Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0420_q1.pkl
Database        : Ashbya Ashbya (4796 sequences; 2346673 residues)
Timestamp       : 25 Jul 2007 at 11:41:40 GMT
Significant hits: mAGL352W-NN  Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); 
                  AEL111C      415421:416467,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C; Inve
                  ABR025C      440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
                  AFR711C      1745290:1746975,reverse,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
                  AER058W      746106:746834,forward,Syntenic homolog of Saccharomyces cerevisiae YLR390W-A (CCW14)
                  mAEL103W     Pir protein,Syntenic homolog of Saccharomyces cerevisiae YJL158C (CIS3), YKL164C (PIR1) and YKL163W
                  ABL063C      282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 41 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mAGL352W-NN                       Mass: 56261    Score: 296    Queries matched: 4
 Gas-family,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1);
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   535.22   1068.42   1068.43   -0.01 0  31  0.49 1  Y.FACGSNEER.A
14   663.28   1324.55   1324.54   0.01 0  42  0.043 1  K.GEYGAFSYCSGK.E
18   708.89   1415.76   1415.75   0.01 0  70  8.1e-005 1  -.ATSSSGEVPEIVIK.G
50   812.67   2434.99   2435.01   -0.02 1  160  7.4e-014 1  K.CMMDALSCVVNDSVDKEDYGK.L

 
      Proteins matching the same set of peptides:
      AGL352W                           Mass: 58032    Score: 295    Queries matched: 4
 47585:49186,forward,Syntenic homolog of Saccharomyces cerevisiae YMR307W (GAS1); Tandem gene duplic

2.    AEL111C                           Mass: 35909    Score: 266    Queries matched: 6
 415421:416467,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C; Inve
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   407.22   812.42   812.49   -0.06 0  44  0.018 1  R.IGAIVANR.Q
20   491.22   1470.65   1470.69   -0.04 1  32  0.53 1  K.HDSKDPVTAVSCR.S
26   881.41   1760.81   1760.84   -0.03 0  56  0.0019 1  Y.NLYDENIAPQCSPIK.L
31   917.92   1833.83   1833.90   -0.08 0  83  3.9e-006 1  R.QFQFDGPPPQAGAIYAK.G
48   1151.94   2301.86   2302.06   -0.20 0  56  0.0019 1  L.SGSFYNLYDENIAPQCSPIK.L
67   1376.75   4127.23   4127.92   -0.70 1  1  3.8e+002 1  D.VFYQCLSGSFYNLYDENIAPQCSPIKLQAIDLVTC.- + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      mAEL111C                          Mass: 33442    Score: 266    Queries matched: 6
 Pir protein,Syntenic homolog of Saccharomyces cerevisiae YKL163W (PIR3) and YJL160C;
3.    ABR025C                           Mass: 20232    Score: 205    Queries matched: 6
 440619:441236,reverse,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1); Tandem gene quad
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   384.17   766.33   766.40   -0.07 0  36  0.13 1  S.TGFSISR.G
30   908.39   1814.77   1814.80   -0.03 0  26  1.9 1  A.SMYHMSSVFEDNGALK.L
38   987.40   1972.79   1972.87   -0.08 0  42  0.043 1  R.SASMYHMSSVFEDNGALK.L
45   1109.99   2217.97   2218.15   -0.18 0  57  0.0013 1  S.SSPYELTLEQPGATSISVALR.A
52   1229.43   2456.85   2457.13   -0.28 0  42  0.047 1  K.GNSGFYPVGSSSPYELTLEQPGAT.S
56   1101.43   3301.26   3301.51   -0.24 1  2  3.3e+002 1  A.DSEAFYFLSIRSASMYHMSSVFEDNGALK.L

 
      Proteins matching the same set of peptides:
      mABR025C                          Mass: 18217    Score: 205    Queries matched: 6
 hom. to Cwp1p,Syntenic homolog of Saccharomyces cerevisiae YKL096W (CWP1);
4.    AFR711C                           Mass: 58053    Score: 179    Queries matched: 3
 1745290:1746975,reverse,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   522.77   1043.53   1043.53   -0.00 0  27  1.5 1  K.FSAPAPETPK.S
22   819.38   1636.75   1636.76   -0.01 0  46  0.018 1  D.YEQYVDVFYHFK.S
35   952.94   1903.87   1903.94   -0.06 0  110  7e-009 1  K.VTAPDCEALQSGMIVVSK.D

 
      Proteins matching the same set of peptides:
      mAFR711C                          Mass: 55938    Score: 179    Queries matched: 3
 weak sim. with Fig2,Non-syntenic homolog of Saccharomyces cerevisiae YCR089W (FIG2)
5.    AER058W                           Mass: 22944    Score: 121    Queries matched: 1
 746106:746834,forward,Syntenic homolog of Saccharomyces cerevisiae YLR390W-A (CCW14)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
25   871.88   1741.75   1740.79   0.96 0  122  4.3e-010 1  K.ESSHPLNDVAHFCTK.E

 
      Proteins matching the same set of peptides:
      mAER058W                          Mass: 20648    Score: 121    Queries matched: 1
 Hom. to Ssr1/Ccw14,Syntenic homolog of Saccharomyces cerevisiae YLR390W-A (CCW14)
6.    mAEL103W                          Mass: 18618    Score: 69     Queries matched: 2
 Pir protein,Syntenic homolog of Saccharomyces cerevisiae YJL158C (CIS3), YKL164C (PIR1) and YKL163W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   407.22   812.42   812.55   -0.13 1  15  15 9  P.IKLQAIK.L
 26   881.41   1760.81   1760.84   -0.03 0  56  0.0019 1  Y.NLYDQNIAPQCSPIK.L + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      AEL103W                           Mass: 18618    Score: 69     Queries matched: 2
 Pir protein,Syntenic homolog of Saccharomyces cerevisiae YJL158C (CIS3), YKL164C (PIR1) and YKL163W
7.    ABL063C                           Mass: 42563    Score: 61     Queries matched: 1
 282533:283695;283763:283823,reverse,Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) an
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   653.34   1304.67   1305.64   -0.97 0  64  0.00027 1  K.TVGNSLALSSNDK.I + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      mABL063C                          Mass: 40673    Score: 61     Queries matched: 1
 Syntenic homolog of Saccharomyces cerevisiae YBR078W (ECM33) and YDR055W (PST1); 1-intron
8.    AFL121W                           Mass: 94569    Score: 37     Queries matched: 1
 209373:211949,forward,Non-syntenic homolog of Saccharomyces cerevisiae YBL022C
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   407.22   812.42   812.52   -0.10 1  39  0.058 2  Q.LGAIVRGK.I

9.    ADL021W                           Mass: 50313    Score: 31     Queries matched: 2
 671422:672810,forward,Non-syntenic homolog of Saccharomyces cerevisiae YOL030W
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
32   922.38   1842.74   1842.78   -0.04 0  28  1.2 1  R.VLAAQYFNCGDDEDAR.I
49   1217.93   2433.84   2433.14   0.70 0  8  1.1e+002 1  R.GVDYQPGGTGELVDPLADTEICK.R

 
      Proteins matching the same set of peptides:
      mADL021W                          Mass: 48492    Score: 31     Queries matched: 2
 Gas-family,forward,Non-syntenic homolog of Saccharomyces cerevisiae YOL030W
10.   AGR099C                           Mass: 34550    Score: 28     Queries matched: 1
 924372:925289,reverse,Syntenic homolog of Saccharomyces cerevisiae YDR106W (ARP10)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   407.22   812.42   812.54   -0.11 1  28  0.78 3  R.LKIVVLE.N

11.   ABR161C                           Mass: 44223    Score: 28     Queries matched: 1
 705053:706273,reverse,Syntenic homolog of Saccharomyces cerevisiae YJR105W (ADO1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   407.22   812.42   812.49   -0.06 0  28  0.81 5  F.VAALVQGR.D

12.   ADR065W                           Mass: 94874    Score: 26     Queries matched: 1
 822102:824639,forward,Syntenic homolog of Saccharomyces cerevisiae YBL101C (ECM21) and YPR030W (CSR
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   407.22   812.42   812.52   -0.10 1  28  0.78 3  K.IKLVPLM.K

13.   ACL006W                           Mass: 81389    Score: 22     Queries matched: 1
 344395:346521,forward,Syntenic homolog of Saccharomyces cerevisiae YMR001C (CDC5)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 26   881.41   1760.81   1760.68   0.12 0  25  2.3 6  K.NSNNNNNQINQNNEQ.L + 3 Deamidation (NQ)

14.   AGR138W                           Mass: 51154    Score: 22     Queries matched: 1
 1008752:1010266,forward,Syntenic homolog of Saccharomyces cerevisiae YDR077W (SED1) and YER150W (SP
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   523.28   1044.55   1045.52   -0.96 0  24  3.1 1  A.ASDQNSVIGR.R

 
      Proteins matching the same set of peptides:
      mAGR138W                          Mass: 49333    Score: 22     Queries matched: 1
 sim. to ScSed1,Syntenic homolog of Saccharomyces cerevisiae YDR077W (SED1) and YER150W (SPI1)
15.   AFR412C                           Mass: 49524    Score: 18     Queries matched: 1
 1173600:1174919,reverse,Syntenic homolog of Saccharomyces cerevisiae YHR011W (DIA4)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   407.22   812.42   812.49   -0.06 0  18  7.7 6  P.LAGLGLNR.T

16.   ABL205C                           Mass: 49226    Score: 18     Queries matched: 1
 22832:24187,reverse,Syntenic homolog of Saccharomyces cerevisiae YNL240C (NAR1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   407.22   812.42   812.46   -0.04 1  18  7.8 7  G.LGPSQRR.D

17.   AGR112C                           Mass: 70913    Score: 18     Queries matched: 1
 948295:950166,reverse,Syntenic homolog of Saccharomyces cerevisiae YER173W (RAD24)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 25   871.88   1741.75   1740.87   0.88 1  19  10 3  R.ESSLNYFHAIGKVIY.G + Deamidation (NQ)

18.   AGR167W                           Mass: 57775    Score: 17     Queries matched: 1
 1059796:1061334,forward,Non-syntenic homolog of Saccharomyces cerevisiae YGL202W (ARO8)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   384.17   766.33   766.40   -0.07 0  19  6.9 2  R.FASSLSR.S

19.   AAL028W                           Mass: 116764   Score: 16     Queries matched: 2
 291808:294942,forward,Syntenic homolog of Saccharomyces cerevisiae YLR249W (YEF3) and YNL014W (HEF3
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   535.22   1068.42   1067.50   0.93 1  13  33 2  K.FDAMGNKIAT.G + Deamidation (NQ)
 25   871.88   1741.75   1740.88   0.87 2  9  84 9  K.QKAIVKVSNMSFQYP.G + 2 Deamidation (NQ)

20.   AER358C                           Mass: 80747    Score: 16     Queries matched: 1
 1295961:1298126,reverse,Syntenic homolog of Saccharomyces cerevisiae YGL205W (POX1)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   637.33   1272.66   1272.77   -0.11 1  19  9.4 1  P.ESVSKLLVSIAK.F

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   684.83   1367.65   1367.68   -0.03 0  17  13 1  GIDNAVAPAPWTR + Deamidation (NQ)
29   897.90   1793.78   1793.89   -0.11 1  16  20 1  LVSFQNSGVSVEDRTR + Deamidation (NQ)
19   714.83   1427.64   1427.66   -0.02 1  15  23 1  QHPNFGGEVWRT + Deamidation (NQ)
11   629.82   1257.63   1257.68   -0.06 2  15  24 1  TPQRRLQPYV + Deamidation (NQ)
15   663.82   1325.63   1326.58   -0.96 0  14  25 1  GFFAGNEVTNDR + Deamidation (NQ)
24   846.87   1691.73   1690.88   0.85 1  14  28 1  LARHFNASFLETSAK
5   453.70   905.39   905.50   -0.11 1  13  37 1  KPPPGKANP + Deamidation (NQ)
21   815.87   1629.72   1628.87   0.85 1  13  43 1  NPIWVVNTRMTVAK + Deamidation (NQ)
40   1041.95   2081.88   2082.06   -0.18 1  12  52 1  ATPHQFPRGVNFNVQIAGK + 2 Deamidation (NQ)
4   437.69   873.37   873.45   -0.08 0  10  74 1  HNTAIYR
1   634.31   633.30   634.30   -1.00 0  9  95 1  DPEFK
7   501.73   1001.45   1001.51   -0.06 2  8  1.1e+002 1  NVDPTKKSN
33   933.40   1864.80   1864.93   -0.13 0  8  1.2e+002 1  LFMQNPFVTDNLIAQL + 2 Deamidation (NQ)
51   1221.87   2441.72   2441.05   0.67 2  8  1.2e+002 1  GEDNTASVCTADSRITDDKVDAT + Deamidation (NQ)
6   493.74   985.46   985.39   0.07 0  8  1.2e+002 1  NVNAGDMHQ + Deamidation (NQ)
43   1059.38   2116.75   2116.93   -0.19 1  8  1.3e+002 1  CTGDCFVHSGVYEQFKLA
37   970.88   1939.75   1939.99   -0.25 0  6  1.7e+002 1  LVAEELQALLPDLQCAR + 2 Deamidation (NQ)
34   942.38   1882.75   1882.91   -0.15 1  6  2.1e+002 1  LDSAPSFVRFNNDSTIT
46   1125.87   2249.73   2250.22   -0.49 2  5  2.1e+002 1  ILNVLSQGKINGHLINMWKA + 2 Deamidation (NQ)
41   1044.88   2087.74   2087.93   -0.19 0  5  2.3e+002 1  QEPEGQHQSILASGNALSGY + 3 Deamidation (NQ)
17   685.82   1369.63   1368.72   0.91 2  5  2.4e+002 1  GERGPVERSAVGR
39   1008.88   2015.74   2014.98   0.76 1  4  2.9e+002 1  ELEDVSANIVKNAQSFHL + 2 Deamidation (NQ)
27   889.87   1777.73   1778.00   -0.28 2  4  3.1e+002 1  GSAVAAQLIAHKLKNEK + Deamidation (NQ)
57   1107.39   3319.15   3319.86   -0.71 1  3  2.7e+002 1  LFPLLPLLCSQLLLKPELQQVLRDESTR + Deamidation (NQ)
36   960.94   1919.86   1920.10   -0.24 2  3  3.7e+002 1  RSSTEVPGRLRPSLLPR
23   841.35   1680.69   1679.79   0.90 0  3  3.7e+002 1  LDITFSQMPCELLN
54   1302.84   2603.67   2604.20   -0.53 1  3  3.6e+002 1  IRYQSSFTFNDNASLLAEEQAAE + Deamidation (NQ)
28   595.61   1783.81   1782.92   0.89 2  3  3.9e+002 1  PKDPTLVKYHAACQR
58   1122.73   3365.17   3364.71   0.47 2  3  3.1e+002 1  PLSEKIYIGDVLGLAESDKLDEDASNWIFK
47   762.06   2283.15   2282.19   0.96 2  3  4e+002 1  WAQLDHSPHHKRSIDTLLK + Deamidation (NQ)
42   1050.94   2099.88   2100.12   -0.25 1  2  4.5e+002 1  IVPVTGERPKPKNNEPPLD + Deamidation (NQ)
55   1434.84   2867.67   2868.35   -0.68 2  1  4.9e+002 1  LTSDQLHCLDLKYGENDLTFSVDKG + Deamidation (NQ)
59   1176.73   3527.16   3527.81   -0.66 1  1  4.6e+002 1  HEVSGLSELTAPWPGQQLIADAEAIPARTLSLGV + 2 Deamidation (NQ)
44   1061.43   2120.84        
53   1272.90   2543.78        
60   1180.06   3537.17        
61   1230.72   3689.13        
62   1278.71   3833.11        
63   1291.05   3870.12        
64   1308.71   3923.11        
65   1332.70   3995.07        
66   1376.05   4125.13        
68   1418.06   4251.17        
69   1480.69   4439.04        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1 Da
Fragment Mass Tolerance: ± 0.2 Da
Max Missed Cleavages   : 2
Instrument type        : ESI-QUAD-TOF
Number of queries      : 69

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 22 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.4   -1.00        DPEFK
  9.4   -1.00        DPFEK
  9.4   -0.96        K.DPFQQ.M
  9.4   -0.01        W.GGPQFK.R
  9.4    0.95        H.IPEFK.D
  9.4    0.95        E.IPFEK.L
  9.4    0.95        LPEFK
  9.4    0.95        V.LPFEK.E
  9.4    0.95        S.LPFQK.V
  9.4    0.91        LPIYK
Top scoring peptide matches to query 2
Score greater than 33 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.7   -0.07    3  ABR025C S.TGFSISR.G
 18.6   -0.07   18  AGR167W R.FASSLSR.S
 17.9   -0.06               V.TGFISNK.D
 15.4   -0.03               R.TFGRANT.E
 15.1   -0.04               K.TGFGCIL.N
 13.0   -0.03               R.TGFTGER.W
  9.6   -0.04               R.FNSIWT.I
  9.4   -0.05               C.FNLSMR.G
  9.4    0.01               R.TGQCSLT.L
  8.8   -0.06               L.ASFLSNK.K
Top scoring peptide matches to query 3
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 44.2   -0.06    2  AEL111C  R.IGAIVANR.Q
 39.1   -0.10    8  AFL121W  Q.LGAIVRGK.I
 27.8   -0.10   12  ADR065W  K.IKLVPLM.K
 27.8   -0.11   10  AGR099C  R.LKIVVLE.N
 27.6   -0.06   11  ABR161C  F.VAALVQGR.D
 17.8   -0.06   15  AFR412C  P.LAGLGLNR.T
 17.8   -0.04   16  ABL205C  G.LGPSQRR.D
 16.1    0.97                T.AVAAQVPR.L
 14.9   -0.11                K.IKLDLVL.E
 14.9   -0.13    6  mAEL103W P.IKLQAIK.L
Top scoring peptide matches to query 4
Score greater than 23 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.4   -0.08        T.HNTAIYR.F
 10.4   -0.10        A.HRRSYR.V
 10.4   -0.11        E.HVTKAYR.Y
  9.6   -0.04        A.DGLHNYR.R
  6.8    0.91        I.FALGFYR.A
  5.9    0.89        M.LLPDPYR.T
  4.5   -0.08        L.GHQLTYR.D
  3.9    0.89        S.EPVIPYR.E
  3.9    0.89        D.IPDIPYR.H
  3.9    0.88        F.VPNKPYR.Q
Top scoring peptide matches to query 5
Score greater than 25 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.9   -0.11        K.KPPPGKANP.K
 12.3   -0.03        R.EQATGSRAS.S
 11.9   -0.05        F.GSVVSSANGK.A
 11.8   -0.02        R.QSSVTAEAGG.H
 11.3   -0.02        P.SADGSVGQGK.E
 10.9    0.00        R.QWSNDQK.D
 10.8    0.88        K.KPPPGKANP.K
 10.6   -0.07        I.KQYQDPK.K
 10.5   -0.14        Q.FKGSQVIK.S
 10.3   -0.01        T.EDITDADK.A
Top scoring peptide matches to query 6
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.7    0.07        K.NVNAGDMHQ.L
  7.7   -0.92        K.NVNAGDMHQ.L
  7.7    0.07        K.NVNAGDMHQ.L
  7.7   -0.92        K.NVNAGDMHQ.L
  4.3   -0.05        K.QPSVLLTDN.F
  1.2    0.03        L.APTCGSEHK.Q
  1.1    0.89        V.LRAAVQEAK.G
  0.9   -0.92        K.DQQSLEQH.G
  0.7   -0.05        K.QGITRFHQ.G
  0.4   -0.96        R.ENEFATIY.L
Top scoring peptide matches to query 7
Score greater than 20 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.4   -0.06        R.NVDPTKKSN.I
  7.4    0.95        M.LNTTPINID.A
  6.4   -0.16        K.KLLATLKSQ.K
  5.8   -0.10        L.AVASPTTTVR.E
  4.5    0.83        K.KLLATLKSQ.K
  4.2   -0.01        R.LGGDRPVEC.K
  3.7   -0.01        K.ADNLLLDND.G
  3.7   -0.05        K.LIKDGINDN.Q
  3.3    0.93        K.LIKDGINDN.Q
  3.2    0.89        R.RATVVTLQN.I
Top scoring peptide matches to query 8
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 27.2   -0.00    4  AFR711C K.FSAPAPETPK.S
  7.2    0.95               G.QKAVSPQASK.T
  2.3   -0.03               K.ERILALGGNT.G
  1.4    0.07               I.YAMSSKDDK.A
  1.1    0.88               L.RKISTITPK.D
  0.8   -0.94               -.MHDALSRDT.A
  0.7   -0.02               K.GALVLELNSE.E
  0.6   -0.03               K.KLVNNADRL.A
  0.6    0.94               F.ARGQEKLNK.N
Top scoring peptide matches to query 9
Score greater than 25 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.3   -0.96   14  AGR138W ASDQNSVIGR
 11.3    0.91               R.KPVFEVVVK.I
 10.2    0.97               V.NPFLEVGIR.S
 10.2   -0.01               V.NPFLEVGIR.S
  9.2   -0.94               V.SPCFPPDVK.T
  9.1    0.97               R.YKVVLHSAQ.K
  9.0   -0.97               G.AAGQEVVNMK.L
  9.0    0.95               A.GSFPTVPLVK.K
  8.1   -0.07               A.LAGILSEKSK.Q
  7.7    0.01               K.IVNNMIDAR.S
Top scoring peptide matches to query 10
Score greater than 27 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 30.8   -0.01    1  mAGL352W-NN Y.FACGSNEER.A
 12.5    0.93   19  AAL028W     K.FDAMGNKIAT.G
 10.0   -0.02                   R.FALNDDAMAT.E
  7.7    0.93                   D.AFTIQQCAK.Y
  7.5   -0.06                   K.FATDWNKST.R
  6.6   -0.14                   R.AFTSGLGKAAF.F
  6.4    0.95                   R.STDTSNASSAK.G
  5.0   -0.08                   R.SYQGSQPRF.L
  4.0    0.91                   R.TFQGTSNIAK.S
  3.6    0.96                   E.ESSTTQDTAK.T
Top scoring peptide matches to query 11
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.0   -0.06        R.TPQRRLQPYV.L
  8.3   -0.04        G.TNMINGVPVAIK.F
  7.2   -0.01        R.AVTGIIHNFGQT.P
  6.8   -0.02        K.TPAISGTIQEEL.W
  6.1   -0.99        R.AVTGIIHNFGQT.P
  4.6   -0.03        K.TKPDPKNSDKK.L
  4.2   -0.14        S.KLVTLAQTEKK.G
  3.6    0.00        R.LAEQPITASMTP.E
  3.2   -0.08        S.KVLEGAERAASK.R
  2.6    0.00        Y.GTYIAINEYSK.R
Top scoring peptide matches to query 12
Score greater than 30 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.3   -0.11   20  AER358C P.ESVSKLLVSIAK.F
 16.1    0.96               P.IAEESLVVNLGK.L
 15.4   -0.06               G.IVAAMKQAQLAK.A
 15.2    0.07               Y.GANADPNTLAEAK.R
 15.0   -0.01               R.EANLNSLVRVTG.V
 14.9   -0.04               A.QRHQLTPPPAK.E
 13.8   -0.11               V.ISTIQSLLTGIK.Q
 12.7    0.01               L.DGSGANGAALGGKAK.K
 11.8   -1.00               F.DSEAEVLDRLK.E
 11.5   -0.01               L.EDAGTLRAELAK.I
Top scoring peptide matches to query 13
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 64.4   -0.97    7  ABL063C K.TVGNSLALSSNDK.I
 50.3    0.01    7  ABL063C K.TVGNSLALSSNDK.I
  9.2   -0.97               V.VTGDMFVDGLPR.G
  6.3   -0.97    7  ABL063C K.TVGNSLALSSNDK.I
  6.2   -0.97               I.TVGGSKNEIGESK.A
  5.7    0.98               R.KSIELAIENSIS.T
  4.9   -0.99               R.SQKDPSRILFD.G
  4.7   -0.89               R.AEGNDMAESGRAV.F
  4.5   -0.90               R.RTNNEQDTTKP.A
  4.1    0.04               D.ISNEMGQSLTPK.C
Top scoring peptide matches to query 14
Score greater than 27 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 42.1    0.01    1  mAGL352W-NN K.GEYGAFSYCSGK.E
 12.3   -0.03                   R.YWKDDNLQEL.S
  5.8   -0.03                   R.WYGARADENPF.R
  5.6    0.97                   R.TSQADSQSVASTAA.S
  4.9    0.02                   K.FQELNLGDDSEG.Q
  3.7   -0.15                   L.GTQYKLNLPYK.L
  3.6   -0.07                   F.QGYKSETEINR.L
  3.3    0.96                   N.ANSFTPNADGTTK.R
  2.9   -0.08                   K.CYIVATNDAGLK.Q
  1.9   -0.11                   R.EYGTQILVAFGAG.I
Top scoring peptide matches to query 15
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.3   -0.96        L.GFFAGNEVTNDR.T
  7.3    0.04        K.YEELMVLPMSN.R
  6.6    0.97        R.GYSLAQRNRYP.M
  6.6    0.97        R.GYSLAQRNRYP.M
  6.0   -0.96        L.GFFAGNEVTNDR.T
  5.9    0.95        K.YGSLRKVPGYGE.S
  3.2    0.95        D.YGSCKLVENKK.V
  0.9    0.96        S.CVCFMLLIAAK.E
  0.8    0.09        R.QRENDDLFSDS.D
  0.7    0.95        G.KQYGLQVGFQR.Y
Top scoring peptide matches to query 16
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.2   -0.03        T.GIDNAVAPAPWTR.L
 10.3    0.02        R.TTVQPGPGAGGNNTP.T
  8.9    0.03        R.SETYAEESRVPT.V
  8.1    0.07        K.STLGNPANYPFAN.I
  3.5    0.90        L.PSTNGLAPPKTRK.S
  2.9   -0.08        R.AVKDPEVAAILQD.P
  2.6   -0.91        R.AWSAGGTPEFTMD.Q
  2.5    0.11        K.SEFYNSYLETN.M
  2.4   -0.07        S.QTLESLRQHTR.N
  2.3    0.82        A.LLFALAAGHLLTK.R
Top scoring peptide matches to query 17
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.7    0.91        V.GERGPVERSAVGR.G
  4.5    0.05        K.ERNMLQSNYVD.L
  2.9    0.93        R.VHSSAPEHPRRP.P
  2.3    0.96        W.VLWDIFNCFR.S
  2.1    0.99        R.RHTSNGIGPSSAGQ.Q
  1.1   -0.11        L.VKPSAALYQQHK.D
  1.1   -0.11        L.VKPSAALYQQHK.D
  0.8   -0.04        E.LPESAEKDAQGPK.K
  0.5    0.93        F.EHGLFPLIDNSK.N
  0.5    0.88        K.LLPGTKVLLQDGD.Q
Top scoring peptide matches to query 18
Score greater than 30 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
 69.8    0.01    1  mAGL352W-NN ATSSSGEVPEIVIK
 13.4   -0.04                   Q.IKDVREEISSLK.S
 11.9    0.14                   A.SEHADASVESGEAK.I
 10.2   -1.00                   N.QGTKVAIVGESGSGK.S
 10.0   -0.04                   R.IKTELLVQWSSL.T
  8.1   -0.90                   K.MESSIFGNYLSGL.K
  8.0   -0.84                   N.EDSNKTSYGSSNK.N
  3.3    0.03                   K.HARASPQPAAADKP.Q
  3.3   -0.05                   P.GGTKRVTALADSLK.I
  2.6   -0.03                   E.LLNNKLLGDSTVK.A
Top scoring peptide matches to query 19
Score greater than 26 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.0   -0.02        K.QHPNFGGEVWRT.V
 14.9    0.97        K.QHPNFGGEVWRT.V
 14.7    0.04        R.KMMSFQSNPTEE.T
 14.5   -0.00        V.EFHNPDLNASQR.D
 12.7    0.98        K.TDFLFTNNLLDN.V
 11.1   -0.02        K.QHPNFGGEVWRT.V
  8.9    0.88        W.QFLAVDEAHRLK.N
  7.8   -0.00        K.TDFLFTNNLLDN.V
  6.6   -0.03        H.YLSNYPPYSPAR.R
  6.2   -0.00        K.ATAAQHNQENFTP.T
Top scoring peptide matches to query 20
Score greater than 25 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 31.5   -0.04    2  AEL111C K.HDSKDPVTAVSCR.S
 10.1    0.85               V.HSLEPTLRNKFK.M
  5.9   -0.12               K.PNPSADPVFSKAIK.V
  4.3   -0.18               R.QIPTPRPVVAVGHT.V
  0.5   -0.03               R.DHSQPQRWRDF.K
Top scoring peptide matches to query 21
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.5    0.85        S.NPIWVVNTRMTVAK.S
  4.0   -0.03        R.KYSQYSFWEPAPQ.G
  3.2    0.77        K.VNLVWPATPVHIRK.F
  2.5   -0.04        E.GAGFYVNATMEPFAR.Y
  2.4   -0.19        L.PASLTQQQQILYIK.K
  2.4    0.96        V.ASLVVGQSCDAWAHK.S
  2.4    0.84        D.DFLDGLLFPAPLSPK.R
  2.4   -0.03        N.TESLGHAPEPACSFK.K
  2.3    0.96        R.TPANRANPDCVTRGV.S
  1.9   -0.12        R.SRQYLKAGWQSLGH.A
Top scoring peptide matches to query 22
Score greater than 26 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.1   -0.01    4  AFR711C D.YEQYVDVFYHFK.S
 34.8   -0.99    4  AFR711C D.YEQYVDVFYHFK.S
 10.5   -0.03               R.YTVGQFRAICMKY.N
  6.6   -0.15               S.AAATLVRDVRAMHAR.L
  5.2    0.07               R.YEQYEPMYTDLW.C
  2.5    0.89               R.YKVQYNDLLPAGKQ.D
  0.8   -0.05               R.NYRIGFSNTYRVF.W
  0.7   -0.04               R.LGSYEEFAFRYKQ.T
  0.7   -0.09               I.INNEIVTLDIDNHK.V
  0.2   -0.11               Y.FAHVQVNDLPQIVR.W
Top scoring peptide matches to query 23
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.90        R.LDITFSQMPCELLN.L
  2.9   -0.08        R.LDITFSQMPCELLN.L
  2.3    0.83        R.DIVGMARTGSGKTAAFV.L
  2.1   -0.16        K.MPYIAPDTKFFPAAL.H
  2.0   -0.15        G.INELLGFNMGFRGGR.R
  1.3   -0.07        L.NITTTNMGSESEAGIR.Q
  1.1   -0.11        S.CPLFNESSTEKEIK.A
  1.0   -0.13        T.VRDYDLEQLDSSIK.S
  0.9   -0.10        D.WALNYIWHDFTSK.Y
  0.8    0.81        K.VTKEKSNGASVPLDVH.P
Top scoring peptide matches to query 24
Score greater than 25 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.2    0.85        E.LARHFNASFLETSAK.Q
 11.5    0.85        A.NSGSSVDHKHLQLLR.L
  3.9   -0.04        M.SQEQPPADPTPQASPAA.P
  3.4    0.90        F.STPGLVSSEWMAGELK.D
  2.7   -0.04        M.SQEQPPADPTPQASPAA.P
  2.6    0.05        R.DDTYDEAETLHPTGE.R
  2.5    0.96        E.IAQLGSLACEDADEAK.T
  2.5    0.88        R.ELEGKEVPAAAHQQLA.Q
  2.5    0.88        R.ELEGKEVPAAAHQQLA.Q
  2.0    1.00        N.DKPYNCEHRGCQK.R
Top scoring peptide matches to query 25
Score greater than 39 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
122.4    0.96    5  AER058W K.ESSHPLNDVAHFCTK.E
 31.3   -0.03    5  AER058W K.ESSHPLNDVAHFCTK.E
 18.6    0.88   17  AGR112C R.ESSLNYFHAIGKVIY.G
 13.6    0.87               I.KLVVYLENCEAEFK.K
 11.4    0.91               R.INGHIDTNIAQLSALC.K
 11.3    0.99               Q.DFCEVNQTDDITRK.A
 10.5    0.91               L.DTSQLSSKQSSISPFK.L
 10.1    0.86               L.AVQWEHEVAKRSSSK.H
  9.5    0.88               D.KKSAAGASLEEDNFFK.I
  9.5    0.87   19  AAL028W K.QKAIVKVSNMSFQYP.G
Top scoring peptide matches to query 26
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 56.1   -0.03    2  AEL111C  Y.NLYDENIAPQCSPIK.L
 56.1   -0.03    6  mAEL103W Y.NLYDQNIAPQCSPIK.L
 42.9   -0.03    6  mAEL103W Y.NLYDQNIAPQCSPIK.L
 30.2   -0.03    6  mAEL103W Y.NLYDQNIAPQCSPIK.L
 28.7    0.95    6  mAEL103W Y.NLYDQNIAPQCSPIK.L
 25.1    0.12   13  ACL006W  K.NSNNNNNQINQNNEQ.L
 15.5   -0.86   13  ACL006W  K.NSNNNNNQINQNNEQ.L
  9.0    0.93                R.DQQTTRVNALQMEIL.R
  8.1    0.12                K.SDSDNKYDSNKDENK.D
  7.8   -0.06                R.SYQFLKFVNEVSSNV.V
Top scoring peptide matches to query 27
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.8   -0.28        G.GSAVAAQLIAHKLKNEK.F
  2.1    0.71        Q.FYLVTVGSTLGILAPAR.L
  1.5    0.92        S.QNPEALDEALEEEYK.V
  1.4    0.03        R.AGLPSNAGETACAGEDEE.H
  1.2    0.86        R.WRLGSIPLSSNASSSES.G
  1.0    0.69        K.GIATALVQLTLTFGIFL.M
  0.8   -0.23        K.LQLTPGVAELTSTLHAAG.C
  0.6    0.84        R.LQGVAGQRIGMFQAETA.G
  0.6   -0.14        R.LQGVAGQRIGMFQAETA.G
  0.6   -0.21        F.YADADLGSNTLQKKVR.T
Top scoring peptide matches to query 28
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8    0.89        R.PKDPTLVKYHAACQR.G
  2.8   -0.09        R.PKDPTLVKYHAACQR.G
  2.0    0.88        L.VEYFPSRTATWSIVK.A
  0.9    0.84        K.ILNPNLEPEVGAPHKR.I
  0.7   -0.03        V.VKSLPHENWNMWDK.G
  0.5    0.03        R.NAPGVAADVSHVNTDCR.V
  0.0   -0.02        L.EQHGSGSITQSPSNDLK.K
Top scoring peptide matches to query 29
Score greater than 27 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.7   -0.11        K.LVSFQNSGVSVEDRTR.T
 15.7   -0.11        K.LVSFQNSGVSVEDRTR.T
 13.4    0.81        R.QFFIPLTGISVNSTLR.E
  9.5   -0.16        H.LKTRFQNMVTGQITR.E
  8.9    0.86        D.IVITETGTAAFGINQTR.F
  8.6   -0.17        D.PKKPIGGNIMAHSSTTR.L
  8.3   -0.20        D.VEWFKSIPLFTKSGR.S
  8.0   -0.02        M.YGARAGNENSGAGAAGSRAG.R
  7.3   -0.17        N.KLFMKQISSMRPAEK.M
  6.5   -0.17        R.QFFIPLTGISVNSTLR.E
Top scoring peptide matches to query 30
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.0   -0.03    3  ABR025C A.SMYHMSSVFEDNGALK.L
  4.9   -0.21               P.QQPPALTASVYLNITAK.K
  2.1    0.92               I.TAKDDIEHCDIEIQK.M
  0.9    0.93               L.DTSGMRVHWLEGSDPK.T
Top scoring peptide matches to query 31
Score greater than 32 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 82.8   -0.08    2  AEL111C R.QFQFDGPPPQAGAIYAK.G
 14.4   -0.10               L.HSRLGATLDGNEPLPEK.E
  9.2   -0.93               K.SFINMEDDFSPFKEE.L
  8.2   -0.15               A.HHLAETLGVGTPAVYAAK.A
  7.9   -0.21               L.AIVREPGQPDRILLQK.Q
  7.7    0.94               R.FVRQPNIRDTSLQEQ.E
  7.5   -0.12               R.QEKLSSMIRNMLGAQK.L
  7.3    0.84               K.LLPPQDVPAIVVGCRAQ.E
  6.9    0.05               P.GQNIYEDIMMQESFK.G
  6.9    0.05               P.GQNIYEDIMMQESFK.G
Top scoring peptide matches to query 32
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 28.1   -0.04    9  ADL021W R.VLAAQYFNCGDDEDAR.I
  8.7    0.87               K.YAGDVQYEGNTLVIDGK.K
  4.4    0.87               K.YAGDVQYEGNTLVIDGK.K
  1.1    0.86               L.AADPYKSVFANSTSLNR.V
Top scoring peptide matches to query 33
Score greater than 20 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.8   -0.13        R.LFMQNPFVTDNLIAQL.K
  7.3    0.99        T.DGGTQESGASSESEAPARK.R
  5.6    0.82        V.KNSNLLSMINFENVIK.L
  5.6    0.82        V.KNSNLLSMINFENVIK.L
  5.2    0.94        K.DMLGWQSRGGSELGTNR.T
  5.1   -0.16        V.KNSNLLSMINFENVIK.L
  5.1   -0.16        V.KNSNLLSMINFENVIK.L
  5.1   -0.16        V.KNSNLLSMINFENVIK.L
  5.1   -0.16        V.KNSNLLSMINFENVIK.L
  5.1    0.85        R.LFMQNPFVTDNLIAQL.K
Top scoring peptide matches to query 34
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.5   -0.15        R.LDSAPSFVRFNNDSTIT.M
  5.2   -0.34        F.VVSTSRDNLLLRQILR.K
  4.3    0.65        A.GGKVINKLTLELTNNLR.T
  4.0   -0.11        R.EEQTMYQVEAERLVSA.A
  3.8    0.92        I.CEMVDYIDATAKSHSR.A
  3.8   -0.15        V.DANEQQQPMRQASKPR.I
  3.8    0.79        R.SSLYNKFAVSTPPNTTR.F
  3.8   -0.19        R.SSLYNKFAVSTPPNTTR.F
  3.7    0.83        W.ARLMPCWGFNVYGRR.I
  3.7    0.88        T.GCRVVGLNNNDYQIMK.G
Top scoring peptide matches to query 35
Score greater than 35 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
110.3   -0.06    4  AFR711C K.VTAPDCEALQSGMIVVSK.D
 15.6    0.77               G.NRPVLTLPHLMLSVVSK.C
 15.6   -0.22               G.NRPVLTLPHLMLSVVSK.C
  9.8   -0.18               H.VTAAARVSLLPPRCHTR.R
  8.4   -0.04               V.ISKHVQDAYAQAEEVSK.K
  8.0   -0.20               L.TVAITDPVAEIRHEILK.H
  7.9   -0.08               L.VFNWRLADWSPAQVSK.L
  4.7    0.99               Q.QTTRNGELSAAAEAQPQK.Q
  4.6   -0.07               D.AEAAIQGMQGFIVGGNAIR.L
  4.5    0.87               L.RSGDRLSSEILLDQVSK.Y
Top scoring peptide matches to query 36
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0   -0.24        S.RSSTEVPGRLRPSLLPR.E
  3.0    0.88        R.PRIFSEISDNTSAARQK.T
  2.4   -0.09        Y.RNQPKVAQDIYEQLSK.G
  1.9   -0.09        L.FQVGMSGNKEPFVNIPR.D
  1.9    0.90        Y.RNQPKVAQDIYEQLSK.G
  1.6   -0.99        R.NSAAAASLQDGLPMGGMGVSS.G
  1.5   -0.15        S.PSSPWDLPKEPPTVRSK.A
  1.0   -0.21        S.GITIIPVLSQTQHTGIDK.A
  0.8   -0.18        I.GTIGHVDHGKTTLTAAITK.T
  0.4   -0.00        R.EAAEGSGSQLVWEVISEE.E
Top scoring peptide matches to query 37
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.2   -0.25        A.LVAEELQALLPDLQCAR.T
  3.4   -0.32        R.FLAVSLLDNTVKVFFLD.S
  0.1   -0.05        K.IEEAFHMNKMQQTMAQ.S
Top scoring peptide matches to query 38
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.4   -0.08    3  ABR025C R.SASMYHMSSVFEDNGALK.L
  8.1   -0.08               E.MIGGTNEDDFSDAVNFIK.E
  7.7   -0.20               S.DEEELDLRLAIDRCVK.S
  6.7   -0.05               P.EDRSNNASHSENEDAVAK.Y
  5.9    0.78               K.SYHSIFASSSLAHLPQVK.E
  4.6   -0.19               P.AYMQMVLDQSRQLYVK.R
  3.3    0.79               L.RSNNGFGPPAVAAGNTITVK.T
  2.5    0.97               M.TSGYQVQECLDWATANGA.V
  2.1    0.86               R.CVQGCAMGRFLRSLNGF.D
  1.8   -0.04               -.MTSGYQVQECLDWATAN.G
Top scoring peptide matches to query 39
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.0    0.76        R.ELEDVSANIVKNAQSFHL.V
  3.2    0.70        V.PPTSAPTSAFSTTISRAAPR.R
  2.6    0.66        K.EHGLHRELPHLKAAASLH.K
  1.7    0.91        K.YYDPCSDAVVCPADVNGI.K
  1.3    0.81        K.HTRGSYAAQKQQLPNGEQ.P
  1.3    0.81        K.HTRGSYAAQKQQLPNGEQ.P
  1.3    0.81        K.HTRGSYAAQKQQLPNGEQ.P
  1.3    0.81        K.HTRGSYAAQKQQLPNGEQ.P
  0.9   -0.24        L.NGDTSGLSLQLMPQTTPQK.Q
  0.5    0.64        N.ATSAEQKVRSVTLEILNR.C
Top scoring peptide matches to query 40
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.5   -0.18        V.ATPHQFPRGVNFNVQIAGK.-
  9.0    0.80        A.LQYMKDVLQIAQVFDLR.A
  5.5    0.18        R.QQQQQQQQQQQQQQQQ.Q
  5.4   -0.18        M.PSILFLFLSGFNNDQLQK.K
  5.4   -0.18        M.PSILFLFLSGFNNDQLQK.K
  5.4   -0.18        M.PSILFLFLSGFNNDQLQK.K
  5.2   -0.06        K.CNSTAEKDKCPEVFLNAV.S
  5.1   -0.18        V.ATPHQFPRGVNFNVQIAGK.-
  5.1   -0.18        V.ATPHQFPRGVNFNVQIAGK.-
  3.9    0.18        R.QQQQQQQQQQQQQQQQ.Q
Top scoring peptide matches to query 41
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.1   -0.19        K.QEPEGQHQSILASGNALSGY.A
  4.3   -0.32        K.KALDLYRYNTQLQNSVY.A
  4.3   -0.32        K.SPINKSFLMEDPALLHLY.S
  4.1   -0.24        R.ESPKVYWIWNHRQWC.L
  4.1    0.66        K.LSIVQTGLLILQCRSECP.N
  4.1    0.73        R.RSGSYPSLPQMSTPGGKHIS.A
  3.2   -0.35        R.RLTPVPSAYPPVVTGDVTGY.T
  2.6    0.58        N.HTGSHKINNSLAQVLLAKR.L
  2.6    0.58        N.HTGSHKINNSLAQVLLAKR.L
  2.6    0.58        N.HTGSHKINNSLAQVLLAKR.L
Top scoring peptide matches to query 42
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.1   -0.25        K.IVPVTGERPKPKNNEPPLD.D
  2.1   -0.25        K.IVPVTGERPKPKNNEPPLD.D
  0.8    0.01        K.TLGDIYHLQGRYNDCCN.S
  0.8   -0.98        K.TLGDIYHLQGRYNDCCN.S
  0.6    0.99        W.CQEEPFNMGSWAYVQPR.I
  0.6    0.99        W.CQEEPFNMGSWAYVQPR.I
  0.5    0.87        R.YSLVPAAPPTNNSDDIPLQS.R
  0.5   -0.03        K.QQEQKGPYGQPQYQQQY.A
Top scoring peptide matches to query 43
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.6   -0.19        K.CTGDCFVHSGVYEQFKLA.Y
  6.2   -0.31        R.FGNAPVPNNLLSSLFHGIYG.D
  5.6    0.74        D.MEHLVIEQQEQVEFIDK.Q
  5.6   -0.16        T.NWQTYDLGQQLNQAMFR.V
  5.6    0.73        C.QSMNFLSGLLLLFMDEEK.A
  5.6   -0.33        Y.VNGFIKGTYTANQAFAKMR.K
  5.6   -0.33        Y.VNGFIKGTYTANQAFAKMR.K
  5.6    0.67        R.FGNAPVPNNLLSSLFHGIYG.D
  5.6   -0.31        R.FGNAPVPNNLLSSLFHGIYG.D
  5.6   -0.31        R.FGNAPVPNNLLSSLFHGIYG.D
Top scoring peptide matches to query 44
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 45
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 57.3   -0.18    3  ABR025C S.SSPYELTLEQPGATSISVALR.A
  8.4   -0.15               Y.DRSVALQHYSSQQPFVISR.A
  6.7   -0.22               G.WIVIEHLVNEHFGRRASR.S
  4.7    0.88               R.ELNVNDCLLKAGGCESVLRA.L
  4.3   -0.23               L.HLLREELQLNVLQIQNVR.R
  4.1   -0.12               Y.VDASSGSIKEVGDPKAEYNPR.D
  3.4   -0.21               M.QISRRLNMEDPTVILYIR.I
  3.4   -0.07               K.IFCMHGGLSPDLNTMEQIR.R
  2.9   -0.18               D.LEELKQNTDGAEFIGNLSLK.I
  2.8   -0.17               Y.ANLATTTVQNLDTKAQEIKR.V
Top scoring peptide matches to query 46
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4   -0.49        K.ILNVLSQGKINGHLINMWKA.L
  5.3    0.54        R.QTTSNVGLLNKPNIQSLIHGL.N
  4.9   -0.49        K.ILNVLSQGKINGHLINMWKA.L
  4.4    0.60        S.PILTNDLVSDTVSINYAVDAK.I
  4.0    0.74        T.LDSSARGMFDSQMNTAPHQR.R
  4.0    0.51        L.LIVVFPVIRDEHTNAVMPAK.D
  3.8    0.60        R.KPVSPLRAACTNTNAASNALHG.V
  3.8    0.65        R.NIPLPIQDDEEHVAFQVGNL.D
  3.6   -0.30        S.HSENEDAVAKYVEETVTNSK.L
  3.6   -0.31        R.QLLLDAPSNGNYEALDDISLS.S
Top scoring peptide matches to query 47
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5    0.96        S.WAQLDHSPHHKRSIDTLLK.L
  0.3   -0.05        S.EAEKAPSRLLNILQELNQSK.L
Top scoring peptide matches to query 48
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 55.8   -0.20    2  AEL111C L.SGSFYNLYDENIAPQCSPIK.L
  6.3   -0.07               K.GTGARCDEEAEDQDVSPPPNAS.P
  2.3   -0.25               R.YRWHQQQMELALRLLANE.E
  1.9    0.74               R.YRWHQQQMELALRLLANE.E
  1.9    0.74               R.YRWHQQQMELALRLLANE.E
  1.9    0.74               R.YRWHQQQMELALRLLANE.E
  1.5    0.75               K.ALQISNQGSSSTGAAVGAAGEAAVPS.M
  1.3   -0.33               H.NKDASALFVDNGGLEIMAPVLK.H
  1.1    0.71               E.DGLSIIETAQQVNVFVQDPAR.V
  1.1    0.71               E.DGLSIIETAQQVNVFVQDPAR.V
Top scoring peptide matches to query 49
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.1    0.70    9  ADL021W R.GVDYQPGGTGELVDPLADTEICK.R
  4.0   -0.28    9  ADL021W R.GVDYQPGGTGELVDPLADTEICK.R
  1.5   -0.39               Q.NEVFGPVLTVMKAKDIEDCIR.I
  0.8   -0.42               V.QSLPHTSNGIRQLVIDKQNQR.V
  0.8   -0.46               K.NLDIWQAAGALKLRHPSESSIK.R
  0.5   -0.27               K.LDDNHISELVFSIGLCYSHDT.K
  0.5    0.70               K.CICAGYVHQAARKSGLNQYVH.L
  0.3    0.60               Q.NEVFGPVLTVMKAKDIEDCIR.I
  0.1   -0.36               L.YKSRADLVQIYDNYAASPFGR.L
  0.0   -0.25               R.INNIPYSLQDIIGDTPGTQGEDA.H
Top scoring peptide matches to query 50
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein     Peptide
159.7   -0.02    1  mAGL352W-NN K.CMMDALSCVVNDSVDKEDYGK.L
Top scoring peptide matches to query 51
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.7    0.67        R.GEDNTASVCTADSRITDDKVDAT.R
  7.7   -0.34        R.EQNCDNQEIRLDIEQIRHE.S
  7.5   -0.51        R.KIYMLYNLQPSIDVTGGPWFT.D
  5.9    0.64        R.EQNCDNQEIRLDIEQIRHE.S
  5.9    0.64        R.EQNCDNQEIRLDIEQIRHE.S
  5.9   -0.51        K.IGTLYTEQNILALDRLQLGDHG.T
  5.9   -0.40        R.NSTKMSVGNNTILNHHATQPFQ.N
  5.9   -0.40        R.NSTKMSVGNNTILNHHATQPFQ.N
  3.6   -0.36        K.FMAPMAYPYMNGVLHVGHCFT.M
  3.6    0.47        K.THFSHPTVQLASPNLYLFRNV.L
Top scoring peptide matches to query 52
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 41.7   -0.28    3  ABR025C K.GNSGFYPVGSSSPYELTLEQPGAT.S
  6.1    0.58               A.IDPFELVNQPVELKVDSIGQSK.Y
  0.9    0.54               L.SEKKISSIQDIIPALEISNQSR.R
  0.8    0.62               S.SGAQLRHYPKNANVLSLNQSVR.G
  0.5    0.65               P.PRPVPVTPSEPTPCPEDQQPTK.V
  0.3    0.76               M.NNNQEPTESEGVAAAGGPNLEISR.G
  0.3    0.76               M.NNNQEPTESEGVAAAGGPNLEISR.G
  0.3    0.76               M.NNNQEPTESEGVAAAGGPNLEISR.G
Top scoring peptide matches to query 53
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 54
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8   -0.53        R.IRYQSSFTFNDNASLLAEEQAAE.V
  1.9   -0.61        K.SPEPVKSAEPTSSPEPTGSPQRSRP.A
  1.9   -0.55        Q.QHGISNPYSKQGMPNPYSQTSQR.L
  1.8    0.31        R.STVAVLSPEVLQASEFRVGEICLV.A
  1.5    0.48        H.LQQPQQQQNLSSQQHDHATQQK.Q
  1.5   -0.50        H.LQQPQQQQNLSSQQHDHATQQK.Q
  1.0    0.37        R.WAELTGDQAVAGPAAGERIPGAEGLPA.V
  1.0    0.35        R.VYDQQAQKAVSSCPAGTPLNLLIK.K
  0.9   -0.62        R.WAELTGDQAVAGPAAGERIPGAEGLPA.V
  0.2   -0.63        R.VYDQQAQKAVSSCPAGTPLNLLIK.K
Top scoring peptide matches to query 55
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.1   -0.68        R.LTSDQLHCLDLKYGENDLTFSVDKG.R
  0.9    0.30        R.LTSDQLHCLDLKYGENDLTFSVDKG.R
  0.5    0.30        R.YRSELSSGFTPNVSRAVHETSSSNALA.L
  0.0    0.31        G.LGYNGYDPDTQQIKWDRVQNVDIK.A
  0.0    0.31        G.LGYNGYDPDTQQIKWDRVQNVDIK.A
  0.0   -0.68        G.LGYNGYDPDTQQIKWDRVQNVDIK.A
Top scoring peptide matches to query 56
Score greater than 15 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5   -0.24    3  ABR025C DSEAFYFLSIRSASMYHMSSVFEDNGALK
  2.3    0.44               K.QNSMLLHLIAYSELVVLISLLWDTLLFR.G
  0.4    0.72               V.SISAWWSASRWPGCTCACPGPAGSLAVPVGR.A
Top scoring peptide matches to query 57
Score greater than 14 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.3   -0.71        E.LFPLLPLLCSQLLLKPELQQVLRDESTR.N
  3.3   -0.71        E.LFPLLPLLCSQLLLKPELQQVLRDESTR.N
  0.9    0.39        E.ALSAPLLDHEQLGFQESAKAIYATLSAPIHK.D
  0.6   -0.59        E.ALSAPLLDHEQLGFQESAKAIYATLSAPIHK.D
  0.6   -0.59        E.ALSAPLLDHEQLGFQESAKAIYATLSAPIHK.D
  0.3    0.54        R.CNNIFIQLKGKVNAVTISESQHCNLLLDS.S
  0.3   -0.44        R.CNNIFIQLKGKVNAVTISESQHCNLLLDS.S
  0.2    0.42        K.LLGCIVVNSSDQDALLKSIEQPSLGYLKEK.A
  0.2   -0.56        K.YDFLTRLYLNGNNLTHLPASIKQLQNLR.V
Top scoring peptide matches to query 58
Score greater than 15 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6    0.47        R.PLSEKIYIGDVLGLAESDKLDEDASNWIFK.N
  2.6   -0.52        R.PLSEKIYIGDVLGLAESDKLDEDASNWIFK.N
  2.3    0.71        R.LHVSDCGEMSEQFNKYTGFLEGARDLSWS.Y
  1.4    0.51        R.MSQFPMEPALSKSLIASVEQGCSDEILTIIA.M
  1.1   -0.36        A.QKEFIMNSLKDMGYQTLMCGDGTNDVGALK.Q
  1.0    0.63        A.QKEFIMNSLKDMGYQTLMCGDGTNDVGALK.Q
  0.8    0.44        K.LLQEVASKTNEAAGDGTTSATVLGRAIFTESVK.N
  0.6   -0.43        R.NVIPSKRPQQGALPQFINGPGNMMPMQPMQG.G
  0.5   -0.47        L.WLGADVMLEYCVDEAIELLMQKLEDARR.N
Top scoring peptide matches to query 59
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.6   -0.66        R.HEVSGLSELTAPWPGQQLIADAEAIPARTLSLGV.N
  0.0   -0.50        N.ELRTMGETLKYSEDLDFILSDNSMTTPEHR.R
  0.0   -0.67        R.NAVLASDYSITPTAAIPIQTHVHSITMSKGLKY.L
Top scoring peptide matches to query 60
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 61
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 62
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 63
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 64
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 65
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 66
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 67
Score greater than 13 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5   -0.70    2  AEL111C D.VFYQCLSGSFYNLYDENIAPQCSPIKLQAIDLVTC.-
Top scoring peptide matches to query 68
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 69
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide