Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0396_q1.pkl
Database        : spombe A_gossypii (4731 sequences; 2318540 residues)
Timestamp       : 20 Apr 2007 at 12:17:27 GMT
Significant hits: Pir2                 AEL111Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Cwp1                 ABR025Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Ecm33                ABL063Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Sod1                 - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Gas1                 AGL352Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Fig2                 AFR711Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Q755B8|Q755B8_ASHGO  AFL095Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Q757W5|Q757W5_ASHGO  AEL103Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
                  Q751S4|Q751S4_ASHGO  AGL351Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 38 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    Pir2                              Mass: 33919    Score: 485    Queries matched: 11
 AEL111Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   407.29   812.56   812.49   0.08 0  44  0.011 1  R.IGAIVANR.Q
13   502.81   1003.60   1003.48   0.12 0  27  0.62 1  K.DPVTAVSCR.S
14   516.87   1031.72   1031.53   0.18 0  11  37 1  K.LQAIDLVTC.-
19   545.87   1089.73   1089.59   0.14 0  52  0.0026 1  R.SEGTLELTLK.D
43   736.44   1470.87   1470.69   0.18 1  59  0.00045 1  K.HDSKDPVTAVSCR.S
53   881.55   1761.08   1760.84   0.24 0  64  0.00016 1  Y.NLYDENIAPQCSPIK.L
56   918.06   1834.11   1833.90   0.21 0  133  2.1e-011 1  R.QFQFDGPPPQAGAIYAK.G
57   918.09   1834.16   1833.90   0.25 0  (54) 0.0019 1  R.QFQFDGPPPQAGAIYAK.G
59   946.60   1891.18   1890.93   0.25 1  52  0.0025 1  R.QFQFDGPPPQAGAIYAKG.W
68   1152.19   2302.37   2302.06   0.31 0  39  0.043 1  L.SGSFYNLYDENIAPQCSPIK.L
69   1208.74   2415.46   2415.14   0.32 0  19  4.6 1  C.LSGSFYNLYDENIAPQCSPIK.L

 
      Proteins matching the same set of peptides:
      Q757X3|Q757X3_ASHGO               Mass: 35909    Score: 485    Queries matched: 11
 AEL111Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)

2.    Cwp1                              Mass: 18217    Score: 450    Queries matched: 6
 ABR025Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   462.78   923.54   923.43   0.11 0  55  0.00089 1  K.GAFTAGSADK.A
31   649.39   1296.77   1296.60   0.17 0  46  0.0072 1  H.MSSVFEDNGALK.L
35   674.42   1346.82   1346.65   0.17 0  63  0.00018 1  -.DSEAFYFLSIR.S
50   839.03   1676.04   1675.83   0.22 0  152  2.3e-013 1  K.LGGSTADALSAVVTDDGK.L
63   987.57   1973.13   1972.87   0.27 0  67  6.8e-005 1  R.SASMYHMSSVFEDNGALK.L
67   1110.23   2218.45   2218.15   0.31 0  70  3.8e-005 1  S.SSPYELTLEQPGATSISVALR.A

 
      Proteins matching the same set of peptides:
      Q75DJ7|Q75DJ7_ASHGO               Mass: 20232    Score: 450    Queries matched: 6
 ABR025Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
3.    Ecm33                             Mass: 39065    Score: 357    Queries matched: 6
 ABL063Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   494.84   987.67   987.56   0.11 0  56  0.0011 1  K.LSGDLVISGK.Q
20   558.90   1115.79   1115.65   0.14 1  63  0.00026 1  K.KLSGDLVISGK.Q
38   691.99   1381.97   1381.79   0.17 0  59  0.00058 1  F.QALPVVNNIVTSK.L
41   716.49   1430.97   1430.74   0.23 0  18  9 1  K.TANDIVISNTNLR.S + Deamidation (NQ)
47   801.03   1600.05   1599.84   0.21 0  89  5.4e-007 1  K.VEEITGALVIADNEK.L
48   801.51   1601.00   1600.78   0.21 0  87  7.2e-007 1  K.VGGDVTFANNEHLTK.I

 
      Proteins matching the same set of peptides:
      Q75DT6|Q75DT6_ASHGO               Mass: 42563    Score: 357    Queries matched: 6
 ABL063Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
4.    Sod1                              Mass: 29874    Score: 169    Queries matched: 4
 - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
21   571.37   1140.72   1140.59   0.13 1  41  0.024 1  R.SLTIHNGDKR.L + Deamidation (NQ)
23   585.87   1169.72   1169.57   0.15 0  45  0.01 1  K.YGNIESNVFK.A
42   720.97   1439.92   1439.74   0.18 0  55  0.0013 1  Y.LGLYSSSPSFIGGR.S
49   829.47   1656.93   1656.71   0.22 0  35  0.1 1  K.DACYVAEFPQAGSDK.V

 
      Proteins matching the same set of peptides:
      Q750I5|Q750I5_ASHGO               Mass: 32063    Score: 169    Queries matched: 4
 Superoxide dismutase [Cu-Zn] - Ashbya gossypii (Yeast) (Eremothecium gossypii)
5.    Gas1                              Mass: 55771    Score: 143    Queries matched: 4
 AGL352Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
22   573.39   1144.76   1144.62   0.14 0  20  4.4 1  R.DIPYLQQLR.T
25   611.89   1221.77   1221.62   0.14 0  18  5.5 1  R.YTQVVDELQK.Y
32   653.42   1304.83   1304.67   0.17 0  54  0.0017 1  K.LSYLLNEYYK.A
45   747.94   1493.87   1493.68   0.19 0  59  0.00038 1  R.NSPEWSVELYDR.Y

 
      Proteins matching the same set of peptides:
      Q751P1|Q751P1_ASHGO               Mass: 58032    Score: 143    Queries matched: 4
 AGL352Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
6.    Fig2                              Mass: 55938    Score: 141    Queries matched: 2
 AFR711Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
33   659.93   1317.84   1317.68   0.16 0  61  0.00037 1  K.SGGVSVEAVSEGLK.V
60   953.10   1904.19   1903.94   0.25 0  82  2.6e-006 1  K.VTAPDCEALQSGMIVVSK.D

 
      Proteins matching the same set of peptides:
      Q751W4|Q751W4_ASHGO               Mass: 58053    Score: 141    Queries matched: 2
 AFR711Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
7.    Q755B8|Q755B8_ASHGO               Mass: 264560   Score: 95     Queries matched: 3
 AFL095Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   543.87   1085.73   1085.60   0.13 0  33  0.19 1  R.AWTVVNLQR.G
 35   674.42   1346.82   1346.72   0.10 0  8  60 10  L.TTTVIVTTCPVR.T
46   777.50   1552.98   1553.76   -0.78 0  63  0.00022 1  R.VFYVNTNNWAGIR.F + Deamidation (NQ)

8.    Q757W5|Q757W5_ASHGO               Mass: 20733    Score: 61     Queries matched: 1
 AEL103Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 53   881.55   1761.08   1760.84   0.24 0  64  0.00016 1  Y.NLYDQNIAPQCSPIK.L + Deamidation (NQ)

9.    Q751S4|Q751S4_ASHGO               Mass: 60203    Score: 39     Queries matched: 1
 AGL351Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 32   653.42   1304.83   1304.67   0.17 1  40  0.037 2  K.LSYLLNKYYQ.E + Deamidation (NQ)

10.   Gas5                              Mass: 47958    Score: 36     Queries matched: 1
 ADL021Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
36   679.91   1357.81   1357.64   0.17 0  36  0.085 1  R.EFGEVSSIFSEK.M

 
      Proteins matching the same set of peptides:
      Q75AD8|Q75AD8_ASHGO               Mass: 50313    Score: 36     Queries matched: 1
 ADL021Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
11.   Q75CR3|Q75CR3_ASHGO               Mass: 61978    Score: 36     Queries matched: 2
 ACL144Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 30   425.59   1273.76   1273.58   0.18 1  2  2.2e+002 8  K.DLQEGDLERAQ.L + Deamidation (NQ)
34   663.94   1325.86   1325.69   0.17 0  37  0.075 1  R.LEFYATGSPTLK.N

12.   Q755E4|Q755E4_ASHGO               Mass: 94569    Score: 33     Queries matched: 1
 AFL121Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   407.29   812.56   812.52   0.04 1  36  0.063 2  Q.LGAIVRGK.I

13.   Q751F6|Q751F6_ASHGO               Mass: 82275    Score: 30     Queries matched: 2
 AGL250Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   421.80   841.59   841.47   0.13 0  29  0.42 2  V.VAEASIPR.K
 19   545.87   1089.73   1089.57   0.16 1  6  1e+002 10  N.DTSKNGLDLK.T

14.   Q75D62|Q75D62_ASHGO               Mass: 44223    Score: 27     Queries matched: 1
 ABR161Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   407.29   812.56   812.49   0.08 0  27  0.5 3  F.VAALVQGR.D

15.   Q756H2|ENO_ASHGO                  Mass: 46660    Score: 25     Queries matched: 2
 Enolase (EC 4.2.1.11) (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate hydro-lyase) - Ashbya
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   468.28   467.27   467.20   0.07 0  12  0.53 1  R.YGASA.G
 5   407.29   812.56   812.49   0.08 1  13  14 9  Q.IKTGAPAR.S

16.   Q75EQ9|Q75EQ9_ASHGO               Mass: 126860   Score: 25     Queries matched: 1
 AAR020Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   558.90   1115.79   1115.60   0.19 1  28  0.78 2  L.DCPVIKISGK.T

17.   Q756G2|TOM1_ASHGO                 Mass: 373977   Score: 24     Queries matched: 1
 Probable E3 ubiquitin protein ligase TOM1 (EC 6.3.2.-) - Ashbya gossypii (Yeast) (Eremothecium goss
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   421.80   841.59   841.50   0.09 0  29  0.36 1  R.IGLSSIPR.L

18.   Q74ZZ1|Q74ZZ1_ASHGO               Mass: 175574   Score: 23     Queries matched: 2
 AGR066Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 56   918.06   1834.11   1833.92   0.19 1  28  0.66 5  L.HSRLGATLDGNEPLPEK.E + Deamidation (NQ)
 57   918.09   1834.16   1833.92   0.24 1  (14) 19 5  L.HSRLGATLDGNEPLPEK.E + Deamidation (NQ)

19.   Q74ZU9|Q74ZU9_ASHGO               Mass: 34550    Score: 22     Queries matched: 1
 AGR099Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   407.29   812.56   812.54   0.03 1  22  1.5 4  R.LKIVVLE.N

20.   Q75BP7|Q75BP7_ASHGO               Mass: 147717   Score: 21     Queries matched: 1
 ACR224Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii)
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   558.90   1115.79   1115.59   0.20 1  25  1.6 3  R.GALSVQRSLNA.Q + Deamidation (NQ)

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   439.76   877.50   877.35   0.15 0  18  4.5 1  FNYFQGT + 2 Deamidation (NQ)
55   909.57   1817.12   1816.79   0.33 0  17  8 1  QFNETYIADVTEEEK + 2 Deamidation (NQ)
29   637.41   1272.81   1272.71   0.10 1  16  8.9 1  IVAAMKQAQLAK + 2 Deamidation (NQ)
28   637.40   1272.79   1273.57   -0.78 0  12  25 1  QQSEQIESNLP + 2 Deamidation (NQ)
52   867.54   1733.07   1732.92   0.15 1  11  33 1  MNLVSNALKFTPVDGK
39   702.96   1403.91   1404.69   -0.78 1  10  42 1  MKQAVTLEEAQR + 2 Deamidation (NQ)
17   540.32   1078.63   1078.55   0.08 0  10  29 1  SQLYEVVIQ + Deamidation (NQ)
4   365.73   729.44   729.37   0.07 0  9  40 1  QGAQVVQ + Deamidation (NQ)
7   435.81   869.60   869.51   0.09 0  9  34 1  AVNAVAAVR
37   683.48   1364.94   1365.62   -0.68 1  9  61 1  LAKQQQQFMEN + 2 Deamidation (NQ)
65   1033.11   2064.21   2063.90   0.31 0  9  46 1  MQLLESDGENNSATVPSDR + 2 Deamidation (NQ)
44   744.49   1486.96   1487.72   -0.76 0  8  69 1  QQSLSQQQSLSPR + 2 Deamidation (NQ)
15   523.36   1044.70   1044.58   0.12 0  6  1e+002 1  TSNGVDVILK
10   491.29   980.57   980.40   0.17 1  6  71 1  SCGEASGRSA
27   629.90   1257.78   1257.64   0.15 0  6  94 1  AVTGIIHNFGQT + Deamidation (NQ)
30   425.59   1273.76   1273.68   0.08 1  5  98 1  HRGLYLESTAK
24   587.40   1172.78   1172.60   0.18 0  5  1.4e+002 1  QGVLSLGGESLN
26   614.38   1226.74   1226.59   0.15 1  5  97 1  KAAQRPSPDQE + Deamidation (NQ)
62   654.74   1961.19   1961.98   -0.79 1  5  1.4e+002 1  QEHYKDVLTAILSMNSI + Deamidation (NQ)
66   1061.62   2121.23   2121.00   0.23 1  4  1.3e+002 1  MLQANKASVSAGSTLNENQR + 3 Deamidation (NQ)
12   501.81   1001.60   1001.55   0.05 1  4  1.3e+002 1  NKLGLSVDR + Deamidation (NQ)
16   536.86   1071.71   1071.59   0.12 1  4  1.6e+002 1  VKQLENALR + 2 Deamidation (NQ)
51   846.99   1691.97   1691.79   0.18 1  4  1.3e+002 1  SQSSCVDERISATPR
3   668.44   667.43   667.34   0.09 0  3  88 1  THPGTR
40   708.98   1415.95   1415.79   0.16 1  2  3.1e+002 1  LRILNFNGVNVR + 2 Deamidation (NQ)
2   531.34   530.33   530.31   0.02 0  1  1.8e+002 1  VAAASI
70   1081.35   3241.03   3241.46   -0.44 1  0  2.7e+002 1  WGVQNDQSANPSVASSVAEKNAPGVPDDSEGK + 2 Deamidation (NQ)
54   600.35   1798.02        
58   619.72   1856.15        
61   642.70   1925.09        
64   689.06   2064.17        
71   1126.30   3375.88        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 71

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 15 indicates homology
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein          Peptide
 11.8    0.07   15  Q756H2|ENO_ASHGO R.YGASA.G
  2.4    0.06                        HPGGT
Top scoring peptide matches to query 2
Score greater than 13 indicates homology
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.9    0.02        R.VAAASI.V
  0.9    0.02        R.VAAASL.E
Top scoring peptide matches to query 3
Score greater than 15 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.4    0.09        L.THPGTR.D
  2.5   -0.00        R.VPALIR.N
Top scoring peptide matches to query 4
Score greater than 18 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3    0.07        K.QGAQVVQ.T
  5.2    0.15        K.KEDSNH.D
  4.5    0.07        K.AAQNVLN.S
  3.3   -0.02        S.FVVPIR.F
  3.3   -0.02        V.FVVPLR.N
  3.2    0.04        K.AAQNLTL.E
  2.1    0.06        H.NSGSPLR.R
  1.9    0.11        R.GAYKEY.I
  1.9    0.06        R.RNQLAQ.Q
  1.4    0.07        K.QAAVVDQ.G
Top scoring peptide matches to query 5
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 43.8    0.08    1  Pir2                R.IGAIVANR.Q
 36.3    0.04   12  Q755E4|Q755E4_ASHGO Q.LGAIVRGK.I
 27.3    0.08   14  Q75D62|Q75D62_ASHGO F.VAALVQGR.D
 22.4    0.04                           K.IKLVPLM.K
 22.4    0.03   19  Q74ZU9|Q74ZU9_ASHGO R.LKIVVLE.N
 19.8    0.10                           G.LGPSQRR.D
 19.3    0.08                           P.LAGLGLNR.T
 13.2    0.15                           H.AVADGAGPR.E
 12.9    0.08   15  Q756H2|ENO_ASHGO    Q.IKTGAPAR.S
 12.2    0.08                           S.LQLGNLR.Q
Top scoring peptide matches to query 6
Score greater than 30 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 29.4    0.09   17  Q756G2|TOM1_ASHGO   R.IGLSSIPR.L
 28.7    0.13   13  Q751F6|Q751F6_ASHGO V.VAEASIPR.K
 15.9    0.13                           R.GTLEAVPR.R
 14.2    0.15                           R.NRIEGRP.L
 14.2    0.09                           H.SAILVSPR.S
 13.1    0.10                           R.AVVTIPSGV.K
 13.0    0.10                           R.AEALVLQV.D
 12.2    0.14                           R.VATVLPQD.E
 12.2    0.10                           N.VATVPLDK.T
 11.7    0.16                           L.AAEEPAVR.A
Top scoring peptide matches to query 7
Score greater than 20 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.2    0.09        T.AVNAVAAVR.V
  7.2    0.13        N.AVKGNQPR.Q
  7.2    0.13        N.AVKGNQPR.Q
  6.4    0.09        I.GQVAVAVAR.A
  5.7    0.08        K.IGKIQTPL.Q
  4.7    0.07        G.IGGGGIGVIK.L
  2.3    0.19        K.AAQPKPEE.A
  2.2    0.14        L.AAAANVPEK.A
  2.0    0.11        Q.GLDLSIPR.E
  2.0    0.18        R.VATAEHVGS.A
Top scoring peptide matches to query 8
Score greater than 27 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.4    0.15        R.FNYFQGT.S
 13.1    0.12        K.AYNPANVE.S
 10.7    0.12        K.AQGRTTNE.L
  9.6    0.17        R.DALNNNNT.K
  9.6    0.17        K.TNPTNNNT.N
  9.6    0.10        R.TTLVDNNT.W
  9.1    0.17        R.DALNNNNT.K
  9.1    0.17        K.TNPTNNNT.N
  8.4    0.05        M.MMVARVAT.A
  8.2    0.12        K.ASRSNVDQ.K
Top scoring peptide matches to query 9
Score greater than 33 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 54.6    0.11    2  Cwp1 K.GAFTAGSADK.A
 17.7    0.11            Y.SGKFGADDK.D
 14.9    0.03            Y.KFGLGSSTK.D
 13.5    0.14            K.QFDNSEGK.S
 11.5    0.21            K.GCNDGSADK.F
 10.8    0.11            K.NDFAKSAAT.I
 10.3    0.08            D.FIESATEK.A
  9.6   -0.00            V.PPKPKTEK.A
  9.5    0.14            G.FQTGNNDK.D
  8.0    0.10            S.KSSVSCQK.H
Top scoring peptide matches to query 10
Score greater than 18 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.8    0.17        R.SCGEASGRSA.G
  5.5    0.15        L.NDTVMSGTR.S
  5.0    0.08        A.MNTSKSSVK.T
  4.3    0.13        L.QVFTDDAGK.H
  3.7    0.22        S.SDESDDEGK.K
  3.3    0.15        N.GFQTGNNDK.D
  3.3    0.15        N.GFQTGNNDK.D
  3.3    0.08        N.NAFSAKQSK.R
  3.0    0.06        S.FNGTKWTK.R
  2.7    0.17        K.STSGTQNDTA.S
Top scoring peptide matches to query 11
Score greater than 35 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 55.6    0.11    3  Ecm33 K.LSGDLVISGK.Q
 19.1    0.11             K.LSATVLQGLS.R
 16.5    0.14             H.LSGDTAGLVR.K
 15.5    0.11             R.LSQVSTLIQ.R
 15.5    0.13             K.NCKVLLLGA.G
 14.7    0.07             V.LATVTVTRK.M
 14.3    0.19             A.TVGNWPWK.T
 11.7    0.11             T.INDSSVILK.T
 11.2    0.08             H.TISALATALK.Q
 10.8    0.19             K.EASPTVEKGA.N
Top scoring peptide matches to query 12
Score greater than 13 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.0    0.05        Y.NKLGLSVDR.T
  0.4    0.09        K.LGGENPSKVT.N
  0.2    0.10        R.FPPLGAGIAC.D
  0.1    0.14        R.VPNRANVAC.L
Top scoring peptide matches to query 13
Score greater than 21 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 27.1    0.12    1  Pir2 K.DPVTAVSCR.S
  6.7    0.19            K.PDEAAACNR.L
  6.7    0.05            C.VLEAARSMK.D
  6.3    0.09            K.KINGAAMSVN.P
  6.2    0.03            R.LVVFKGDLN.Y
  4.7    0.05            V.LVSLVASCR.I
  3.8    0.10            R.AIVQATTHY.M
  2.8    0.08            R.APKGALMYGP.P
  2.7    0.06            K.AINLANQIF.G
Top scoring peptide matches to query 14
Score greater than 20 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.1    0.18    1  Pir2 K.LQAIDLVTC.-
  6.5    0.22            K.VAAADLVNCV.I
  4.6    0.15            P.QIANMIITK.A
  4.2    0.18            H.LQAINLISC.-
  4.0    0.12            N.DILAKPFTK.D
  3.4    0.16            Q.KLANLSQTR.F
  2.2    0.17            R.LNALKTANSV.A
  1.3   -0.78            K.LAKDLQDTE.R
  1.2    0.17            K.NKLAILDSAS.P
  0.9    0.23            Q.GLADSDNALR.L
Top scoring peptide matches to query 15
Score greater than 18 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.1    0.12        T.TSNGVDVILK.Y
  5.5    0.03        Q.IGNKFILLK.L
  5.4   -0.76        A.EEREPDSGK.L
  3.5    0.16        R.LGSIPLSSNAS.S
  3.2    0.21        R.GMAVPEGQKQ.G
  3.0    0.13        E.GIAMLREAGK.E
  2.8    0.22        I.KEDGTPGGER.L
  2.1    0.05        T.GLSSILKSIK.Y
  1.7    0.16        Q.QGSNVQVAIK.A
  1.0    0.12        T.STQSALPTLK.T
Top scoring peptide matches to query 16
Score greater than 15 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.8    0.12        F.VKQLENALR.F
  2.8    0.13        R.KELVQQLDV.L
  2.5    0.13        K.KETSLEAPVV.L
  2.5    0.01        K.QKILLLFVV.R
  2.4    0.13        K.QKAAINDLVV.G
  2.3    0.17        R.INELELIND.L
  2.2    0.09        V.VVGTIDNLLK.G
  2.1    0.17        K.TLGDLPNGSVV.G
  2.1    0.13        K.KLDLNQLQV.R
  2.1    0.13        K.KLDLNQLQV.R
Top scoring peptide matches to query 17
Score greater than 22 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.0    0.08        K.SQLYEVVIQ.A
  9.3    0.02        K.NDVILHKQL.P
  9.0    0.14        R.NNVIFASAADG.W
  9.0    0.14        R.NNVIFASAADG.W
  8.2    0.08        R.ATAYDVVDLL.L
  7.5    0.09        H.VNDIYSVNR.R
  6.6    0.24        K.FMYYNDEP.D
  5.2    0.03        G.TINFDKLTK.S
  5.1    0.04        K.KLSEYDVLL.D
  4.9    0.16        L.DGFRENGQR.F
Top scoring peptide matches to query 18
Score greater than 28 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 33.0    0.13    7  Q755B8|Q755B8_ASHGO R.AWTVVNLQR.G
 13.2    0.19                           A.EKAEQPQQK.E
 12.8    0.23                           V.QRNEPPSEK.E
 12.6    0.08                           L.QKLSLDLLR.V
 10.8    0.18                           H.QQTLNPTQR.I
 10.0   -0.76                           K.EGAPQAAGKEE.S
  8.9    0.19                           A.EKAEQPQQK.E
  8.6    0.11                           N.QQTLKQLAR.R
  8.5    0.16                           S.NAALQELLGR.H
  8.4    0.17                           R.FEVGPVVPWG.R
Top scoring peptide matches to query 19
Score greater than 37 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 52.3    0.14    1  Pir2                R.SEGTLELTLK.D
 21.1    0.17                           Q.QSGSLLQNIK.S
 11.8    0.19                           E.SGETNAGISVR.R
 11.0    0.14                           R.TASTIGILVNT.L
  7.3    0.17                           S.SESGQLLIDK.A
  6.7    0.19                           P.ESRTLEQAR.T
  6.5    0.22                           D.QSSESPLWR.K
  6.5    0.21                           E.TSNALGQGWR.L
  6.4    0.15                           K.RFGLEGLEAV.V
  6.4    0.16   13  Q751F6|Q751F6_ASHGO N.DTSKNGLDLK.T
Top scoring peptide matches to query 20
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 63.1    0.14    3  Ecm33               K.KLSGDLVISGK.Q
 28.3    0.19   16  Q75EQ9|Q75EQ9_ASHGO L.DCPVIKISGK.T
 25.2    0.20   20  Q75BP7|Q75BP7_ASHGO R.GALSVQRSLNA.Q
 16.1    0.23                           K.KNLDIWQAAG.A
 15.8   -0.79                           F.QVDQLKTER.K
 15.5   -0.75                           K.KNLDIWQAAG.A
 11.9    0.19                           R.KINVQDALLT.N
 11.7    0.16                           C.KLLGLSTNNR.A
 11.7    0.16                           C.KLLGLSTNNR.A
 11.7    0.26                           R.QLGEERQAW.E
Top scoring peptide matches to query 21
Score greater than 29 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 41.0    0.13    4  Sod1 R.SLTIHNGDKR.L
 13.7    0.07            F.SITLPALSSPR.I
  8.2    0.20            K.AEDSHLANQR.E
  8.2    0.04            G.SLLHFIKQR.L
  6.8    0.17            V.AEITQAHESR.I
  6.7   -0.74            E.SYSSGNENGAR.G
  6.7   -0.74            E.SYSSGNENGAR.G
  4.4    0.13            I.TITVHNGDRK.H
  3.5    0.14            Q.NGELQPVLNR.T
  3.1    0.13            P.KSSPVNQPQR.H
Top scoring peptide matches to query 22
Score greater than 18 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.9    0.14    5  Gas1 R.DIPYLQQLR.T
  3.9    0.08            K.LDFILLLLQG.S
  3.9    0.21            R.VEEMIKYSF.G
  1.7    0.17            K.LDGGKQQWTL.S
  0.9    0.18            S.NNKNSEGIIR.I
  0.9   -0.71            R.YYYSDEHAV.P
  0.9   -0.75            K.YYYYKSYP.R
  0.8    0.16            P.SIINNLAAQAK.T
  0.7   -0.79            K.ENVTVLGQGIN.E
  0.7    0.13            V.DLIDSLALSAK.A
Top scoring peptide matches to query 23
Score greater than 25 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 44.8    0.15    4  Sod1 K.YGNIESNVFK.A
  9.3    0.11            D.YITQSFAALR.S
  7.7    0.24            A.YWQDQLCR.I
  6.3    0.10            V.YGPFPVLYSK.Y
  6.1    0.25            P.STMQEMDGGSK.L
  4.7    0.32            P.SGQCCEDGEK.S
  4.3    0.16            S.YGFQLANNIK.L
  4.2    0.14            R.GGRSHVEVQTT.H
  2.7    0.20            R.YNSTKSVDEQ.T
  1.5    0.23            R.KSPYNSSANSD.Y
Top scoring peptide matches to query 24
Score greater than 17 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.0    0.18        K.QGVLSLGGESLN.F
  4.1    0.11        Q.QLQTSINLKK.Q
  4.0   -0.78        K.QPQAGSSSVNSI.S
  2.5    0.17        L.QKDPWGTLTK.G
  2.4    0.11        S.LKGSDNVISIK.T
  2.0    0.18        L.PNSNIKVADSK.D
  1.5    0.18        T.GAIDKGLDEQK.Y
  0.2    0.18        S.LQQSFPPDLK.E
Top scoring peptide matches to query 25
Score greater than 27 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.0    0.14    5  Gas1 R.YTQVVDELQK.Y
 13.7    0.08            A.APSHVVGISVTR.V
  2.2    0.21            M.LNFNTDSPEGK.A
  2.0    0.21            K.DMEDDITQKK.E
  1.7    0.16            A.NDYVGKGLSGGR.I
  1.6    0.06            H.AHGKVILEVEK.F
  1.2    0.14            P.ELAEYSAAQLK.E
  1.0    0.21            R.ASAYVNNSAVEP.Q
  0.8    0.28            R.DEMLNQADSAE.V
  0.1    0.14            P.DYDNLTLLQK.V
Top scoring peptide matches to query 26
Score greater than 14 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.9    0.15        R.KAAQRPSPDQE.D
  1.6    0.20        R.FLNQEQPTFT.Q
Top scoring peptide matches to query 27
Score greater than 15 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6    0.15        R.AVTGIIHNFGQT.P
  2.0    0.18        R.DDICEALLRGP.E
  1.4    0.17        C.TPEQVEGEIEK.C
  1.1    0.13        S.FQHIARETGAK.V
  0.8   -0.79        W.TEHDHHNIQK.R
  0.8    0.09        T.TNLLLNNTINK.T
  0.8    0.09        T.TNLLLNNTINK.T
  0.8    0.09        T.TNLLLNNTINK.T
  0.7    0.17        L.TPQALNEQNIK.K
  0.7    0.17        L.TPQALNEQNIK.K
Top scoring peptide matches to query 28
Score greater than 22 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.6   -0.78        R.QQSEQIESNLP.N
  9.3    0.21        R.QQSEQIESNLP.N
  9.3    0.21        R.QQSEQIESNLP.N
  8.9    0.15        K.EGRLSEEQAVR.I
  4.7   -0.78        R.QQSEQIESNLP.N
  4.7   -0.78        R.QQSEQIESNLP.N
  3.8    0.17        T.NSAASDVIPPSSK.T
  3.6    0.12        A.DKTEQVIANVR.N
  3.1    0.21        R.QQSEQIESNLP.N
  2.5   -0.78        K.NSQGLTLEQQGP.S
Top scoring peptide matches to query 29
Score greater than 27 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.4    0.10        G.IVAAMKQAQLAK.A
 13.5    0.23        Y.GANADPNTLAEAK.R
 13.4    0.10        N.LLIARTDSANAK.L
 12.5    0.14        L.EDAGTLRAELAK.I
 12.4    0.13        K.IGMIIGIENDAK.T
 12.3    0.06        Y.LKSVPFLPSSAK.E
 12.2   -0.79        D.DHLGSYAPNTAK.K
 12.1    0.11        A.QRHQLTPPPAK.E
 11.5    0.04        P.ESVSKLLVSIAK.F
 11.2    0.14        R.EANLNSLVRVTG.V
Top scoring peptide matches to query 30
Score greater than 17 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
  5.2    0.08                           S.HRGLYLESTAK.D
  4.6   -0.02                           D.AVKFLNGLITAK.L
  4.2    0.16                           S.GFGSHAGTQNVAK.A
  3.3    0.03                           I.AVFLNILAGLDK.N
  2.7    0.09                           G.GPDFGPSGKITAK.S
  2.6    0.11                           E.NSVDQIKDVGAK.W
  1.8    0.08                           Q.VAEMARQTVAAK.E
  1.6    0.18   11  Q75CR3|Q75CR3_ASHGO K.DLQEGDLERAQ.L
  1.6    0.09                           K.ADDVIPLHVPAQ.S
  1.2    0.17                           D.HEQLGFQESAK.A
Top scoring peptide matches to query 31
Score greater than 23 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.2    0.17    2  Cwp1 H.MSSVFEDNGALK.L
  8.1    0.15            G.SMGYLQNLIEK.A
  5.9    0.18            G.VTSNVDFFDPR.L
  5.4    0.13            K.ASFMINIGMISI.L
  3.9    0.08            K.HLNWLKTWSI.A
  3.7    0.15            R.SMVSEFKLLDE.G
  2.6   -0.77            R.NNSAQSLASQYN.S
  2.6   -0.77            R.NNSAQSLASQYN.S
  2.0    0.14            L.HTPSEDEITIR.G
  1.0   -0.70            R.SAEHKQCYNC.G
Top scoring peptide matches to query 32
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 53.7    0.17    5  Gas1                K.LSYLLNEYYK.A
 40.4    0.17    9  Q751S4|Q751S4_ASHGO K.LSYLLNKYYQ.E
 33.1    0.17    9  Q751S4|Q751S4_ASHGO K.LSYLLNKYYQ.E
 21.8    0.12                           L.ISYLVPRSDQK.A
 14.7    0.06                           L.LSYLNLITVLR.K
 11.4    0.18                           R.QAFQKLELPTE.R
 11.3    0.06                           R.YSLLLNTQKLL.Q
  9.8    0.24                           E.SFEQFINEYK.H
  9.0   -0.68                           K.NSYGSKNSYGND.N
  7.0    0.28                           R.EAYEHVLSQND.R
Top scoring peptide matches to query 33
Score greater than 38 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 60.5    0.16    6  Fig2 K.SGGVSVEAVSEGLK.V
 21.4   -0.73            R.QLFGDAAEDAAPD.H
 11.3    0.15            V.SGGVSSLRQADLK.D
  6.3    0.13            S.VKASTETTISPGK.E
  6.2    0.25            H.NGTNEGEGLQGSR.Y
  4.8    0.24            R.QQELADVSDGRV.P
  2.9   -0.79            V.VVSTDAGSGASSPGK.T
  2.2   -0.79            R.DSVANLQSTVQR.Q
  2.1   -0.73            W.QESSTIEENPW.-
  2.0    0.23            K.NSVSNGALFHMAA.R
Top scoring peptide matches to query 34
Score greater than 29 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 37.2    0.17   11  Q75CR3|Q75CR3_ASHGO R.LEFYATGSPTLK.N
 14.2    0.12                           E.LEFYTGIISRK.D
  3.2    0.16                           I.LQFEPSGHLLGK.F
  2.4    0.20                           N.ELFDSMKSELK.S
Top scoring peptide matches to query 35
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 62.8    0.17    2  Cwp1                DSEAFYFLSIR
 21.9    0.18                           G.SDFAQQGLPLDR.Q
 11.7    0.17                           R.SNSAASIALQAVVD.A
 11.3    0.18                           G.SDFAQQGLPLDR.Q
  8.0    0.19                           K.QQLSDPQFISSP.R
  8.0    0.19                           K.QQLSDPQFISSP.R
  8.0    0.19                           K.QQLSDPQFISSP.R
  8.0    0.20                           D.SDSLFDKCFTK.N
  7.6    0.09                           R.TTISNDGATILKL.L
  7.6    0.10    7  Q755B8|Q755B8_ASHGO L.TTTVIVTTCPVR.T
Top scoring peptide matches to query 36
Score greater than 23 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.9    0.17   10  Gas5 R.EFGEVSSIFSEK.M
  8.5    0.21            L.TAVHTEADASEQV.-
  0.2    0.16            R.LDALMDETPPRT.G
Top scoring peptide matches to query 37
Score greater than 16 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.2   -0.68        K.LAKQQQQFMEN.N
  9.2   -0.68        K.LAKQQQQFMEN.N
  9.2   -0.68        K.LAKQQQQFMEN.N
  3.1   -0.74        R.VLSGEFQIVNPY.L
  2.2    0.24        R.VLSGEFQIVNPY.L
  2.1   -0.70        K.LMLSSGRDNTCI.L
  1.4   -0.68        K.LAKQQQQFMEN.N
  1.4   -0.68        K.LAKQQQQFMEN.N
  1.4   -0.68        K.LAKQQQQFMEN.N
  1.2    0.36        K.AGGTEEDRGSAGSAT.D
Top scoring peptide matches to query 38
Score greater than 29 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 59.2    0.17    3  Ecm33 F.QALPVVNNIVTSK.L
 12.7    0.26             R.KALPAVGTNAPEDV.M
  9.7    0.14             L.QALEAIKLLVQR.Q
  8.3   -0.74             L.QALPAQWEVWR.E
  7.9    0.29             R.GAALKIGQMMSFQ.D
  7.9    0.29             R.GAALKIGQMMSFQ.D
  5.7   -0.80             R.VTLPPLASLLQSSG.Y
  4.9    0.17             K.QALLIPGQTSNKL.L
  4.3   -0.73             R.SIIPQHEWNFI.R
  4.0    0.19             M.AQIVSVSLVPQAAV.S
Top scoring peptide matches to query 39
Score greater than 21 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3   -0.78        H.MKQAVTLEEAQR.R
  7.4    0.24        W.TTGEPTNPEFRR.T
  6.9   -0.77        R.TVSVQSQQSAVGGTG.A
  5.4   -0.77        R.MAAADMGKAVADVR.Q
  5.2   -0.79        R.FQLAAADNLRAGGT.L
  5.1    0.21        H.MKQAVTLEEAQR.R
  4.5   -0.75        L.EGNSGCTAAVGILR.W
  4.4    0.31        N.TSAYYPSMNVNR.W
  3.9    0.19        P.KTPLQMAMDTLR.R
  3.5   -0.76        V.EMQHYKEQALK.Y
Top scoring peptide matches to query 40
Score greater than 14 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.9    0.16        F.LRILNFNGVNVR.L
  1.9    0.16        F.LRILNFNGVNVR.L
  1.9    0.16        F.LRILNFNGVNVR.L
  1.0   -0.72        Y.NATIFAYGMTGSGK.T
Top scoring peptide matches to query 41
Score greater than 25 indicates homology
Score greater than 40 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.6    0.23    3  Ecm33 K.TANDIVISNTNLR.S
 11.3    0.19             R.SNFIQDLVLQVGV.H
 10.7    0.23    3  Ecm33 K.TANDIVISNTNLR.S
 10.1    0.23    3  Ecm33 K.TANDIVISNTNLR.S
  9.2   -0.68             S.GTANEASGEPNKQK.L
  8.8   -0.75    3  Ecm33 K.TANDIVISNTNLR.S
  8.7   -0.67             R.DVSTDPNSATPLES.I
  6.5   -0.79             R.SNFIQDLVLQVGV.H
  5.6    0.28             A.DATINVWRGDER.W
  5.3    0.21             S.TKNQIDTLIDIR.K
Top scoring peptide matches to query 42
Score greater than 31 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 54.9    0.18    4  Sod1 Y.LGLYSSSPSFIGGR.S
 15.5    0.29            K.HDHITQSSSEIW.G
  7.9    0.33            C.NEASDSEYNFHK.T
  6.8    0.34            P.SDMLQFPSENDR.Q
  6.7    0.23            R.AWLSFTNSSNLVT.W
  6.3   -0.73            D.CSSSLSSETQSLR.Q
  5.9    0.26            S.MSSNNSSITQRSK.D
  4.6    0.18            E.LGLGHVKCSGAWR.R
  4.5   -0.78            Q.GIPPQQFANPPQF.-
  4.5   -0.78            Q.GIPPQQFANPPQF.-
Top scoring peptide matches to query 43
Score greater than 35 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 58.6    0.18    1  Pir2 K.HDSKDPVTAVSCR.S
 19.2    0.10            K.PNPSADPVFSKAIK.V
 10.2    0.11            S.NHSLNQLVKDFR.M
  8.3    0.10            D.PTLRDVGGADQITK.V
  7.8    0.16            D.PLGSLNDAHYNLR.I
  7.2    0.04            V.RTPIPNAALYTVR.N
  7.1    0.11            L.FRFIIDPSSYAR.S
  7.0    0.19            S.SENSFAGFVSRNR.T
  6.7    0.20            A.PEEAEDAFHASLR.R
  6.3    0.23            N.GGYTFGPFDPEQR.L
Top scoring peptide matches to query 44
Score greater than 20 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.2   -0.76        Q.QQSLSQQQSLSPR.Q
  7.9   -0.75        R.GTPSQVAVSDSLAANA.S
  7.0    0.20        V.RAENPGISFGQVGR.V
  7.0   -0.79        V.RAENPGISFGQVGR.V
  7.0    0.25        V.ESLEFNRHEVAR.Q
  7.0    0.16        R.GSSLCNIAILVIDI.M
  7.0    0.19        N.SHAYVFVNQPGLR.L
  7.0    0.18        Q.TQLNQALALMGGLR.I
  6.7    0.11        R.INELTIEKSLTIL.K
  5.9    0.24        G.EEVINDLDTLGNR.A
Top scoring peptide matches to query 45
Score greater than 27 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 59.0    0.19    5  Gas1 R.NSPEWSVELYDR.Y
 55.6   -0.79    5  Gas1 R.NSPEWSVELYDR.Y
 10.5    0.25            R.QLGDGTEVEDPYGN.I
  8.6   -0.73            R.QLGDGTEVEDPYGN.I
  7.4    0.05            D.SDPKSVSLINGHLK.L
  6.3    0.15            F.SAQSGESYASVRPR.S
  6.0    0.08            G.SLKVSVHTERPQGG.-
  5.3    0.06            M.SNLLPVNNTPRNR.D
  5.0    0.09            K.LPIELVYKGNDFS.R
  4.7    0.11            K.SNRVGGVKPFSAEF.G
Top scoring peptide matches to query 46
Score greater than 34 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 62.8   -0.78    7  Q755B8|Q755B8_ASHGO R.VFYVNTNNWAGIR.F
 60.9    0.20    7  Q755B8|Q755B8_ASHGO R.VFYVNTNNWAGIR.F
 60.5   -0.78    7  Q755B8|Q755B8_ASHGO R.VFYVNTNNWAGIR.F
 48.6   -0.78    7  Q755B8|Q755B8_ASHGO R.VFYVNTNNWAGIR.F
 17.5   -0.71                           G.GQHSGRTNNSDPQR.G
 17.3    0.27                           G.GQHSGRTNNSDPQR.G
  9.5    0.23                           K.NMMLQILEGINYI.H
  9.0   -0.71                           G.GQHSGRTNNSDPQR.G
  8.0    0.25                           K.MDYIAELEEKLEA.I
  7.6    0.12                           P.VFFNILISPFVTR.L
Top scoring peptide matches to query 47
Score greater than 36 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 89.3    0.21    3  Ecm33 K.VEEITGALVIADNEK.L
 18.1    0.27             E.DELLTIPGGEADAGSR.R
 15.6    0.23             A.AAPGTCPRTIAFNPK.Y
 15.6    0.18             P.EVLDRSLVDQWIK.T
 11.2    0.33             M.NSRFDQYLDAENK.I
 11.1    0.25             K.QVEKTLNISDPVEQ.Q
 10.4    0.16             Q.LEDVIAAALQATTRK.L
  8.1   -0.72             R.NERLYHSVFPQNP.L
  8.1   -0.79             E.ELNSQLQLSDNLVK.L
  7.8    0.29             A.QVEFTAAPAASGADHK.-
Top scoring peptide matches to query 48
Score greater than 30 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 87.5    0.21    3  Ecm33 K.VGGDVTFANNEHLTK.I
 19.0   -0.77    3  Ecm33 K.VGGDVTFANNEHLTK.I
 14.4   -0.77    3  Ecm33 K.VGGDVTFANNEHLTK.I
 12.5    0.17             A.VQTAEQDPRVMLSK.D
 12.3    0.21             G.KLSADCQQLQGAPGK.I
  9.3    0.10             K.SLLNTPVFVVGRATQ.E
  9.0    0.30             N.NNVNNNGQQSTPPSK.L
  7.2    0.13             T.QTTPGGTTVTTLVPTK.N
  6.7    0.13             Q.LSQLSVIDVGSNQLK.Y
  6.7    0.13             Q.LSQLSVIDVGSNQLK.Y
Top scoring peptide matches to query 49
Score greater than 25 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 34.5    0.22    4  Sod1 K.DACYVAEFPQAGSDK.V
 13.7   -0.76    4  Sod1 K.DACYVAEFPQAGSDK.V
 10.6    0.12            P.QTVDYITRNGYAQK.V
 10.2   -0.79            T.FEQARSEEAFDNSK.L
  2.6    0.18            K.SWSYNPISLVSMCL.V
  1.1    0.13            T.GNSRSTLSGSTVESFK.S
  0.7   -0.67            R.QSSSSEDQQNTDMNS.Q
  0.1   -0.03            R.KNVPAPISVPPNPVTK.N
Top scoring peptide matches to query 50
Score greater than 38 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
152.5    0.22    2  Cwp1 K.LGGSTADALSAVVTDDGK.L
 15.7    0.23            L.RSAGNWSLGLQETEK.S
 10.1    0.15            A.ENEVYGAKLWAGLVK.E
  9.7    0.19            R.FAQVIDESLAVLQQL.S
  9.3    0.32            R.NPQNDESSMALLNEI.I
  8.9    0.32            R.NPQNDESSMALLNEI.I
  8.1    0.13            R.LGGSLLAHKIAEEEPI.R
  8.0    0.32            R.NPQNDESSMALLNEI.I
  7.9    0.25            K.GVTTAGNASQVSDGAAGVL.L
  7.1    0.16            C.SSGSDISVGIVLAALCK.N
Top scoring peptide matches to query 51
Score greater than 16 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6    0.18        A.SQSSCVDERISATPR.S
  3.3    0.22        P.QSFNATICCVSFMK.R
  3.3    0.13        R.SKFANTLTDDPLGSLN.D
  3.3    0.09        A.SKQTFGQLAESLDLR.V
  2.9   -0.76        P.QSFNATICCVSFMK.R
  1.5    0.15        V.VNQLLTEMDGMNAKK.N
  1.5    0.10        Q.FILHGNVYVNGVTMK.H
  1.5    0.23        K.FMFDKLFDVDASQQ.D
  1.5    0.19        K.STMDVNVYLPVQYY.K
  1.5    0.15        I.WNGNPLVDFASEKSK.S
Top scoring peptide matches to query 52
Score greater than 20 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.9    0.15        V.MNLVSNALKFTPVDGK.V
  6.5    0.18        A.GLGSSASIAVCLALAMGR.L
  5.8    0.15        V.VAGGLGHPHGVYDTLLK.E
  4.9    0.03        G.QPIILTGAPAINKVLGK.E
  4.9    0.16        K.TAYPLLALSLESLVDQ.I
  4.5    0.19        R.QPSADVMLGTLLRFGQ.A
  3.7    0.18        K.KLVNHGQAILCTIHQ.P
  3.5    0.18        D.YNTTHLITRTPGTMK.A
  3.1    0.11        F.QVGLLSTLPFFERAR.E
  2.9    0.24        R.GGSIGQETISTGKMPVGN.M
Top scoring peptide matches to query 53
Score greater than 37 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 64.0    0.24    1  Pir2                Y.NLYDENIAPQCSPIK.L
 64.0    0.24    8  Q757W5|Q757W5_ASHGO Y.NLYDQNIAPQCSPIK.L
 51.2   -0.75    1  Pir2                Y.NLYDENIAPQCSPIK.L
 51.2   -0.75    8  Q757W5|Q757W5_ASHGO Y.NLYDQNIAPQCSPIK.L
 50.0    0.24    8  Q757W5|Q757W5_ASHGO Y.NLYDQNIAPQCSPIK.L
 47.9   -0.75    8  Q757W5|Q757W5_ASHGO Y.NLYDQNIAPQCSPIK.L
 33.5   -0.75    1  Pir2                Y.NLYDENIAPQCSPIK.L
 33.5   -0.75    8  Q757W5|Q757W5_ASHGO Y.NLYDQNIAPQCSPIK.L
 29.2    0.24    8  Q757W5|Q757W5_ASHGO Y.NLYDQNIAPQCSPIK.L
 20.4    0.39                           K.NSNNNNNQINQNNEQ.L
Top scoring peptide matches to query 54
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 55
Score greater than 24 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.1    0.33        L.QFNETYIADVTEEEK.L
 17.0    0.29        K.EQQRLQDNLQGLDISG.G
 10.5    0.29        K.EQQRLQDNLQGLDISG.G
  9.9    0.16        K.TGSLYAIVLYDFKAEK.S
  9.5    0.37        R.FDSDLQEVVYNACEQ.R
  8.6   -0.72        R.VTNAFNQERPTPAAAET.D
  8.1   -0.61        R.FDSDLQEVVYNACEQ.R
  7.9    0.33        S.KFNSGDYSNSVADQQR.A
  7.1    0.29        S.GLGYAYQEETGNPVYR.E
  6.8    0.37        R.FDSDLQEVVYNACEQ.R
Top scoring peptide matches to query 56
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
132.5    0.21    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 87.2   -0.78    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 80.9   -0.78    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 61.2   -0.78    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 27.6    0.19   18  Q74ZZ1|Q74ZZ1_ASHGO L.HSRLGATLDGNEPLPEK.E
 17.2    0.09                           I.NAIVLHVGIEAALEKQK.T
 12.1    0.14                           A.HHLAETLGVGTPAVYAAK.A
 11.4    0.22                           K.QQYGNAVRSLNEAQEK.I
 10.3   -0.65                           K.SFINMEDDFSPFKEE.L
 10.2    0.30                           K.GDINALSQDIDCEQRT.D
Top scoring peptide matches to query 57
Score greater than 29 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein             Peptide
 53.5    0.25    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 47.9   -0.73    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 43.6   -0.73    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 37.8   -0.73    1  Pir2                R.QFQFDGPPPQAGAIYAK.G
 13.5    0.24   18  Q74ZZ1|Q74ZZ1_ASHGO L.HSRLGATLDGNEPLPEK.E
  8.6    0.24                           G.IDVKGEVTVNMPQFQK.A
  8.3    0.25                           I.WWPPVGVLQSYYNPK.V
  6.5   -0.63                           R.SETSINGMPESLNSRNP.M
  6.2    0.14                           I.NAIVLHVGIEAALEKQK.T
  5.9   -0.70                           K.FYYDVISWGGPFKQQ.L
Top scoring peptide matches to query 58
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 59
Score greater than 25 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 52.2    0.25    1  Pir2 R.QFQFDGPPPQAGAIYAKG.W
 51.6   -0.73    1  Pir2 R.QFQFDGPPPQAGAIYAKG.W
 43.5   -0.73    1  Pir2 R.QFQFDGPPPQAGAIYAKG.W
 27.8   -0.73    1  Pir2 R.QFQFDGPPPQAGAIYAKG.W
  9.0    0.25            R.SGCWIDAVQIITSQGRT.S
  8.1   -0.73            R.SGCWIDAVQIITSQGRT.S
  6.7    0.26            R.DFPTGTGLKSVLNQVQGGA.L
  5.8    0.24            E.GNVELGPLEETYQKWK.S
  5.7    0.25            S.STSMGTLPPVTTKQEQGK.G
  5.2    0.30            G.QFGIETKYQMFDEQK.G
Top scoring peptide matches to query 60
Score greater than 30 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 82.1    0.25    6  Fig2 K.VTAPDCEALQSGMIVVSK.D
 40.1   -0.73    6  Fig2 K.VTAPDCEALQSGMIVVSK.D
 12.0    0.10            G.NRPVLTLPHLMLSVVSK.C
  9.1    0.16            A.CQAALTTVSKVTSIPISK.L
  6.6    0.21            I.SAIHGITFRNFSLPESK.T
  6.1    0.17            D.SSPLLICWFANVLGISK.Y
  5.4    0.27            V.ISKHVQDAYAQAEEVSK.K
  3.3    0.26            K.LSALNSQLEELITQNQT.L
  3.2    0.33            S.EAAAASPEEFSETGHMLK.V
  2.9    0.16            R.VATGTSLIEYPVKDWLL.R
Top scoring peptide matches to query 61
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 62
Score greater than 17 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.5   -0.79        R.QEHYKDVLTAILSMNSI.D
Top scoring peptide matches to query 63
Score greater than 30 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 66.7    0.27    2  Cwp1 R.SASMYHMSSVFEDNGALK.L
 46.2   -0.72    2  Cwp1 R.SASMYHMSSVFEDNGALK.L
 13.8    0.11            L.TATLNNTGFNFIRYIVK.N
 12.0   -0.73            G.GDGVTSQYEFNQMEQLK.S
 10.8    0.11            L.TATLNNTGFNFIRYIVK.N
  9.5   -0.73            G.GDGVTSQYEFNQMEQLK.S
  9.5   -0.73            G.GDGVTSQYEFNQMEQLK.S
  7.9    0.10            M.VTPVIPSNGNYLTLEDIK.K
  7.6    0.30            -.MTSGYQVQECLDWATAN.G
  7.6    0.18            S.DADVEESLEQLQDNKLK.V
Top scoring peptide matches to query 64
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 65
Score greater than 18 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6    0.31        L.MQLLESDGENNSATVPSDR.K
  4.5    0.21        E.TAAQALDESDMNIYRIPR.T
  4.2    0.31        L.MQLLESDGENNSATVPSDR.K
  4.1    0.16        L.GPGKYQSVAMVSLNCIALR.R
  3.5    0.25        L.SDTAERNLTEEESAGVLSR.L
  3.4    0.24        F.GNLFNLQFLGCEGNPLDR.Q
  3.4    0.24        F.GNLFNLQFLGCEGNPLDR.Q
  3.2    0.24        L.ATTNDAMVDDAKGSLAEQVK.Q
  3.0    0.24        F.GNLFNLQFLGCEGNPLDR.Q
  2.8    0.24        G.NSLGEVTGHALNVNACHIR.Q
Top scoring peptide matches to query 66
Score greater than 16 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1    0.23        S.MLQANKASVSAGSTLNENQR.S
  4.1    0.23        S.MLQANKASVSAGSTLNENQR.S
  4.1    0.23        S.MLQANKASVSAGSTLNENQR.S
  3.9    0.24        T.LTQDCINTVMADELELQK.A
  3.1    0.18        -.MEGLLQSDAQLAFSRQAVR.R
  2.3    0.17        K.NLTNETLFEFLQLTTHSL.R
  2.1    0.20        R.LTQLLTQSQYSPLAAEEQV.P
  1.7    0.22        K.SNPGSLTNGIQTTSTSSDKQV.D
  1.1    0.24        K.LQSIDIEQLCATCVTELQ.S
  1.0    0.18        Q.QDEDSTIAILPSSLPQIHR.A
Top scoring peptide matches to query 67
Score greater than 29 indicates homology
Score greater than 39 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 70.5    0.31    2  Cwp1 S.SSPYELTLEQPGATSISVALR.A
 31.1   -0.68    2  Cwp1 S.SSPYELTLEQPGATSISVALR.A
 11.7    0.26            L.HLLREELQLNVLQIQNVR.R
  8.5    0.35            R.ELALQIFGVARELMEFHSQ.T
  8.1    0.24            G.FLVGGASLKPEFVDIINSRR.-
  8.0    0.26            L.HLLREELQLNVLQIQNVR.R
  8.0    0.26            L.HLLREELQLNVLQIQNVR.R
  7.8    0.37            A.REEFDETITEISVSGHTLR.I
  7.2    0.26            L.HLLREELQLNVLQIQNVR.R
  6.5    0.34            Y.DRSVALQHYSSQQPFVISR.A
Top scoring peptide matches to query 68
Score greater than 17 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 39.1    0.31    1  Pir2 L.SGSFYNLYDENIAPQCSPIK.L
 25.8   -0.67    1  Pir2 L.SGSFYNLYDENIAPQCSPIK.L
 12.4   -0.67    1  Pir2 L.SGSFYNLYDENIAPQCSPIK.L
  5.6   -0.67    1  Pir2 L.SGSFYNLYDENIAPQCSPIK.L
  2.3    0.18            F.LLTLDKESLYGTTVSGYLNSK.K
  2.0    0.44            K.GTGARCDEEAEDQDVSPPPNAS.P
  1.5    0.38            R.HAGLHPRTDSWDEYNNELF.L
  1.4    0.21            T.ESIDWVIGFIDAQGQVAIANR.L
  0.5    0.13            V.FTKELDSILELRPSAQDVLK.G
Top scoring peptide matches to query 69
Score greater than 25 indicates homology
Score greater than 38 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.0    0.32    1  Pir2 C.LSGSFYNLYDENIAPQCSPIK.L
 11.1    0.35            K.DLVRDDPAMLEYITTQYGSVE.E
  4.9   -0.66    1  Pir2 C.LSGSFYNLYDENIAPQCSPIK.L
  4.2    0.29            R.KADQILCMSLLENGINRPDDL.Y
  4.0   -0.70            R.KADQILCMSLLENGINRPDDL.Y
  3.0   -0.79            F.AINVATDAANTVLSVDQIIMAKR.A
  2.9   -0.68            N.SGHPNFWFMGGNLALARYYSK.R
  2.9   -0.68            R.VPNDKETQTQICTNVLEGLQQ.T
  2.7   -0.73            A.QHPISQIGDGQIQANTDTAPPTK.V
  2.7   -0.69            G.TKTCFQMFTQQVEVAAGSGQAK.I
Top scoring peptide matches to query 70
Score greater than 13 indicates homology
Score greater than 37 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2   -0.44        S.WGVQNDQSANPSVASSVAEKNAPGVPDDSEGK.-
  0.0   -0.44        S.WGVQNDQSANPSVASSVAEKNAPGVPDDSEGK.-
  0.0   -0.44        S.WGVQNDQSANPSVASSVAEKNAPGVPDDSEGK.-
  0.0   -0.70        M.VFFTSAEVVAQKLQHLIDNLASQTPVGISK.V
Top scoring peptide matches to query 71
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide