNAEAWNK.L
  4.0    0.07               V.SIGNRDELSANK.R
  3.7   -0.95               S.GGSGNDGFAAKLGR.K
Top scoring peptide matches to query 20
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0   -0.38        R.NMSVIAHVDHGK.S
Top scoring peptide matches to query 21
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 78.0    0.03    1  AFR711C K.SGGVSVEAVSEGLK.V
 24.6   -0.86   11  ADR367C R.QLFGDAAEDAAPD.H
 20.0    0.02   18  ACR130W V.SGGVSSLRQADLK.D
 16.7    0.98               R.TVVSVSRSPSVSL.S
 15.4    0.95               G.TVVARSSMVIVR.R
 11.3    0.06               S.KNSNVDNGVLQK.E
 11.0    0.99               R.QAVCLLVCKLL.F
 10.6   -0.01               S.VKASTETTISPGK.E
 10.5    0.99               R.SLDKELVSKVQA.V
  9.3   -0.92               S.KNSNVDNGVLQK.E
Top scoring peptide matches to query 22
Score greater than 26 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 60.8    0.03    7  ADL021W R.EFGEVSSIFSEK.M
  9.7   -0.98               R.NADVSIIHFNET.L
  8.8   -0.98               G.TFNIYASFPGDK.A
  8.1    0.94               L.ANPSVTLIEREK.I
  7.9    0.93               -.MGSGQLVVSPIIR.D
  7.5    0.01               R.LDALMDETPPRT.G
  5.1    0.14               R.EADEEGDLHNET.E
  4.5    0.92               E.DAAIQLVALVNTK.L
  3.9    0.99               M.TAQSKEVAPTVPE.G
  2.9   -0.06               K.LHALVDKINAYT.Q
Top scoring peptide matches to query 23
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6   -0.96        K.GTTAQTASTSTGSLS.S
  0.8   -0.01        T.GIDNAVAPAPWTR.L
Top scoring peptide matches to query 24
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.4   -0.89        R.DGKFGHLACFDN.V
  3.3   -0.01        S.PQSLKSISSYNR.A
  3.3   -1.00        S.PQSLKSISSYNR.A
  3.0    0.89        M.AAQTRPIPLRVR.T
  1.4    0.94        E.RINLQSLNKYK.E
  1.0   -0.13        R.KTVSLLFFIGVR.C
  0.9    0.94        E.RINLQSLNKYK.E
  0.9   -0.05        I.KTSVLVERYER.R
  0.8   -0.10        R.IRIRSSLLTPHS.L
  0.7   -0.04        K.LRPYIVLYNEV.H
Top scoring peptide matches to query 25
Score greater than 32 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 59.7    0.03    2  ABL063C F.QALPVVNNIVTSK.L
 48.5   -0.96    2  ABL063C F.QALPVVNNIVTSK.L
 32.4   -0.96    2  ABL063C F.QALPVVNNIVTSK.L
 28.2   -0.96    2  ABL063C F.QALPVVNNIVTSK.L
 15.9    0.11               R.KALPAVGTNAPEDV.M
 11.4   -0.89               L.QALPAQWEVWR.E
 10.3    0.12               K.QAIKYAREQQF.D
  9.9    0.15               R.GAALKIGQMMSFQ.D
  7.9    0.12               K.QAIKYAREQQF.D
  7.7    0.06               N.KIAKLNSFNFAK.E
Top scoring peptide matches to query 26
Score greater than 28 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 47.5    0.03    3  mAGL352W-NN ATSSSGEVPEIVIK
 12.8   -0.98                   N.QGTKVAIVGESGSGK.S
 12.7   -0.02                   Q.IKDVREEISSLK.S
  2.9   -0.93                   V.SGLALNIQEQESK.E
  2.1   -0.96                   V.KDVEDALKTAEAK.Q
  1.8   -0.89                   M.QLENKPSQQTNK.R
  1.4   -0.92                   R.LQIQVDDSTGVIE.N
  1.1   -0.90                   K.WVEPGEVVSTNVT.S
  0.6   -0.02                   D.LQLYNSLLPDLK.E
  0.5    0.09                   K.WVEPGEVVSTNVT.S
Top scoring peptide matches to query 27
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.9    0.04    2  ABL063C G.GDVTFANNEHLTK.I
  7.7   -0.97               L.TQQQQQEAKQVK.A
  7.7   -0.97               L.TQQQQQEAKQVK.A
  6.7   -0.97               L.TQQQQQEAKQVK.A
  4.0   -0.03               S.TALFSATTIHLDR.L
  3.9   -0.01               T.SRPRADTAAMLEK.V
  2.3   -0.07               A.GITTLSQLRNSVR.S
  2.0   -0.13               Y.NLLQEFKLSLLK.F
  1.6    0.04               G.AAQADSAKQSNTPR.D
  1.4    0.04               L.ESRRATGPADEQK.L
Top scoring peptide matches to query 28
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.6    0.04        V.EMILMQQQMMAR.M
 12.6    0.04        V.EMILMQQQMMAR.M
 11.4    0.04        V.EMILMQQQMMAR.M
 10.5   -0.10        E.IKIGYQTANFQVK.S
  8.2    0.91        N.LLQMYKDMIVVR.R
  6.1   -0.04        S.QLQQQRQQPQAR.S
  5.9    0.93        R.KLMSDYKNLGDLI.S
  5.7   -0.04        K.NMLKAFDVSQMLL.C
  5.5    0.95        K.NMLKAFDVSQMLL.C
  5.2   -0.03        R.NKLWAHWSNQLN.N
Top scoring peptide matches to query 29
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.5   -0.05        R.AYQTSTLTLESTVT.L
  3.9    0.95        Y.PAVFQYCQLPYK.K
  3.9   -0.04        R.IENALRVAEEGGEE.E
  2.7    0.97        S.TENKSSSASTSSSIK.V
  2.2   -0.08        R.RPAPVQSRSASSMAA.P
  2.0   -0.07        S.LKWNGPIGDPDFR.R
  2.0    0.88        D.CGIALDGISSLRPR.Q
  1.7   -0.16        R.NNVNPRIGKYLLL.G
  1.7   -0.16        R.NNVNPRIGKYLLL.G
  1.7    0.84        R.QLWLAVRDVKTW.I
Top scoring peptide matches to query 30
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.0   -0.97        P.SEEPQAPASSEQGSK.K
  3.0   -0.11        K.GSVAGPKGAFVKVQDA.I
  2.6   -0.03        P.QSEKPTADWVVNR.Y
  0.8    0.02        R.NTLQHGSAFLSSHM.A
  0.6   -0.97        K.AGDNEVRGPNSALTQ.F
  0.6    0.96        G.VQQSAGAESWLPEK.Y
  0.5    0.96        F.IQQRQQDFSSHR.E
  0.2    0.93        K.VGSEIRVVGNDAGEK.L
  0.2   -0.99        K.KDFNSYCQKLIN.E
Top scoring peptide matches to query 31
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.6    0.06        K.TDKGQNFCRNEY.N
  9.4    0.92        E.SGSIGLEELIEQEK.D
  7.8   -0.10        M.ESVSIETSRAAGIGR.R
  6.9   -0.92        K.TDKGQNFCRNEY.N
  6.9   -0.06        E.SGSIGLEELIEQEK.D
  6.1    0.91        N.ENAVSAWKRSGGLR.S
  4.7    0.91        G.GSSDALLQVGSELVR.C
  4.4    0.94        L.KNKDDQLVNGSVGR.V
  3.2   -0.95        F.DSAQAYHNEDGVAR.G
  3.1    0.96        M.GSIQEQQNIRNRS.N
Top scoring peptide matches to query 32
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.2    0.91        G.SAITKATSLLTGQQK.L
 11.2    0.91        G.SAITKATSLLTGQQK.L
  9.4    0.99        P.SGKLDASAPSASISEK.L
  8.1   -0.96        G.SQATDEKTGLADGQK.R
  8.0    0.98        K.QRTGNSLAQLKATGT.T
  6.8   -0.01        K.QRTGNSLAQLKATGT.T
  4.9   -0.01        L.PSKLSMNNFQPRK.F
  3.8   -0.01        P.NLGSKLADTQDRTK.W
  3.5    0.98        P.NLGSKLADTQDRTK.W
  3.3    0.06        K.KAMNTGALSTGPDGDI.E
Top scoring peptide matches to query 33
Score greater than 35 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
108.2    0.02    2  ABL063C K.VGGDVTFANNEHLTK.I
 34.3   -0.97    2  ABL063C K.VGGDVTFANNEHLTK.I
 33.9   -0.97    2  ABL063C K.VGGDVTFANNEHLTK.I
 16.1   -0.04               R.KSLLSVLNAYGWHN.E
 15.3    0.14               K.NEWQAGQQEPPSTQ.Q
 15.1    0.10               N.NNVNNNGQQSTPPSK.L
 14.2    0.14               K.NEWQAGQQEPPSTQ.Q
 13.9    0.08               D.RDGDGEQPAQPFQR.R
 13.9    0.08               D.RDGDGEQPAQPFQR.R
 13.5    0.01               E.VDGRQLVSEPCVDK.G
Top scoring peptide matches to query 34
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7    0.91        K.HADGKVTGTDFVLNR.E
  1.2    0.86        R.GFSLVSGGTDTHLLLI.D
  0.6    0.07        R.NFSFPNTGDGTAAAQM.P
  0.6   -0.91        R.NFSFPNTGDGTAAAQM.P
Top scoring peptide matches to query 35
Score greater than 39 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
128.2    0.00    4  ABR025C K.LGGSTADALSAVVTDDGK.L
 18.2    0.01               L.RSAGNWSLGLQETEK.S
 10.7    0.95               D.QRIADARPESYTLR.L
 10.3   -0.06               R.AGHVSVLLNLAPKDADG.D
  9.7   -0.06               A.ENEVYGAKLWAGLVK.E
  9.0   -0.03               R.FAQVIDESLAVLQQL.S
  9.0   -0.02               K.KIEQYINIEKPNW.K
  7.8    1.00               L.RSAGNWSLGLQETEK.S
  7.7    0.90               K.TSLLRTLSTTGAVRAE.A
  7.6   -0.05               C.SSGSDISVGIVLAALCK.N
Top scoring peptide matches to query 36
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0    0.89               E.RNPQLLGDLGAEELR.A
  4.0    0.78               K.FVLVNTLQQKLHLK.C
  4.0    0.78               K.FVLVNTLQQKLHLK.C
  3.7   -0.96   13  ADL046C P.DNSNQLSGTNFANGIK.G
  3.7   -0.96   13  ADL046C P.DNSNQLSGTNFANGIK.G
  3.7   -0.96   13  ADL046C P.DNSNQLSGTNFANGIK.G
  3.4   -0.21               K.FVLVNTLQQKLHLK.C
  3.0    0.90               L.GLQIFYGDIDALSLR.E
  3.0    0.89               E.RNPQLLGDLGAEELR.A
  3.0   -0.09               E.RNPQLLGDLGAEELR.A
Top scoring peptide matches to query 37
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.0   -0.27        E.IVILSVADTGSSVKFTK.K
  4.0    0.77        K.NSINLRQKTTSQILF.D
  3.8   -0.27        A.ARQNAAALRVPLEVVR.A
  3.6    0.85        R.KANRAPAQNPIPVQQE.V
  3.3   -0.14        E.NMEQRSLSGLSSGSRR.V
  3.1    0.79        M.TYGGYGGPGQGAVPVKKK.F
  3.1    0.84        R.YPLEQAPGPPAQPLARG.A
  2.7    0.80        K.KVYLGSQYDGHLLAKA.K
  2.6    0.86        R.LEGAVPVSGTGGPGSPGPQV.P
  2.3    0.87        K.LFEKDQLNQQMIAGE.S
Top scoring peptide matches to query 38
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8   -0.32        D.IPNNLPTIGPSTHPPTK.N
  2.8   -0.32        K.QPVQPVPQSSTLVHGLP.L
  2.6   -0.30        K.LNGGRGWDLTINKKPN.L
  2.5    0.73        P.TDRLYKLTHCYTVL.-
  2.0    0.76        R.RANMGEMLTYLQEKV.P
  1.9   -0.22        R.RANMGEMLTYLQEKV.P
  1.9    0.66        K.LLNELKVLQDENIQL.E
  1.9    0.61        S.PVKDFTPVVSIIDKPK.G
  1.7   -0.29        K.RLTTIYNSAPRLFSGS.S
  1.7   -0.37        P.QLVDSLNVSVAAALLLR.S
Top scoring peptide matches to query 39
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.84        M.ILPSSRAAVLQTSGSSLP.S
  0.8    0.91        R.PKDPTLVKYHAACQR.G
  0.8   -0.08        R.PKDPTLVKYHAACQR.G
Top scoring peptide matches to query 40
Score greater than 25 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.8    0.17        L.QFNETYIADVTEEEK.L
 11.8    0.15        K.QQKQQQKQQEEQQE.E
  9.6    0.13        K.EQQRLQDNLQGLDISG.G
  8.6    0.17        K.AGYEIPGSSFDAQSMRT.F
  8.3   -0.83        R.QQQQQKQQQQKQQQ.Q
  8.3   -0.76        R.QQQQQQQQQQQQQQ.Q
  8.3    0.05        V.QFMLAGGLTPANVAEAAR.L
  7.9    0.15        K.QQKQQQKQQEEQQE.E
  7.7    0.04        L.QSYIRHRDQVQSTAK.E
  7.2   -0.94        L.QSYIRHRDQVQSTAK.E
Top scoring peptide matches to query 41
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0    0.87        S.AREQGTLSSLAEFRCK.R
  6.5    0.70        L.LGQQLAAGATALLSLASLR.F
  6.1    0.87        R.NRSKPRANSLLHDQQS.L
  5.8   -0.14        A.GTLPAGGQGGTFFERFGR.T
  5.6    0.85        S.SSAIVRGSGTKQQSGFNK.R
  5.6    0.85        S.SSAIVRGSGTKQQSGFNK.R
  3.6    0.88        H.ALQRAQDGDSANLDHLK.R
  3.4    0.87        R.ETPGVIAAAGTTGHRTWE.A
  3.4   -0.11        K.GTAEQRRQTFNLFING.L
  3.4    0.85        V.HARPTAHDSARADHRR.S
Top scoring peptide matches to query 42
Score greater than 29 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
102.9   -0.02    1  AFR711C K.LDYEQYVDVFYHFK.S
 10.2   -0.03               S.LDHNTCAFTMNLSTIK.R
  6.3    0.08               R.LNYQAQPLQQSSQQPQ.A
  5.7   -0.93               R.KQMMMDEYCQQVFK.V
  5.5   -0.05               W.QYMILDEAHNIKNFK.S
  5.4    0.05               R.KQMMMDEYCQQVFK.V
  4.0   -0.06               Y.LQAHAQGARRDSSPEDK.I
  3.5    0.93               W.QYMILDEAHNIKNFK.S
  3.4   -0.05               D.ESMLSIRTDSPAGYNPK.F
  3.2   -0.09               R.FVKSHIDQAVYFSQVP.N
Top scoring peptide matches to query 43
Score greater than 35 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
119.3   -0.04    1  AFR711C K.VTAPDCEALQSGMIVVSK.D
 15.1    0.79               G.NRPVLTLPHLMLSVVSK.C
 15.1   -0.19               G.NRPVLTLPHLMLSVVSK.C
  9.9    0.96               D.KAYPLLEQACALDPEGK.I
  8.7   -0.15               H.VTAAARVSLLPPRCHTR.R
  8.2   -0.02               V.ISKHVQDAYAQAEEVSK.K
  8.1   -0.08               I.SAIHGITFRNFSLPESK.T
  4.9   -0.03               L.VCLNVGMWNGRDELLK.E
  4.7   -0.03               G.EADDSMNRLAQKDGLLK.N
  4.3    0.97               A.DLTEQIARENDVRQSK.L
Top scoring peptide matches to query 44
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6    0.06        L.FGKSIYDFMCNNGNPR.F
  3.6    0.06        L.FGKSIYDFMCNNGNPR.F
  3.6    0.06        L.FGKSIYDFMCNNGNPR.F
  3.4    0.91        A.AGAAACVAVTFTNPIETVK.T
  3.2    0.03        A.NRGPDFNGPTNSGAQRTK.T
  1.9    0.96        R.SASSQAYTDALAHLKQDL.K
Top scoring peptide matches to query 45
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.1    0.70        K.KPQEILQNVQDLKKEI.N
  3.3   -0.28        K.KPQEILQNVQDLKKEI.N
  3.0    0.89        R.RSQLAQLAMKSDMSDEN.G
  2.0    0.74        P.SQHTQQPIVTGTSVIAMK.Y
  2.0    0.95        K.CGNHAVHMQQLQQQLE.S
  2.0    0.95        K.CGNHAVHMQQLQQQLE.S
  1.8    0.94        R.LGALNQNDSGNNSQNASGY.N
  1.7    0.69        L.LGQQALEGRRVPVMVSGK.T
  1.7    0.69        L.LGQQALEGRRVPVMVSGK.T
  1.7    0.70        K.KPQEILQNVQDLKKEI.N
Top scoring peptide matches to query 46
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.0   -0.02        K.FTQEEQDAIVNYVAPSK.E
 11.0   -0.02        K.FTQEEQDAIVNYVAPSK.E
  9.5   -0.05        A.AKSFDDMNYFLSKFVK.D
  9.4    0.96        K.FTQEEQDAIVNYVAPSK.E
  8.1    0.92        K.LIFNCLNDFLLLDSQL.T
  7.8   -0.22        R.ILQLRNNPLLKDQFVK.Q
  7.8   -0.22        R.ILQLRNNPLLKDQFVK.Q
  7.8   -0.22        R.ILQLRNNPLLKDQFVK.Q
  7.8   -0.21        -.MRIAATFSLLFLAIFQV.S
  7.8    0.83        R.RDAIHTPSLKGQYVELL.Q
Top scoring peptide matches to query 47
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.4    0.87        R.LFIMDLTAQGTMVESNSF.L
  8.3    0.73        G.LSCQRSTVTNPTLKLMR.Q
  8.3   -0.26        G.LSCQRSTVTNPTLKLMR.Q
  5.3   -0.12        I.NQRTEEVNAQNEAQMLK.K
  5.3   -0.12        I.NQRTEEVNAQNEAQMLK.K
  4.2    0.73        K.EFTAQRTSIVRELHVYG.S
  4.2    0.87        I.NQRTEEVNAQNEAQMLK.K
  4.2   -0.12        I.NQRTEEVNAQNEAQMLK.K
  4.2   -0.12        I.NQRTEEVNAQNEAQMLK.K
  4.0   -0.20        K.FRCSVCYVTVVLQGTAF.T
Top scoring peptide matches to query 48
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8   -0.15        V.ATPHQFPRGVNFNVQIAGK.-
  1.7   -0.15        V.ATPHQFPRGVNFNVQIAGK.-
  1.7   -0.15        V.ATPHQFPRGVNFNVQIAGK.-
  1.2   -0.15        V.ATPHQFPRGVNFNVQIAGK.-
Top scoring peptide matches to query 49
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5    0.85        K.NTLPWTKEYMNGAFDNW.A
  1.0    0.72        K.LNLLCHNSSDPAASKLAFK.A
  0.3   -0.31        S.LNKLEKDIAQWVAESSEK.G
  0.1    0.76        R.IPQEIKASGVNQSLDTNAGGS.L
  0.1    0.76        R.IPQEIKASGVNQSLDTNAGGS.L
  0.1    0.76        R.IPQEIKASGVNQSLDTNAGGS.L
Top scoring peptide matches to query 50
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 55.5   -0.13    4  ABR025C S.SSPYELTLEQPGATSISVALR.A
  8.3   -0.10               Y.DRSVALQHYSSQQPFVISR.A
  5.4   -0.03               R.DQQFFNKKYLQDLCTNR.L
  4.3   -0.04               G.EQSEAESMQALRQELEALR.L
  4.1   -0.18               L.HLLREELQLNVLQIQNVR.R
  3.8    0.02               L.QNNLNSASVELRDDLENER.E
  2.4   -0.13               D.LEELKQNTDGAEFIGNLSLK.I
  2.2   -0.08               R.HEARQRLESYVSSIEQTVS.D
  2.1   -0.12               E.SSLKTLESRQLLEQNVQNK.V
  1.8    0.02               L.QNNLNSASVELRDDLENER.E
Top scoring peptide matches to query 51
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 29.5   -0.14    3  mAGL352W-NN R.ADFYGFNVYSWCGDSSFEK.S
  0.0   -0.21    7  ADL021W     R.FNTECSYNANYLQHVFATV.D
Top scoring peptide matches to query 52
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8   -0.53        R.NILESVTLLARPGEMVLVLGR.P
  2.1    0.61        H.PVKAFVDSGAQSTIMSTALAER.T
  1.9    0.75        K.ASSSNPSIQSSSSSALAQGQQQQ.F
  0.8   -0.32        L.DVVFTSIQDQFLQEVPEQR.L
  0.3    0.52        R.EIKISLDGKPAPLNLPEGQLF.F
  0.3   -0.46        R.EIKISLDGKPAPLNLPEGQLF.F
  0.1   -0.49        F.VITLAPSQRPTGINSPSSATRK.I
Top scoring peptide matches to query 53
Score greater than 27 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 68.1   -0.17    5  AEL111C L.SGSFYNLYDENIAPQCSPIK.L
 10.2   -0.23               S.FLDKAVENEDGILEGAEDLPK.V
  7.5   -0.30               H.NKDASALFVDNGGLEIMAPVLK.H
  4.5   -0.21               R.DLQRLMIEQQDHRYQESL.R
  4.5    0.68               D.CDARTLLQLFLAALQTDPQK.T
  4.0   -0.24               E.DGLSIIETAQQVNVFVQDPAR.V
  4.0   -0.24               E.DGLSIIETAQQVNVFVQDPAR.V
  3.9   -0.21               R.DLQRLMIEQQDHRYQESL.R
  3.9    0.74               E.DGLSIIETAQQVNVFVQDPAR.V
  3.3   -0.16               F.AGDQRLSGEVNEDTTPDLQQK.Y
Top scoring peptide matches to query 54
Score greater than 29 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 68.1   -0.16    6  ADR019C K.LLAGNFPTEADYEAIDFETVK.N
 12.2   -0.18               R.LLQAGDFQPLEDADIQEVVQL.L
  3.2    0.79               F.LLVEGSRIDHAAHQNDPAAQAK.E
  1.6    0.02               R.LEDPGQSSAEDGGTAGEQEYTMA.A
  0.6   -0.19               F.LLVEGSRIDHAAHQNDPAAQAK.E
  0.6   -0.19               F.LLVEGSRIDHAAHQNDPAAQAK.E
  0.4   -0.10               F.IHNEYINGNAASSLHNESLEK.F
  0.3   -0.06               A.AGAVRAACDAEGLEGCDAHAWR.W
Top scoring peptide matches to query 55
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 56
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
128.2    0.01    3  mAGL352W-NN K.CMMDALSCVVNDSVDKEDYGK.L
 96.1   -0.97    3  mAGL352W-NN K.CMMDALSCVVNDSVDKEDYGK.L
  3.1   -0.22                   F.EELLRDNFGVHFEKLADIYK.D
Top scoring peptide matches to query 57
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 58
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 59
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8    0.64        R.ETTFDAQLQQMRQQEAGNSSDTI.L
Top scoring peptide matches to query 60
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4   -0.53        G.ISGNDFETEVDELSFNCYVNNVFR.V
  0.0    0.46        R.ELINAYEEENCPQEQLKKMQLQQ.R
  0.0    0.46        R.ELINAYEEENCPQEQLKKMQLQQ.R
Top scoring peptide matches to query 61
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 62
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8    0.55        A.EPGVAGGFCLFSNVAVAAQNILKNYPESVRR.V
  0.8    0.71        R.LEGEGVNHVSISDTNGLLSVSMESNVVEFWD.P
  0.7    0.30        K.VVVQPQVPSELPKLLDGLNLVHKLYPGAVIK.V
  0.7    0.30        K.VVVQPQVPSELPKLLDGLNLVHKLYPGAVIK.V
  0.7    0.30        K.VVVQPQVPSELPKLLDGLNLVHKLYPGAVIK.V
  0.4    0.70        C.TADTPQAEYECAPPPGRGHLVEPQFPTEDR.S
  0.1    0.64        R.CILDIXVPPANFKCIIRSPTFMLADDCSN.M
  0.1    0.46        R.ILSKLGELGELPSTREQFPDVDPQVVLSALN.S
Top scoring peptide matches to query 63
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 64
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 65
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 66
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 67
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 68
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 69
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide