Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0401_q2.pkl
Database        : spombe A_gossypii (4731 sequences; 2318540 residues)
Timestamp       : 27 Apr 2007 at 07:42:36 GMT
Significant hits: Cwp1               ABR025Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Q756G2|TOM1_ASHGO  Probable E3 ubiquitin protein ligase TOM1 (EC 6.3.2.-) - Ashbya gossypii (Yeast) (Eremothecium goss

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 25 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    Cwp1                              Mass: 18217    Score: 86     Queries matched: 1
 ABR025Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   838.94   1675.86   1675.83   0.03 0  86  5.1e-008 1  K.LGGSTADALSAVVTDDGK.L

 
      Proteins matching the same set of peptides:
      Q75DJ7|Q75DJ7_ASHGO               Mass: 20232    Score: 86     Queries matched: 1
 ABR025Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)

2.    Q756G2|TOM1_ASHGO                 Mass: 373977   Score: 27     Queries matched: 2
 Probable E3 ubiquitin protein ligase TOM1 (EC 6.3.2.-) - Ashbya gossypii (Yeast) (Eremothecium goss
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   421.78   841.55   841.50   0.05 0  22  0.12 1  R.IGLSSIPR.L
 21   747.07   2238.18   2238.09   0.09 1  5  6.1 2  R.IFEPSAELYLKEQEENAVK.E + 2 Deamidation (NQ)

3.    Q751I4|Q751I4_ASHGO               Mass: 26178    Score: 17     Queries matched: 1
 AGL278Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   421.78   841.55   841.47   0.09 0  17  0.36 2  R.GTLEAVPR.R

4.    Q75C32|Q75C32_ASHGO               Mass: 107538   Score: 13     Queries matched: 1
 ACR085Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
14   897.94   1793.86   1793.96   -0.10 0  13  0.84 1  R.QFFIPLTGISVNSTLR.E + 2 Deamidation (NQ)

5.    Q755C8|PUS1_ASHGO                 Mass: 60157    Score: 11     Queries matched: 1
 tRNA pseudouridine synthase 1 (EC 5.4.99.-) (tRNA-uridine isomerase 1) (tRNA pseudouridylate syntha
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   971.00   1939.98   1939.91   0.07 0  11  1.3 1  K.FTQEEQDAIVNYVAPSK.E + 2 Deamidation (NQ)

6.    Q756R6|Q756R6_ASHGO               Mass: 247767   Score: 11     Queries matched: 1
 AER188Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   897.94   1793.86   1793.89   -0.03 1  12  1.1 2  K.LVSFQNSGVSVEDRTR.T + Deamidation (NQ)

7.    Ssr1                              Mass: 19834    Score: 10     Queries matched: 1
 AER058Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   581.28   1740.83   1740.79   0.04 0  10  1.6 1  K.ESSHPLNDVAHFCTK.E

 
      Proteins matching the same set of peptides:
      Q757F5|Q757F5_ASHGO               Mass: 22944    Score: 10     Queries matched: 1
 AER058Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
8.    Q750Q1|Q750Q1_ASHGO               Score: 8      Queries matched: 1
 AGL109Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   421.78   841.55   841.50   0.05 0  9  2.2 3  R.LTVSAVPR.E

9.    Q75A83|MRD1_ASHGO                 Score: 7      Queries matched: 1
 Multiple RNA-binding domain-containing protein 1 - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   897.94   1793.86   1793.93   -0.07 1  7  3.5 4  K.QTKPQHGIDAEISKNK.Q + Deamidation (NQ)

10.   Q75DV0|Q75DV0_ASHGO               Mass: 159064   Score: 7      Queries matched: 1
 ABL077Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
21   747.07   2238.18   2238.04   0.14 0  7  3.7 1  R.EQNVVFITSTGGQGEFPQDGK.A + Deamidation (NQ)

11.   Q75DM9|Q75DM9_ASHGO               Mass: 116032   Score: 7      Queries matched: 1
 ABL012Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   1042.04   2082.06   2082.02   0.04 1  7  3.7 1  K.LIQSYQGELQEKEMQLK.T + 2 Deamidation (NQ); Oxidation (M)

12.   Q754E0|Q754E0_ASHGO               Mass: 70305    Score: 6      Queries matched: 1
 AFR130Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   946.95   1891.88   1891.98   -0.10 0  6  5 1  K.QNSLAEVTILYQQALAK.T + 3 Deamidation (NQ)

13.   Q75ES2|Q75ES2_ASHGO               Score: 4      Queries matched: 1
 AAR007Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   421.78   841.55   841.54   0.02 0  4  6.7 4  K.VLAGLTIR.E

14.   Q75EK6|Q75EK6_ASHGO               Mass: 135300   Score: 4      Queries matched: 1
 AAR073Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   435.80   869.59   869.53   0.06 0  4  6.1 1  R.ALTLTVPR.F

15.   Q751E6|Q751E6_ASHGO               Score: 4      Queries matched: 1
 AGL240Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   421.78   841.55   841.48   0.08 0  4  7.4 5  R.GLQGQALR.S

16.   Q751R8|Q751R8_ASHGO               Score: 4      Queries matched: 1
 AGL300Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   421.78   841.55   841.42   0.13 0  4  7.7 6  R.GIAMHAAR.V + Oxidation (M)

17.   Q754B2|Q754B2_ASHGO               Score: 3      Queries matched: 1
 AFR158Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   435.80   869.59   869.52   0.07 1  3  8.3 2  R.VVRNNLR.V

18.   Q754M5|Q754M5_ASHGO               Score: 3      Queries matched: 1
 AFR047Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   421.78   841.55   841.51   0.04 1  3  10 7  R.LGERVLR.A

19.   Q74ZK4|GSHR_ASHGO                 Score: 2      Queries matched: 1
 Glutathione reductase (EC 1.8.1.7) (GR) (GRase) - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   897.94   1793.86   1793.87   -0.01 0  2  10 5  K.HYDYLVIGGGSGGVASSR.R

20.   Q75EG1|Q75EG1_ASHGO               Mass: 23448    Score: 2      Queries matched: 1
 AAR120Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   523.31   1044.61   1044.47   0.14 0  2  14 1  K.CQQDGAPLR.A + Deamidation (NQ)

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   994.07   1986.12   1986.87   -0.75 1  2  16 1  QPEFDLVKSYYTMDHN + Deamidation (NQ)
10   683.81   1365.60   1365.62   -0.02 1  0  19 1  MGDKNNNVTSLR + 2 Deamidation (NQ); Oxidation (M)
25   1181.96   3542.85   3542.92   -0.06 0  0  13 1  AQSTVVSQLVPLQLSLEVQHMGLTSLHPLFLR + 2 Deamidation (NQ)
1   447.27   446.26        
2   472.31   471.31        
3   536.35   535.34        
4   767.42   766.41        
8   592.78   1183.55        
9   629.35   1256.69        
11   710.88   1419.75        
17   984.01   1966.00        
20   737.72   2210.14        
22   762.08   2283.21        
23   1032.56   3094.67        
24   1116.59   3346.76        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 25

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 12 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 4 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 3
Score greater than 12 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 4
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 5
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 21.9    0.05    2  Q756G2|TOM1_ASHGO   R.IGLSSIPR.L
 17.2    0.09    3  Q751I4|Q751I4_ASHGO R.GTLEAVPR.R
  9.2    0.05    8  Q750Q1|Q750Q1_ASHGO R.LTVSAVPR.E
  4.5    0.02   13  Q75ES2|Q75ES2_ASHGO K.VLAGLTIR.E
  4.1    0.08   15  Q751E6|Q751E6_ASHGO R.GLQGQALR.S
  3.9    0.13   16  Q751R8|Q751R8_ASHGO R.GIAMHAAR.V
  2.7    0.04   18  Q754M5|Q754M5_ASHGO R.LGERVLR.A
  2.0    0.08                           R.RPSLVDR.R
  0.2    0.11                           R.LGRENPR.G
  0.1    0.14                           K.CEVLGHK.S
Top scoring peptide matches to query 6
Score greater than 16 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
  4.3    0.06   14  Q75EK6|Q75EK6_ASHGO R.ALTLTVPR.F
  3.0    0.07   17  Q754B2|Q754B2_ASHGO R.VVRNNLR.V
  0.6    0.05                           R.IERLLAR.S
  0.2    0.09                           K.LEEVKPR.K
Top scoring peptide matches to query 7
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
  2.3    0.14   20  Q75EG1|Q75EG1_ASHGO K.CQQDGAPLR.A
  2.3    0.14   20  Q75EG1|Q75EG1_ASHGO K.CQQDGAPLR.A
  1.7    0.12                           R.LVGNETHMK.D
  1.1    0.09                           R.LRNEQVER.D
  0.2    0.02                           R.SLSGLDIGKR.N
Top scoring peptide matches to query 8
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 9
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 10
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2   -0.02        -.MGDKNNNVTSLR.G
  0.1   -0.02        -.MGDKNNNVTSLR.G
Top scoring peptide matches to query 11
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 12
Score greater than 18 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 86.1    0.03    1  Cwp1 K.LGGSTADALSAVVTDDGK.L
  0.3    0.03            K.DSHNFALVPPGPAPTR.R
Top scoring peptide matches to query 13
Score greater than 23 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3    0.04    7  Ssr1 K.ESSHPLNDVAHFCTK.E
Top scoring peptide matches to query 14
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 13.3   -0.10    4  Q75C32|Q75C32_ASHGO R.QFFIPLTGISVNSTLR.E
 11.9   -0.03    6  Q756R6|Q756R6_ASHGO K.LVSFQNSGVSVEDRTR.T
 11.9   -0.03    6  Q756R6|Q756R6_ASHGO K.LVSFQNSGVSVEDRTR.T
  7.1   -0.07    9  Q75A83|MRD1_ASHGO   K.QTKPQHGIDAEISKNK.Q
  2.4   -0.01   19  Q74ZK4|GSHR_ASHGO   K.HYDYLVIGGGSGGVASSR.R
Top scoring peptide matches to query 15
Score greater than 18 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
  5.6   -0.10   12  Q754E0|Q754E0_ASHGO K.QNSLAEVTILYQQALAK.T
  5.0   -0.10   12  Q754E0|Q754E0_ASHGO K.QNSLAEVTILYQQALAK.T
Top scoring peptide matches to query 16
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein           Peptide
 11.0    0.07    5  Q755C8|PUS1_ASHGO K.FTQEEQDAIVNYVAPSK.E
 11.0    0.07    5  Q755C8|PUS1_ASHGO K.FTQEEQDAIVNYVAPSK.E
  1.7    0.01                         K.NMFSAAYLALDQVNLLR.M
  1.6   -0.18                         K.VLQLLRLNQINSGVFVK.V
Top scoring peptide matches to query 17
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 18
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7   -0.75        R.QPEFDLVKSYYTMDHN.-
  1.7    0.15        R.EISNYRNATHAQAVANAR.H
Top scoring peptide matches to query 19
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
  6.8    0.04   11  Q75DM9|Q75DM9_ASHGO K.LIQSYQGELQEKEMQLK.T
  4.4    0.04   11  Q75DM9|Q75DM9_ASHGO K.LIQSYQGELQEKEMQLK.T
  4.4    0.04   11  Q75DM9|Q75DM9_ASHGO K.LIQSYQGELQEKEMQLK.T
  2.2    0.05                           K.RDQFIFVEECLEELQK.Q
Top scoring peptide matches to query 20
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 21
Score greater than 17 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
  7.0    0.14   10  Q75DV0|Q75DV0_ASHGO R.EQNVVFITSTGGQGEFPQDGK.A
  4.8    0.09    2  Q756G2|TOM1_ASHGO   R.IFEPSAELYLKEQEENAVK.E
  3.7    0.14   10  Q75DV0|Q75DV0_ASHGO R.EQNVVFITSTGGQGEFPQDGK.A
  2.7    0.14   10  Q75DV0|Q75DV0_ASHGO R.EQNVVFITSTGGQGEFPQDGK.A
Top scoring peptide matches to query 22
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 23
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 24
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 25
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.1   -0.06        K.AQSTVVSQLVPLQLSLEVQHMGLTSLHPLFLR.Y