Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0400_q2.pkl
Database        : spombe A_gossypii (4731 sequences; 2318540 residues)
Timestamp       : 27 Apr 2007 at 07:41:28 GMT
Significant hits: Ssr1   AER058Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Pir2   AEL111Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Fig2   AFR711Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Gas5   ADL021Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Ecm33  ABL063Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Gas1   AGL352Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 25 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    Ssr1                              Mass: 19834    Score: 266    Queries matched: 6
 AER058Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   496.24   990.46   990.46   -0.00 0  43  0.0012 1  D.VAHFCTKE.S
11   619.80   1237.58   1237.58   0.01 0  55  7.4e-005 1  E.GALSAFKANCAE.H
23   830.35   1658.69   1658.67   0.01 1  (57) 4.9e-005 1  E.SDAMQKCFSSICPE.G
24   830.35   1658.69   1658.67   0.02 1  64  9e-006 1  E.SDAMQKCFSSICPE.G
28   581.27   1740.78   1740.79   -0.01 1  (61) 1.9e-005 1  E.SSHPLNDVAHFCTKE.S
29   871.41   1740.81   1740.79   0.02 1  104  8.4e-010 1  E.SSHPLNDVAHFCTKE.S

 
      Proteins matching the same set of peptides:
      Q757F5|Q757F5_ASHGO               Mass: 22944    Score: 266    Queries matched: 6
 AER058Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)

2.    Pir2                              Mass: 33919    Score: 230    Queries matched: 5
 AEL111Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
36   657.67   1970.00   1969.99   0.01 0  (10) 2 1  D.GPPPQAGAIYAKGWSITQE.G
37   986.03   1970.04   1969.99   0.05 0  137  3.6e-013 1  D.GPPPQAGAIYAKGWSITQE.G
41   714.38   2140.12   2140.10   0.02 1  (20) 0.19 1  E.NIAPQCSPIKLQAIDLVTC.-
42   1071.08   2140.14   2140.10   0.04 1  92  1.1e-008 1  E.NIAPQCSPIKLQAIDLVTC.-
43   1072.13   2142.24   2142.07   0.17 1  (44) 0.00087 1  E.NIAPQCSPIKLQAIDLVTC.- + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      Q757X3|Q757X3_ASHGO               Mass: 35909    Score: 230    Queries matched: 5
 AEL111Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
3.    Fig2                              Mass: 55938    Score: 104    Queries matched: 3
 AFR711Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   545.27   1088.52   1088.52   0.00 1  19  0.25 1  E.GLKVTAPDCE.A
34   654.32   1959.94   1959.94   0.01 1  (9) 2.4 1  E.QYVDVFYHFKSGGVSVE.A
35   980.99   1959.96   1959.94   0.03 1  84  6.6e-008 1  E.QYVDVFYHFKSGGVSVE.A

 
      Proteins matching the same set of peptides:
      Q751W4|Q751W4_ASHGO               Mass: 58053    Score: 104    Queries matched: 3
 AFR711Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
4.    Gas5                              Mass: 47958    Score: 72     Queries matched: 2
 ADL021Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   628.27   1254.53   1254.51   0.02 0  38  0.004 1  E.YGCNTMPGARE.F
17   687.35   1372.69   1372.67   0.02 0  34  0.0076 1  E.KMSSLFSGGLAFE.Y

 
      Proteins matching the same set of peptides:
      Q75AD8|Q75AD8_ASHGO               Mass: 50313    Score: 72     Queries matched: 2
 ADL021Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
5.    Ecm33                             Mass: 39065    Score: 66     Queries matched: 4
 ABL063Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   476.22   950.42   950.42   -0.00 0  1  17 2  E.SCPMKSLE.L
6   558.30   1114.59   1114.59   0.00 1  10  2.1 1  E.ITGALVIADNE.K
12   623.35   1244.69   1244.67   0.02 1  33  0.012 1  D.SLKLMDLPSLE.A
69   1046.84   4183.35   4183.30   0.05 1  22  0.064 1  E.VSMVQFQALPVVNNIVTSKLKTANDIVISNTNLRSIKE.F

 
      Proteins matching the same set of peptides:
      Q75DT6|Q75DT6_ASHGO               Mass: 42563    Score: 66     Queries matched: 4
 ABL063Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
6.    Gas1                              Mass: 55771    Score: 48     Queries matched: 1
 AGL352Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   698.87   1395.73   1395.72   0.01 0  48  0.00029 1  E.FSRLPVPAFFSE.Y

 
      Proteins matching the same set of peptides:
      Q751P1|Q751P1_ASHGO               Mass: 58032    Score: 48     Queries matched: 1
 AGL352Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
7.    Q751A2|Q751A2_ASHGO               Mass: 116428   Score: 23     Queries matched: 1
 AGL078Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   623.35   1244.69   1244.68   0.01 0  23  0.11 2  D.IRSMAQLAILE.L + Deamidation (NQ)

8.    Q75AU0|Q75AU0_ASHGO               Mass: 62572    Score: 20     Queries matched: 1
 ADL170Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   623.35   1244.69   1244.65   0.04 1  22  0.15 3  E.SVEQNKLALIE.K + 2 Deamidation (NQ)

9.    Q75AM4|Q75AM4_ASHGO               Mass: 30979    Score: 20     Queries matched: 1
 ADL101Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   623.35   1244.69   1244.61   0.07 1  20  0.23 4  E.NLESNLQALIE.L + 2 Deamidation (NQ)

10.   Q753H6|Q753H6_ASHGO               Mass: 22475    Score: 16     Queries matched: 1
 AFR336Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   698.87   1395.73   1395.50   0.24 0  17  0.37 2  -.MSNVNCYFQSE.I + 2 Deamidation (NQ); Oxidation (M)

11.   Q753A9|Q753A9_ASHGO               Mass: 48152    Score: 16     Queries matched: 1
 AFR415Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   612.35   1222.69   1222.66   0.04 0  16  0.52 1  E.GASYALAKKVSE.L

12.   Q751L2|Q751L2_ASHGO               Mass: 39698    Score: 15     Queries matched: 1
 AGL311Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
49   1275.15   2548.28   2548.21   0.07 0  15  0.42 1  D.NHMSSKKSTNPAVNLVAGGTAGLFE.A + 3 Deamidation (NQ); Oxidation (M)

13.   Q75EK8|Q75EK8_ASHGO               Mass: 250246   Score: 14     Queries matched: 1
 AAR071Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 11   619.80   1237.58   1237.62   -0.04 1  16  0.57 2  E.KLFSGSKVNEE.D + Deamidation (NQ)

14.   Q751Q4|Q751Q4_ASHGO               Mass: 67852    Score: 14     Queries matched: 1
 AGL365Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   687.88   1373.75   1373.61   0.14 0  14  0.81 1  -.MNSAEPEPKNIE.K + Oxidation (M)

15.   Q754X5|Q754X5_ASHGO               Mass: 144124   Score: 13     Queries matched: 1
 AFL059Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
25   851.44   1700.87   1700.80   0.07 1  13  1.1 1  E.KYLQIALDNNHNQE.L + 2 Deamidation (NQ)

16.   Q74ZH1|Q74ZH1_ASHGO               Score: 13     Queries matched: 1
 AGR236Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 35   980.99   1959.96   1959.91   0.06 1  13  0.9 2  E.NSWLSDAGLVANILNQNE.G + 3 Deamidation (NQ)

17.   Q75AE5|Q75AE5_ASHGO               Score: 13     Queries matched: 1
 ADL028Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   687.88   1373.75   1373.77   -0.02 0  13  1.2 2  E.NRKTRSKGAVKE.S + Deamidation (NQ)

18.   Q75CM2|Q75CM2_ASHGO               Score: 12     Queries matched: 1
 ACL103Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 25   851.44   1700.87   1700.90   -0.04 1  12  1.5 3  E.VQLVSFKLFLYDTE.S

19.   Q74Z47|PPME1_ASHGO                Mass: 43042    Score: 12     Queries matched: 1
 Protein phosphatase methylesterase 1 (EC 3.1.1.-) (PME-1) - Ashbya gossypii (Yeast) (Eremothecium g
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
46   1134.61   2267.20   2267.19   0.01 1  12  1.2 1  D.KELIIGQMQGKYQLVVFQE.S + Deamidation (NQ); Oxidation (M)

20.   Q75E13|Q75E13_ASHGO               Score: 11     Queries matched: 1
 ABL140Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   612.35   1222.69   1222.57   0.12 0  11  1.6 2  E.QSNNQLIYLE.K + 2 Deamidation (NQ)

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   559.32   1116.62   1116.60   0.02 0  9  2.8 1  IALLNTQKSE + Deamidation (NQ)
79   1251.67   5002.66   5002.67   -0.01 0  8  0.98 1  NSPQLYNHLIRLGIRSSMYATQWFLTLFAYKFPLGFVLRILD + Deamidation (NQ)
76   1606.35   4816.04   4816.63   -0.59 1  8  1.4 1  LFALNKQAATAGLKAKPRISYNTVAGVNGPLVILERVKYPQYNE + 2 Deamidation (NQ)
21   706.40   1410.79   1410.69   0.09 0  8  3.6 1  FFIHYITANRE + Deamidation (NQ)
45   1086.09   2170.16   2170.05   0.11 0  7  3.7 1  GYQFAVLLQPPHVQGLCNE + Deamidation (NQ)
80   1811.15   5430.44   5429.81   0.63 1  7  1.6 1  TYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMD + 3 Deamidation (NQ)
14   630.82   1259.62   1259.61   0.00 1  7  4.8 1  WATNADRLIAE + Deamidation (NQ)
50   854.06   2559.15   2559.18   -0.03 1  6  4.6 1  GAILNILNQMSSKEVMYQPMKE + 4 Deamidation (NQ); 2 Oxidation (M)
8   570.33   1138.64   1138.59   0.05 0  5  5.4 1  ITNLHLQLGE + 2 Deamidation (NQ)
16   683.86   1365.71   1365.73   -0.01 1  5  7 1  NADKTLPIHTKE
9   408.56   1222.67   1222.55   0.12 0  4  7 1  QGFTVLSNMPE + Deamidation (NQ)
62   1181.31   3540.92   3541.67   -0.75 0  3  5.3 1  QSNLLQFSNLRTGNLRLASTNRGSANGGGSSTME + 4 Deamidation (NQ)
78   1223.17   4888.67   4888.34   0.33 1  3  3.7 1  MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE + 2 Deamidation (NQ); 2 Oxidation (M)
59   1106.81   3317.40   3317.81   -0.42 1  2  11 1  VSKKGKKTRNTVKRTTELEPSPIMSIFGGE
51   1301.07   2600.13   2600.12   0.01 1  2  13 1  AQMRHDSPAFSANSQFSCKMVGE + Oxidation (M)
53   945.87   2834.59   2834.45   0.14 1  1  13 1  RQLCKLIRYAYESMLLQFPYLE + Deamidation (NQ)
3   476.22   950.42   950.40   0.02 1  1  17 1  ISQDMIND + Oxidation (M)
31   919.45   1836.88   1836.83   0.05 1  1  16 1  LQRSMFEHNNKLSSE + 2 Deamidation (NQ); Oxidation (M)
57   1001.53   3001.56   3001.52   0.04 0  0  11 1  QLMYKGISMLINVLIISLSLIMCGSGD + Deamidation (NQ); 2 Oxidation (M)
22   811.92   1621.83   1621.78   0.05 1  0  21 1  QDQSNSSKRPRVGY + Deamidation (NQ)
1   490.29   489.28        
2   463.23   924.46        
15   648.31   1294.61        
20   471.26   1410.75        
26   568.30   1701.88        
27   858.86   1715.71        
30   586.97   1757.88        
32   931.53   1861.05        
33   644.37   1930.09        
38   664.00   1988.97        
39   1037.97   2073.92        
40   699.37   2095.08        
44   724.38   2170.13        
47   783.06   2346.16        
48   850.43   2548.28        
52   908.07   2721.20        
54   958.78   2873.30        
55   1437.67   2873.32        
56   969.50   2905.48        
58   1095.94   3284.80        
60   1121.83   3362.45        
61   864.56   3454.20        
63   1238.56   3712.67        
64   1258.01   3771.01        
65   1303.59   3907.75        
66   978.86   3911.40        
67   1336.29   4005.84        
68   1390.31   4167.89        
70   1400.63   4198.87        
71   1427.80   4280.38        
72   1444.33   4329.96        
73   1454.98   4361.92        
74   1508.67   4522.98        
75   1562.70   4685.07        
77   1617.04   4848.11        
81   1865.50   5593.48        
82   1439.64   5754.52        
83   1480.16   5916.60        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : V8-DE
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 83

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 3
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2    0.02             E.ISQDMIND.T
  1.1   -0.00    5  Ecm33 E.SCPMKSLE.L
Top scoring peptide matches to query 4
Score greater than 21 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.9   -0.00    1  Ssr1 D.VAHFCTKE.S
  6.1   -0.04            E.AASNTTKAID.F
  2.0   -0.08            E.KQFAVVAVE.Q
  0.5    0.01            E.KQMQVQDD.V
Top scoring peptide matches to query 5
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.4    0.00    3  Fig2 E.GLKVTAPDCE.A
  0.6   -0.02            E.AGLSLGALQSGD.A
  0.3    0.04            D.FPQEGATEPN.-
Top scoring peptide matches to query 6
Score greater than 23 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.0    0.00    5  Ecm33 E.ITGALVIADNE.K
Top scoring peptide matches to query 7
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3    0.02        D.IALLNTQKSE.L
  8.0    0.02        D.IALLNTQKSE.L
  1.3    0.02        E.LTKEISANIE.L
Top scoring peptide matches to query 8
Score greater than 18 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4    0.05        D.ITNLHLQLGE.L
Top scoring peptide matches to query 9
Score greater than 17 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1    0.12        E.QGFTVLSNMPE.R
Top scoring peptide matches to query 10
Score greater than 24 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 15.6    0.04   11  Q753A9|Q753A9_ASHGO E.GASYALAKKVSE.L
 10.7    0.12   20  Q75E13|Q75E13_ASHGO E.QSNNQLIYLE.K
  7.9    0.17                           D.QTSMDRNVGSE.R
  7.4    0.08                           D.QFGKRLSMQE.A
  7.4    0.14                           E.QGFTVLSNMPE.R
  7.0    0.09                           D.KFPMRVATEE.Y
  6.7    0.10                           D.KSLLSMGMVEE.Y
  6.7    0.12   20  Q75E13|Q75E13_ASHGO E.QSNNQLIYLE.K
  6.7    0.12   20  Q75E13|Q75E13_ASHGO E.QSNNQLIYLE.K
  4.3    0.15                           E.SDSSKWLSGQE.L
Top scoring peptide matches to query 11
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 54.6    0.01    1  Ssr1                E.GALSAFKANCAE.H
 15.8   -0.04   13  Q75EK8|Q75EK8_ASHGO E.KLFSGSKVNEE.D
  6.5   -0.05                           E.TRAAFVKNTTE.E
  5.0   -0.00                           E.TVQAATYLQNE.Q
  5.0   -0.00                           E.TVQAATYLQNE.Q
  4.3   -0.11                           D.LQLLPGEVIQE.F
  3.5   -0.09                           D.FKLSSTWLKE.Y
  2.7   -0.08                           E.SLQAEHKVVLD.R
  1.6   -0.00                           E.IGNSIYDKAGAE.I
  1.4    0.01                           E.CVSIGMVKEAE.L
Top scoring peptide matches to query 12
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 32.6    0.02    5  Ecm33               D.SLKLMDLPSLE.A
 22.8    0.01    7  Q751A2|Q751A2_ASHGO D.IRSMAQLAILE.L
 21.6    0.04    8  Q75AU0|Q75AU0_ASHGO E.SVEQNKLALIE.K
 19.8    0.07    9  Q75AM4|Q75AM4_ASHGO E.NLESNLQALIE.L
 18.6    0.07    9  Q75AM4|Q75AM4_ASHGO E.NLESNLQALIE.L
  8.0    0.07    9  Q75AM4|Q75AM4_ASHGO E.NLESNLQALIE.L
  8.0    0.08                           E.MILQRDPLDE.I
  7.4   -0.01                           D.KAQLDAKTKIE.E
  6.7    0.13                           D.ALQQMEPGELE.E
  6.7    0.13                           D.ALQQMEPGELE.E
Top scoring peptide matches to query 13
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 37.5    0.02    4  Gas5 E.YGCNTMPGARE.F
Top scoring peptide matches to query 14
Score greater than 16 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.7    0.00        D.WATNADRLIAE.Y
  2.9    0.03        D.TNNSGQLNRQE.F
  2.7    0.03        D.QQDRTSGSPRE.R
Top scoring peptide matches to query 15
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 16
Score greater than 16 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.0   -0.01        D.NADKTLPIHTKE.N
  2.9    0.03        D.LAQYFPVESAIE.G
  1.6    0.08        E.FQDGILCQRTE.A
  1.0    0.05        E.TVGIIQNVYTQE.G
Top scoring peptide matches to query 17
Score greater than 20 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 34.3    0.02    4  Gas5 E.KMSSLFSGGLAFE.Y
  6.2   -0.01            E.NRVAANEPLLFE.T
  5.9    0.12            D.MMHCFKIVME.D
  5.5    0.05            D.EQSPRPGQQAFE.K
Top scoring peptide matches to query 18
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 14.2    0.14   14  Q751Q4|Q751Q4_ASHGO -.MNSAEPEPKNIE.K
 12.5   -0.02   17  Q75AE5|Q75AE5_ASHGO E.NRKTRSKGAVKE.S
  9.7    0.02                           E.ELKMQINRVKD.Q
  9.1    0.06                           E.GLQRNDIAVMLE.F
  7.1    0.06                           M.TVRVCQQAAVLE.K
  6.5    0.13                           E.NVRNNGTAHFLE.H
  6.0   -0.01                           D.SLISTLEQLKIE.S
  4.8    0.09                           E.NLVQQSELSNLE.D
  4.5   -0.02                           D.STLLELSLTRLE.W
  4.4    0.09                           E.NLVQQSELSNLE.D
Top scoring peptide matches to query 19
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 48.5    0.01    6  Gas1                E.FSRLPVPAFFSE.Y
 17.3    0.24   10  Q753H6|Q753H6_ASHGO -.MSNVNCYFQSE.I
 17.3    0.24   10  Q753H6|Q753H6_ASHGO -.MSNVNCYFQSE.I
  5.5    0.10                           D.VFRSLMSDPESE.I
  4.7    0.10                           E.GRAYRNDVTQSE.Y
  3.2   -0.03                           E.LQLLTPQPLRSE.D
  2.1    0.11                           E.QAPVDSAVHGQASE.H
  1.4    0.18                           E.AMNQFQFLYSE.N
  0.3    0.24   10  Q753H6|Q753H6_ASHGO -.MSNVNCYFQSE.I
Top scoring peptide matches to query 20
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 21
Score greater than 20 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.9    0.09        D.FFIHYITANRE.R
  6.8    0.09        E.QFVKQWFLWE.N
  4.6    0.14        D.QKEFQQAMKQE.D
  3.1    0.07        D.KPQTSSRRPAGPE.C
  2.9    0.05        E.TDKVFGKVFLQE.F
  2.5    0.17        E.TMMTPAMKQDIE.T
  2.0    0.15        D.KSERNGFFPAQE.E
  1.1    0.04        D.YLSQKLRFIDE.E
  1.1    0.14        D.YLVLCCIIDNE.I
  0.9    0.05        D.SYQGRFQKLRE.Q
Top scoring peptide matches to query 22
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.0    0.05        E.QDQSNSSKRPRVGY.-
Top scoring peptide matches to query 23
Score greater than 22 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 57.1    0.01    1  Ssr1 E.SDAMQKCFSSICPE.G
  6.0   -0.15            D.FTRQLYKMVLQSE.G
  0.5   -0.14            D.ERHTPVIEPIQNPE.A
  0.5   -0.14            D.ERHTPVIEPIQNPE.A
Top scoring peptide matches to query 24
Score greater than 24 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 64.4    0.02    1  Ssr1 E.SDAMQKCFSSICPE.G
  7.5   -0.14            D.FTRQLYKMVLQSE.G
  6.0   -0.13            D.LMHQLVTLISPYDE.K
  5.3    0.04            E.MNTPGTITDCMASLD.L
  3.8   -0.14            E.TNSTLNLSLLIEPED.S
  3.0   -0.14            D.ERHTPVIEPIQNPE.A
  3.0   -0.14            D.ERHTPVIEPIQNPE.A
Top scoring peptide matches to query 25
Score greater than 25 indicates homology
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 13.2    0.07   15  Q754X5|Q754X5_ASHGO E.KYLQIALDNNHNQE.L
 13.2    0.07   15  Q754X5|Q754X5_ASHGO E.KYLQIALDNNHNQE.L
 11.8   -0.04   18  Q75CM2|Q75CM2_ASHGO E.VQLVSFKLFLYDTE.S
  3.9    0.09                           M.TNKVFLSECMLQSE.K
  2.0    0.07   15  Q754X5|Q754X5_ASHGO E.KYLQIALDNNHNQE.L
Top scoring peptide matches to query 26
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 27
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 28
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 60.5   -0.01    1  Ssr1 E.SSHPLNDVAHFCTKE.S
Top scoring peptide matches to query 29
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
104.0    0.02    1  Ssr1 E.SSHPLNDVAHFCTKE.S
 10.5   -0.08            D.RHIKQAEKSVGMTQE.E
  5.6   -0.07            D.SATNFSKALNRFQKE.D
  0.4   -0.17            E.KRRDKNLKNVIINE.K
  0.0    0.01            D.FFNLVMSNQMTKHE.V
Top scoring peptide matches to query 30
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 31
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.9    0.05        E.LQRSMFEHNNKLSSE.H
Top scoring peptide matches to query 32
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 33
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 34
Score greater than 21 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.7    0.01    3  Fig2 E.QYVDVFYHFKSGGVSVE.A
Top scoring peptide matches to query 35
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 84.2    0.03    3  Fig2                E.QYVDVFYHFKSGGVSVE.A
 12.9    0.06   16  Q74ZH1|Q74ZH1_ASHGO E.NSWLSDAGLVANILNQNE.G
 12.9    0.06   16  Q74ZH1|Q74ZH1_ASHGO E.NSWLSDAGLVANILNQNE.G
  7.8    0.17                           E.GAYYNYHLNMINNNEE.I
  7.8    0.17                           E.GAYYNYHLNMINNNEE.I
  7.8    0.17                           E.GAYYNYHLNMINNNEE.I
  5.9   -0.09                           -.MAKQRGRKLLQKQNKD.D
  1.8   -0.09                           D.YGVAQDVNQLKRRKVGE.L
  1.4    0.06   16  Q74ZH1|Q74ZH1_ASHGO E.NSWLSDAGLVANILNQNE.G
  1.4    0.06   16  Q74ZH1|Q74ZH1_ASHGO E.NSWLSDAGLVANILNQNE.G
Top scoring peptide matches to query 36
Score greater than 22 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.6    0.01    2  Pir2 D.GPPPQAGAIYAKGWSITQE.G
Top scoring peptide matches to query 37
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
137.3    0.05    2  Pir2 D.GPPPQAGAIYAKGWSITQE.G
  5.2    0.13            D.MKTLRYGHVMIMTDQD.H
  4.4    0.13            D.MKTLRYGHVMIMTDQD.H
  2.6    0.03            E.KMVEWHAQRRRKSQD.G
  0.2    0.04            D.MLLGIQMCFALISSIKE.D
  0.0    0.19            -.MSLTNNQPVNLSQYTQE.Q
  0.0    0.19            -.MSLTNNQPVNLSQYTQE.Q
  0.0    0.19            -.MSLTNNQPVNLSQYTQE.Q
  0.0    0.19            -.MSLTNNQPVNLSQYTQE.Q
Top scoring peptide matches to query 38
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 39
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 40
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 41
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.8    0.02    2  Pir2 E.NIAPQCSPIKLQAIDLVTC.-
Top scoring peptide matches to query 42
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 92.4    0.04    2  Pir2 E.NIAPQCSPIKLQAIDLVTC.-
Top scoring peptide matches to query 43
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 44.3    0.17    2  Pir2 E.NIAPQCSPIKLQAIDLVTC.-
 41.3    0.17    2  Pir2 E.NIAPQCSPIKLQAIDLVTC.-
 20.6    0.17    2  Pir2 E.NIAPQCSPIKLQAIDLVTC.-
Top scoring peptide matches to query 44
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 45
Score greater than 20 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.1    0.11        E.GYQFAVLLQPPHVQGLCNE.R
  7.0    0.18        D.VEHYCLFTTSGNPGMSKKD.A
  6.7    0.28        D.CGMLTTPQLHFLTCACNE.R
  6.6    0.07        D.VFFKNYNTNPSQLKILNE.R
  6.6    0.07        D.VFFKNYNTNPSQLKILNE.R
  6.6    0.07        D.VFFKNYNTNPSQLKILNE.R
  6.3    0.21        -.MFSGFGSFGGGFVPMPQKFE.D
  4.7    0.07        -.MDHRTVGILGGGQLGRMIVE.A
  4.3    0.05        E.FQAGHIKNAINVSSRRELE.A
  4.3    0.05        E.FQAGHIKNAINVSSRRELE.A
Top scoring peptide matches to query 46
Score greater than 21 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein            Peptide
 11.7    0.01   19  Q74Z47|PPME1_ASHGO D.KELIIGQMQGKYQLVVFQE.S
  7.7    0.03                          E.GFSSQQTNYIIQLLLSVLNE.Q
  7.7    0.03                          E.GFSSQQTNYIIQLLLSVLNE.Q
  7.7    0.03                          E.GFSSQQTNYIIQLLLSVLNE.Q
  7.7    0.03                          E.GFSSQQTNYIIQLLLSVLNE.Q
  5.2    0.03                          D.VAQPDQARIIALNSHMFLKD.Q
  4.2    0.03                          D.VAQPDQARIIALNSHMFLKD.Q
  4.2    0.03                          D.VAQPDQARIIALNSHMFLKD.Q
  4.2    0.09                          E.QQEYLNTRFWILIGQINE.L
  4.2    0.09                          E.QQEYLNTRFWILIGQINE.L
Top scoring peptide matches to query 47
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 48
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 49
Score greater than 14 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 15.5    0.07   12  Q751L2|Q751L2_ASHGO D.NHMSSKKSTNPAVNLVAGGTAGLFE.A
  0.8    0.09                           D.GVFNKRTRNRRYSNYYHSND.Y
  0.3   -0.12                           D.AVGVADPFLQVELLYTLRRIFE.K
  0.3   -0.00                           D.QGLAQYLHSRRNLSQFMVSLAE.I
  0.3   -0.00                           D.QGLAQYLHSRRNLSQFMVSLAE.I
  0.2    0.12                           -.MREVISVNAVGQAGCQIGNACWE.L
  0.1   -0.18                           E.GLPIKINGKLERKMRVVQRAPE.N
Top scoring peptide matches to query 50
Score greater than 18 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.7   -0.03        D.GAILNILNQMSSKEVMYQPMKE.M
  5.3   -0.03        D.GAILNILNQMSSKEVMYQPMKE.M
Top scoring peptide matches to query 51
Score greater than 14 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6    0.01        E.AQMRHDSPAFSANSQFSCKMVGE.S
Top scoring peptide matches to query 52
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 53
Score greater than 13 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.3    0.14        D.RQLCKLIRYAYESMLLQFPYLE.N
  0.6    0.20        D.AVAVATGYYNMPFIPDRPGLKSWHE.T
  0.2   -0.06        D.AVLLTLTELFPLLPLLCSQLLLKPE.L
Top scoring peptide matches to query 54
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 55
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 56
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 57
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5    0.04        E.QLMYKGISMLINVLIISLSLIMCGSGD.V
Top scoring peptide matches to query 58
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 59
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.1   -0.42        E.VSKKGKKTRNTVKRTTELEPSPIMSIFGGE.Y
Top scoring peptide matches to query 60
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 61
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 62
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.5   -0.75        M.QSNLLQFSNLRTGNLRLASTNRGSANGGGSSTME.S
  3.5   -0.75        M.QSNLLQFSNLRTGNLRLASTNRGSANGGGSSTME.S
  3.2    0.08        E.GLGLGPLTPTQMNTMLLRHLRAVANHPCLLVD.H
  3.2    0.08        E.GLGLGPLTPTQMNTMLLRHLRAVANHPCLLVD.H
  2.6    0.07        E.GMVKMYKAEVLGKLPIMQHFFFSRFLPVPD.G
  2.6    0.07        E.GMVKMYKAEVLGKLPIMQHFFFSRFLPVPD.G
Top scoring peptide matches to query 63
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 64
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 65
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 66
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 67
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 68
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 69
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.4    0.05    5  Ecm33 E.VSMVQFQALPVVNNIVTSKLKTANDIVISNTNLRSIKE.F
Top scoring peptide matches to query 70
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 71
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 72
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 73
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 74
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 75
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 76
Score greater than 20 indicates homology
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.1   -0.59        E.LFALNKQAATAGLKAKPRISYNTVAGVNGPLVILERVKYPQYNE.I
  7.0   -0.22        D.VLLNAQPEPGVVMCAPSPSAMQLAILTNNANVITTMGQTCVGVSDE.R
  7.0   -0.22        D.VLLNAQPEPGVVMCAPSPSAMQLAILTNNANVITTMGQTCVGVSDE.R
  7.0   -0.22        D.VLLNAQPEPGVVMCAPSPSAMQLAILTNNANVITTMGQTCVGVSDE.R
  7.0   -0.22        D.VLLNAQPEPGVVMCAPSPSAMQLAILTNNANVITTMGQTCVGVSDE.R
Top scoring peptide matches to query 77
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 78
Score greater than 16 indicates homology
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.1    0.33        -.MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE.E
  3.1    0.33        -.MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE.E
  3.1   -0.66        -.MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE.E
  3.1   -0.66        -.MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE.E
  3.1   -0.66        -.MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE.E
  3.1   -0.66        -.MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAE.E
Top scoring peptide matches to query 79
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3   -0.01        E.NSPQLYNHLIRLGIRSSMYATQWFLTLFAYKFPLGFVLRILD.V
  8.3   -0.01        E.NSPQLYNHLIRLGIRSSMYATQWFLTLFAYKFPLGFVLRILD.V
Top scoring peptide matches to query 80
Score greater than 19 indicates homology
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.8    0.63        E.TYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMD.G
  6.8    0.63        E.TYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMD.G
  6.8    0.63        E.TYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMD.G
Top scoring peptide matches to query 81
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 82
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 83
Score greater than 20 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide