Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0348_q4.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 6 Dec 2006 at 12:17:40 GMT
Significant hits: mSSR1     |Candida albicans 212 aa - Secretory Stress Response
                  mRBT5     |predicted| C. albicans fungus|CA2558| 241 aa
                  mEcm33.3  |predicted|m5366.2|CaECM33
                  9023.3    |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
                  15898.1   |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
                  mCrh11    |predicted| C. albicans |CA0375|: 453 aa
                  TRBOTR    trypsin (EC3.4.21.4 ) precursor-bovine
                  12297.1   CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 34 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mSSR1                             Mass: 20690    Score: 213    Queries matched: 3
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   635.81   1269.60   1269.66   -0.05 0  62  9.3e-005 1  -.APPACLLACVAK.V
23   815.32   1628.62   1628.68   -0.07 0  96  3.4e-008 1  K.CSGLNDLSCICTTK.N + Deamidation (NQ)
26   855.39   1708.76   1708.76   -0.00 0  59  0.0002 1  K.EICPNGDADTAISAFK.S + Deamidation (NQ)

2.    mRBT5                             Mass: 22745    Score: 115    Queries matched: 3
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   618.79   1235.56   1236.57   -1.01 0  39  0.024 1  R.IYDQLPECAK.E + Deamidation (NQ)
28   584.92   1751.74   1751.82   -0.08 1  80  1.5e-006 1  R.IYDQLPECAKECVK.Q
29   876.95   1751.88   1752.81   -0.92 1  (56) 0.00043 1  R.IYDQLPECAKECVK.Q + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      mPga10                            Mass: 23610    Score: 115    Queries matched: 3
 |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
      19952.1                           Mass: 24614    Score: 115    Queries matched: 3
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      20169.1                           Mass: 25603    Score: 115    Queries matched: 3
 |Pga10| CONTIG=Contig10231 POSCDS1=59560 POSCDS2=60312
      21543.1                           Mass: 25731    Score: 115    Queries matched: 3
 CONTIG=Contig20231 POSCDS1=59564 POSCDS2=60316
      21544.1                           Mass: 25457    Score: 115    Queries matched: 3
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
3.    mEcm33.3                          Mass: 41984    Score: 94     Queries matched: 2
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
14   664.30   1326.58   1326.62   -0.05 1  28  0.26 1  K.TDGKLSCSAFNK.L
19   787.42   1572.82   1573.79   -0.97 0  71  1.4e-005 1  K.TIGGALQISDNSELR.S + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      5366.2                            Mass: 43798    Score: 94     Queries matched: 2
 |Ecm33.3| CaECM33 CONTIG=Contig10163 POSCDS1=164904 POSCDS2=166142
      24311.1                           Mass: 42880    Score: 94     Queries matched: 2
 CONTIG=Contig20163 POSCDS1=164513 POSCDS2=165751
4.    9023.3                            Mass: 33980    Score: 81     Queries matched: 3
 |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 1   469.21   936.41   936.47   -0.05 1  14  6.8 2  K.AYVDEGRK.A
7   573.78   1145.56   1146.59   -1.03 0  43  0.0085 1  K.SNQQAAISSIK.S + Deamidation (NQ)
18   759.81   1517.61   1518.63   -1.02 0  28  0.26 1  K.GITYSPYSDNGGCK.S + Deamidation (NQ)

5.    15898.1                           Mass: 39582    Score: 74     Queries matched: 3
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   476.23   950.44   950.48   -0.04 1  7  33 1  K.AYVEEGRK.A
 7   573.78   1145.56   1146.59   -1.03 0  43  0.0085 1  K.SNQQAAISSIK.S + Deamidation (NQ)
 18   759.81   1517.61   1518.63   -1.02 0  28  0.26 1  K.GITYSPYSDNGGCK.S + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      m15898.1|mSCW1:                   Mass: 35901    Score: 74     Queries matched: 3
 346 aa - glucanase (by homology) Candida albicans
6.    mCrh11                            Mass: 44667    Score: 74     Queries matched: 2
 |predicted| C. albicans |CA0375|: 453 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   548.23   1094.45   1094.49   -0.04 0  40  0.018 1  R.YDQAQDDIK.K
30   882.86   1763.70   1763.76   -0.06 0  39  0.02 1  K.QYSYSDQSGSWESIK.A

 
      Proteins matching the same set of peptides:
      14360.2                           Mass: 46818    Score: 74     Queries matched: 2
 |Crh11| CONTIG=Contig10158 POSCDS1=92919 POSCDS2=94280
      24611.1                           Mass: 47890    Score: 74     Queries matched: 2
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
7.    TRBOTR                            Mass: 24662    Score: 54     Queries matched: 2
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   577.27   1152.52   1152.57   -0.04 0  42  0.011 1  K.SSGTSYPDVLK.C
34   1081.97   2161.92   2163.03   -1.11 0  15  5 1  R.LGEDNINVVEGNEQFISASK.S + Deamidation (NQ)

8.    12297.1                           Mass: 15525    Score: 40     Queries matched: 2
 CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 28   584.92   1751.74   1751.82   -0.08 1  43  0.0073 2  R.IYDQIPKCAQECVK.Q + Deamidation (NQ)
 29   876.95   1751.88   1752.81   -0.92 1  (29) 0.19 3  R.IYDQIPKCAQECVK.Q + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      24214.1                           Mass: 16067    Score: 40     Queries matched: 2
 CONTIG=Contig20166 POSCDS1=63254 POSCDS2=63697
9.    mPga4                             Mass: 47426    Score: 34     Queries matched: 1
 |predicted| mIPF8796 C. albicans CA4800| 451 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   677.33   1352.65   1352.71   -0.06 0  36  0.043 1  K.YFQELGINTIR.V

 
      Proteins matching the same set of peptides:
      8796.1                            Mass: 49422    Score: 34     Queries matched: 1
 |Pga4| CONTIG=Contig10194 POSCDS1=248535 POSCDS2=249890
      23247.1                           Mass: 53324    Score: 34     Queries matched: 1
 CONTIG=Contig20194 POSCDS1=251401 POSCDS2=252756
10.   mPhr2                             Mass: 57243    Score: 20     Queries matched: 1
 |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   520.24   1038.46   1039.48   -1.03 0  22  0.97 1  K.SNTDASAFVK.A + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      4604.2                            Mass: 59477    Score: 20     Queries matched: 1
 |Phr2| CONTIG=Contig20237 POSCDS1=156145 POSCDS2=157779
      14612.3                           Mass: 67274    Score: 20     Queries matched: 1
 CONTIG=Contig10237 POSCDS1=160121 POSCDS2=161755
      mPhr1                             Mass: 58075    Score: 18     Queries matched: 1
 |experimentally validated by us| C albicans |CA4857| 548 aa
      15932.2                           Mass: 60276    Score: 18     Queries matched: 1
 |Phr1| CONTIG=Contig10192 POSCDS1=117957 POSCDS2=119603
      23455.1                           Mass: 60747    Score: 18     Queries matched: 1
 CONTIG=Contig20192 POSCDS1=117993 POSCDS2=119639
11.   19584.1                           Score: 19     Queries matched: 2
 CONTIG=Contig10143 POSCDS1=61144 POSCDS2=63636
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 28   584.92   1751.74   1751.82   -0.08 0  (19) 1.8 5  R.TTQSTLNFEPLGDSNK.R + Deamidation (NQ)
 29   876.95   1751.88   1752.81   -0.92 0  22  0.92 5  R.TTQSTLNFEPLGDSNK.R + 2 Deamidation (NQ)

12.   6973.2                            Mass: 24745    Score: 16     Queries matched: 1
 CONTIG=Contig10155 POSCDS1=12280 POSCDS2=12936
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   469.21   936.41   935.51   0.90 1  16  4 1  -.MSVAKAVSK.N + Oxidation (M)

 
      Proteins matching the same set of peptides:
      24695.1                           Mass: 24745    Score: 16     Queries matched: 1
 CONTIG=Contig20155 POSCDS1=12280 POSCDS2=12936
13.   2121.2                            Score: 16     Queries matched: 1
 CONTIG=Contig10196 POSCDS1=69210 POSCDS2=72338
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   548.23   1094.45   1094.52   -0.08 0  19  2.1 2  K.YNQTAQELK.S + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      23186.1                           Score: 16     Queries matched: 1
14.   19585.2                           Score: 12     Queries matched: 2
 CONTIG=Contig20143 POSCDS1=60861 POSCDS2=63353
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 28   584.92   1751.74   1751.86   -0.11 0  (13) 6.9 8  R.TTQSTLNFKPLGDSNK.R + 2 Deamidation (NQ)
 29   876.95   1751.88   1752.84   -0.96 0  15  5.1 8  R.TTQSTLNFKPLGDSNK.R + 3 Deamidation (NQ)

15.   66.1                              Score: 11     Queries matched: 1
 CONTIG=Contig10236 POSCDS1=190021 POSCDS2=190878
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 7   573.78   1145.56   1144.57   0.98 0  14  7.1 5  K.AQQAGDLDLSK.G

 
      Proteins matching the same set of peptides:
      21250.1                           Score: 11     Queries matched: 1
16.   22722.1                           Score: 10     Queries matched: 1
 CONTIG=Contig20209 POSCDS1=40704 POSCDS2=41534
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   664.30   1326.58   1327.66   -1.08 0  10  15 2  K.QIQTNNNINNR.G

17.   4484.1                            Score: 9      Queries matched: 1
 CONTIG=Contig10215 POSCDS1=248572 POSCDS2=249276
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   664.30   1326.58   1327.73   -1.16 0  9  18 3  K.QIEILTDILDR.H

 
      Proteins matching the same set of peptides:
      22473.1                           Score: 9      Queries matched: 1
18.   12141.1                           Score: 9      Queries matched: 1
 CONTIG=Contig20137 POSCDS1=44862 POSCDS2=45974
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 11   618.79   1235.56   1234.65   0.91 1  9  22 4  R.FKVTAGGGGWGAK.A

 
      Proteins matching the same set of peptides:
      18863.1                           Score: 9      Queries matched: 1
19.   10888.1                           Mass: 85036    Score: 9      Queries matched: 1
 CONTIG=Contig10218 POSCDS1=4505 POSCDS2=6775
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   716.82   1431.63   1431.72   -0.09 0  10  15 1  K.QSPVSSTGVDVSIR.D + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      22116.1                           Mass: 88705    Score: 9      Queries matched: 1
 CONTIG=Contig20218 POSCDS1=4505 POSCDS2=6775
20.   8339.2                            Score: 8      Queries matched: 1
 CONTIG=Contig10215 POSCDS1=160305 POSCDS2=163235
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   548.23   1094.45   1093.60   0.85 1  8  24 7  K.KSLTEQFLK.Y + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      22538.1                           Score: 8      Queries matched: 1
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   647.29   1292.56   1292.69   -0.13 1  11  13 1  SSTMLGLGIKMR
10   602.30   1202.59   1202.51   0.08 0  9  25 1  EEENSNPQQK + Deamidation (NQ)
22   806.31   1610.60   1611.80   -1.20 0  8  21 1  EATPDVQQVAETVPK + Deamidation (NQ)
5   540.75   1079.50   1079.53   -0.04 0  7  31 1  LSVIEFVNC
37   1270.24   3807.70   3808.83   -1.13 1  6  21 1  AVDFAQLQFIAEQNGWHKFISMQNYYNLIYR + 2 Deamidation (NQ)
3   511.23   1020.44   1020.49   -0.04 0  4  70 1  SNEPGVGFSK
33   682.92   2045.74   2045.73   0.02 0  4  44 1  SDFQSDEECSYNCYNK + Deamidation (NQ)
25   843.33   1684.65   1684.78   -0.13 1  3  83 1  NTWWNIEKHVNNK + 3 Deamidation (NQ)
21   532.23   1593.68   1593.95   -0.27 1  2  99 1  KFFNISVVIVTLSK
20   797.84   1593.67   1593.95   -0.28 1  2  1.1e+002 1  KFFNISVVIVTLSK
31   912.37   1822.73   1823.85   -1.12 1  0  1.3e+002 1  QKFGDVQEIDETSSNK
9   589.27   1176.52        
16   692.84   1383.66        
24   826.35   1650.69        
27   871.84   1741.67        
32   931.84   1861.67        
35   1023.43   3067.27        
36   1108.42   3322.25        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 37

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 27 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.0    0.90   12  6973.2 -.MSVAKAVSK.N
 13.7   -0.05    4  9023.3 K.AYVDEGRK.A
  4.1    0.94              K.CSNKLVSK.S
  4.1    0.90              K.GYRNIVSK.A
  4.0   -0.08              R.AFNKTINK.L
  2.5    0.94              R.NFVANVGSK.I
  2.3    0.91              K.LALAGYNSK.E
  0.8    0.86              K.QIIGLQHK.K
  0.8   -0.13              K.QIIGLQHK.K
  0.8   -0.13              K.QIIGLQHK.K
Top scoring peptide matches to query 2
Score greater than 19 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0   -0.04    5  15898.1 K.AYVEEGRK.A
  7.0    0.93               K.SDTSKVVSK.V
  7.0   -0.09               R.SFVSSRLR.V
  7.0   -0.08               K.SFVVKDTR.V
  7.0   -0.06               R.SMVTSVRR.E
  6.2   -0.00               K.HPTFMFR.V
  5.9    1.00               R.QNPLNFSK.N
  5.9    0.96               K.VEILDMSK.A
  0.8   -1.07               K.RNAIYSTK.I
Top scoring peptide matches to query 3
Score greater than 14 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.3   -0.04        R.SNEPGVGFSK.C
  1.5   -0.07        -.SRPSMSRGK.T
  1.1   -1.16        K.EHVKQLLR.S
  0.9   -1.09        K.QKFLAMER.L
Top scoring peptide matches to query 4
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.1   -1.03   10  mPhr2 SNTDASAFVK
 21.8   -0.04   10  mPhr2 SNTDASAFVK
  7.0   -1.12             -.MATVIPPPSK.K
  5.5   -1.07             K.TTKFSGSGQK.L
  3.9   -1.07             K.DSLVNQHVK.L
  2.0   -1.08             K.GITAFEFQK.D
  2.0   -0.08             -.VTNTYSGIGK.A
  1.6   -0.12             K.SNLPIGPNVK.L
  1.3   -0.03             K.SILNDFNSK.I
  1.2   -0.08             R.SNLSYQSIK.C
Top scoring peptide matches to query 5
Score greater than 20 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.5   -0.04        K.LSVIEFVNC.-
  0.6   -1.02        K.LSVIEFVNC.-
Top scoring peptide matches to query 6
Score greater than 34 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 39.6   -0.04    6  mCrh11 R.YDQAQDDIK.K
 18.8   -0.08   13  2121.2 K.YNQTAQELK.S
 14.9   -1.02    6  mCrh11 R.YDQAQDDIK.K
 12.2   -1.02    6  mCrh11 R.YDQAQDDIK.K
 10.5   -0.09              K.MQFLSNNLK.N
  8.8   -0.07              K.FMQQYLHK.L
  8.3    0.85   20  8339.2 K.KSLTEQFLK.Y
  6.0   -0.06              R.YNELLENAK.S
  5.5   -1.08              K.MQFLSNNLK.N
  4.9   -0.13              R.QMFTNLTIK.W
Top scoring peptide matches to query 7
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 43.4   -1.03    4+ 9023.3 K.SNQQAAISSIK.S
 42.7   -1.03    4+ 9023.3 K.SNQQAAISSIK.S
 39.8   -0.05    4+ 9023.3 K.SNQQAAISSIK.S
 34.6   -1.03    4+ 9023.3 K.SNQQAAISSIK.S
 14.2    0.98   15  66.1   K.AQQAGDLDLSK.G
 14.2   -0.00   15  66.1   K.AQQAGDLDLSK.G
 10.1   -0.01              R.ENNVAATDKGK.K
 10.1   -1.00              R.ENNVAATDKGK.K
 10.1   -1.00              R.ENNVAATDKGK.K
  8.6    1.00              K.TPDFHNSLSK.K
Top scoring peptide matches to query 8
Score greater than 26 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 41.6   -0.04    7  TRBOTR K.SSGTSYPDVLK.C
 10.5    0.04              K.QEICDFQGR.G
  8.1    0.98              R.SIMSGMVWNK.N
  7.1   -0.07              K.IIYCTGITGR.L
  6.4   -0.10              R.KVGVQEPPSGR.F
  5.6   -0.01              K.KMGSIETDQK.H
  5.6    1.01              R.SMLSEESNQK.K
  5.6   -1.04              -.SVMSNVSSSIK.L
  5.4   -0.15              R.LTTSYKTLVK.K
  4.7    0.03              R.TMSMVNSNPR.T
Top scoring peptide matches to query 9
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 10
Score greater than 17 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.5    0.08        K.EEENSNPQQK.-
  8.5    0.08        K.EEENSNPQQK.-
  5.3   -0.90        K.EEENSNPQQK.-
  5.3   -0.90        K.EEENSNPQQK.-
  5.3   -0.90        K.EEENSNPQQK.-
  5.3   -0.90        K.EEENSNPQQK.-
  3.9   -1.04        K.LDDISISGEKK.R
  3.4   -1.02        K.IINPSPSYQGK.L
  3.2    0.90        K.LLNVIGMTRGK.R
  2.7   -0.06        K.QQVQFLLTPK.R
Top scoring peptide matches to query 11
Score greater than 25 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 38.5   -1.01    2  mRBT5   IYDQLPECAK
 37.9   -0.03    2  mRBT5   IYDQLPECAK
 10.1    0.04               K.ENFPNDIEQK.T
  8.9    0.91   18  12141.1 R.FKVTAGGGGWGAK.A
  6.9    0.92               K.KQSSSLGAITDK.N
  6.7    0.95               K.KFLQNYMFK.K
  6.5   -0.00               K.GRNEMIQSER.L
  6.4    0.90               K.QFLLESVRDK.Y
  5.2    0.91               K.ELMIKQELSK.N
  4.4    0.89               R.LYEAQLQSKR.F
Top scoring peptide matches to query 12
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 62.2   -0.05    1  mSSR1 -.APPACLLACVAK.V
  8.0   -0.06             M.APVVQQPAPSFK.K
Top scoring peptide matches to query 13
Score greater than 18 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.2   -0.13        K.SSTMLGLGIKMR.D
  5.1   -1.00        K.TMGSTKSNHTTN.-
  2.1   -0.94        K.NGHNNMNAYDK.Y
  2.1   -0.94        K.NGHNNMNAYDK.Y
  2.1   -0.94        K.NGHNNMNAYDK.Y
  0.9   -0.07        R.LIDDMVAQMIK.S
  0.9   -0.07        R.LIDDMVAQMLK.S
  0.5   -0.11        R.ILRHISDMHR.L
Top scoring peptide matches to query 14
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 27.8   -0.05    3  mEcm33.3 K.TDGKLSCSAFNK.L
 10.1   -1.08   16  22722.1  K.QIQTNNNINNR.G
  9.4   -1.16   17  4484.1   K.QIEILTDILDR.H
  9.3   -1.03    3  mEcm33.3 K.TDGKLSCSAFNK.L
  4.0    0.90                R.GSPQNAIPLCLR.I
  3.8   -0.17                K.LQVELNNLRVK.F
  3.4   -1.12                K.AKATLLEYYQK.N
  2.9   -1.14                R.QLVESVEFLHK.H
  2.8   -1.03                R.QISENFNQYGK.L
  1.4    0.00                K.TGENYYLNHSK.D
Top scoring peptide matches to query 15
Score greater than 17 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.8   -0.06    9  mPga4 K.YFQELGINTIR.V
 23.5   -1.04    9  mPga4 K.YFQELGINTIR.V
  2.3    0.02             R.INDITDLEEYK.S
  2.1    0.88             K.TVPVVALVPPPYT.-
  0.5    0.96             -.CISNQLAKQYK.H
Top scoring peptide matches to query 16
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 17
Score greater than 22 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.5   -0.09   19  10888.1 K.QSPVSSTGVDVSIR.D
  8.7   -1.13               K.LADFGLAKQLNDK.N
  8.5   -0.13               K.ENIPSFLEKLDK.Q
  8.4   -0.17               R.MALKSVLVQIGEK.Y
  3.4   -1.18               R.YIVASQDLQLRK.K
  2.7   -0.06               -.CDGISINPSINIK.I
  2.3    0.92               -.CDGISINPSINIK.I
  1.5   -0.16               K.ILSICFLNPISR.H
  1.1    0.79               R.MLIISIKINLQK.G
  0.6   -0.02               K.NRNCTYTFVQK.E
Top scoring peptide matches to query 18
Score greater than 16 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 27.9   -1.02    4+ 9023.3 K.GITYSPYSDNGGCK.S
  2.3   -0.14              R.VAENENELVSMKR.L
Top scoring peptide matches to query 19
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 70.5   -0.97    3  mEcm33.3 K.TIGGALQISDNSELR.S
 70.1   -0.97    3  mEcm33.3 K.TIGGALQISDNSELR.S
 62.8    0.01    3  mEcm33.3 K.TIGGALQISDNSELR.S
  7.6   -0.04                K.NVGALQGIQFLRQK.G
  7.6   -0.04                K.NVGALQGIQFLRQK.G
  2.7   -1.02                K.NVGALQGIQFLRQK.G
  2.7   -1.02                K.NVGALQGIQFLRQK.G
Top scoring peptide matches to query 20
Score greater than 13 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7   -0.28        R.KFFNISVVIVTLSK.M
  0.5   -1.15        K.NPNPSHTNRFGLLK.L
Top scoring peptide matches to query 21
Score greater than 14 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.1   -0.27        R.KFFNISVVIVTLSK.M
  1.1    0.94        -.MSTSLSHQELSTEK.G
  0.7    0.91        K.DNDRSIIDQIFQK.A
  0.4    0.87        K.GLLSSWMNDLSILK.F
Top scoring peptide matches to query 22
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.0   -1.20        K.EATPDVQQVAETVPK.T
  5.3   -0.21        K.EATPDVQQVAETVPK.T
  4.2   -1.20        K.EATPDVQQVAETVPK.T
  2.6   -0.25        R.WSLKDLAFEFLSR.R
Top scoring peptide matches to query 23
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 95.8   -0.07    1  mSSR1 K.CSGLNDLSCICTTK.N
 34.1    0.92    1  mSSR1 K.CSGLNDLSCICTTK.N
  4.6   -0.03             R.YGGQQNNYGNNNGAR.R
  3.6   -1.01             R.YGGQQNNYGNNNGAR.R
  3.5   -0.21             K.LDSFQQLYSKLTGK.Q
  2.4   -1.01             R.YGGQQNNYGNNNGAR.R
  1.6   -1.12             K.FMTQLQKAMDGNTK.M
  0.6   -1.17             K.GKTGASLFASMMQASK.S
  0.6   -1.17             K.GKTGASLFASMMQASK.S
  0.1    0.96             R.YGGQQNNYGNNNGAR.R
Top scoring peptide matches to query 24
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 25
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5   -0.13        K.NTWWNIEKHVNNK.L
  2.5   -0.13        K.NTWWNIEKHVNNK.L
Top scoring peptide matches to query 26
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 59.0   -0.00    1  mSSR1 K.EICPNGDADTAISAFK.S
 44.9    0.98    1  mSSR1 K.EICPNGDADTAISAFK.S
  4.5   -1.07             K.SGPGPRCGHSMTLLPK.F
  4.3   -1.13             K.DKHCLVIGAGDVALSR.I
  1.9   -0.16             R.QLFAQVTNPPIDPIR.E
  1.9    0.09             R.WQSNANDQDENKEK.E
  1.3   -0.89             R.WQSNANDQDENKEK.E
  1.0    1.07             R.WQSNANDQDENKEK.E
  0.9   -0.06             R.STITNLQTLNLCSNK.L
Top scoring peptide matches to query 27
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 28
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 80.2   -0.08    2  mRBT5   IYDQLPECAKECVK
 43.2   -0.08    8  12297.1 R.IYDQIPKCAQECVK.Q
 37.6   -1.06    2  mRBT5   IYDQLPECAKECVK
 33.4   -0.08    8  12297.1 R.IYDQIPKCAQECVK.Q
 19.2   -0.08   11  19584.1 R.TTQSTLNFEPLGDSNK.R
 17.1   -1.06   11  19584.1 R.TTQSTLNFEPLGDSNK.R
 14.2   -1.06    8  12297.1 R.IYDQIPKCAQECVK.Q
 13.4   -0.11   14  19585.2 R.TTQSTLNFKPLGDSNK.R
 12.7   -0.08   11  19584.1 R.TTQSTLNFEPLGDSNK.R
 10.5    0.87   14  19585.2 R.TTQSTLNFKPLGDSNK.R
Top scoring peptide matches to query 29
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 55.7   -0.92    2  mRBT5   IYDQLPECAKECVK
 53.0    0.06    2  mRBT5   IYDQLPECAKECVK
 29.1   -0.92    8  12297.1 R.IYDQIPKCAQECVK.Q
 28.2    0.06    8  12297.1 R.IYDQIPKCAQECVK.Q
 22.4   -0.92   11  19584.1 R.TTQSTLNFEPLGDSNK.R
 19.7    0.06    8  12297.1 R.IYDQIPKCAQECVK.Q
 15.5    0.06   11  19584.1 R.TTQSTLNFEPLGDSNK.R
 15.0   -0.96   14  19585.2 R.TTQSTLNFKPLGDSNK.R
 13.6   -0.92   11  19584.1 R.TTQSTLNFEPLGDSNK.R
 13.4    0.06   11  19584.1 R.TTQSTLNFEPLGDSNK.R
Top scoring peptide matches to query 30
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 38.6   -0.06    6  mCrh11 K.QYSYSDQSGSWESIK.A
 33.1   -1.05    6  mCrh11 K.QYSYSDQSGSWESIK.A
  8.2   -1.05    6  mCrh11 K.QYSYSDQSGSWESIK.A
  2.1    0.82              R.FTTDYNQIEKTLYK.Y
  2.0   -0.14              R.SSPILNHDSESLHSNK.S
  1.6    0.74              R.VLIITGPNMGGKSSYVK.T
Top scoring peptide matches to query 31
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5   -1.12        K.QKFGDVQEIDETSSNK.L
  0.1   -0.24        K.RGALSAITAPVVGNGNNGR.H
Top scoring peptide matches to query 32
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 33
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1    0.02        K.SDFQSDEECSYNCYNK.K
Top scoring peptide matches to query 34
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.5   -1.11    7  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 13.6   -0.13    7  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 10.0   -1.11    7  TRBOTR R.LGEDNINVVEGNEQFISASK.S
  6.2   -1.11    7  TRBOTR R.LGEDNINVVEGNEQFISASK.S
  5.0   -1.11    7  TRBOTR R.LGEDNINVVEGNEQFISASK.S
  0.4    0.79              R.ISNLPAVSAINGMISSFPVVK.I
Top scoring peptide matches to query 35
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 36
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 37
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.0   -1.13        R.AVDFAQLQFIAEQNGWHKFISMQNYYNLIYR.E
  3.6   -0.11        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.6   -1.09        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.6   -0.11        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.6   -1.09        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.6   -0.11        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.6   -1.09        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.6   -0.11        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.6   -1.09        R.FNETHELNDLLTQGTGLDTFGNTGDTRIPHQHTK.T
  3.0    0.71        K.EISYMHSEGVLAGELKHGILALVDEDLPIIAFATR.D