Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0348_q2.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 29 Sep 2006 at 12:07:22 GMT
Significant hits: 15898.1     |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
                  9023.3      |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
                  mSSR1       |Candida albicans 212 aa - Secretory Stress Response
                  TRBOTR      trypsin (EC3.4.21.4 ) precursor-bovine
                  mRBT5       |predicted| C. albicans fungus|CA2558| 241 aa
                  mALS3.5eoc  |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mPhr2       |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
                  mEcm33.3    |predicted|m5366.2|CaECM33
                  mALS4.5f    |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
                  mUTR2       |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase
                  24611.1     CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
                  19771.1     |Als5| CONTIG=Contig10233 POSCDS1=63367 POSCDS2=67410
                  mTOS1       |predicted| C. albicans |CA2303| 468 aa
                  mPga4       |predicted| mIPF8796 C. albicans CA4800| 451 aa
                  mSod4/Pga2  |predicted| mIPF1218 C. albicans |CA4835| 232 aa
                  mCHT2       583 aa - chitinase 2 precursor Candida albicans
                  15363.2     |Pir1| CONTIG=Contig20045 POSCDS1=52307 POSCDS2=53464
                  8527.1      |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
                  mPga24      |predicted| mIPF5185 C. albicans |CA1678| 533 aa

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 33 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    15898.1                           Mass: 39582    Score: 435    Queries matched: 6
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   573.85   1145.68   1145.60   0.08 0  67  3.1e-005 1  K.SNQQAAISSIK.S
34   759.87   1517.72   1517.65   0.08 0  20  1.5 1  K.GITYSPYSDNGGCK.S
41   791.44   1580.86   1579.79   1.07 0  58  0.0002 1  R.LYGVDCSQVEAVLK.A
55   924.46   1846.90   1846.82   0.08 1  63  6.5e-005 1  K.ADGPYNAEKYWGIYSN.-
59   994.52   1987.03   1986.95   0.08 0  71  9.4e-006 1  K.SSCGASAILFTAFNDLWK.A
62   1025.57   2049.13   2049.04   0.09 0  156  2.9e-014 1  K.SESQIASEIAQLSGFDVIR.L

 
      Proteins matching the same set of peptides:
      m15898.1|mSCW1:                   Mass: 35901    Score: 435    Queries matched: 6
 346 aa - glucanase (by homology) Candida albicans

2.    9023.3                            Mass: 33980    Score: 381    Queries matched: 6
 |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 8   469.27   936.54   936.47   0.07 1  4  55 6  K.AYVDEGRK.A
 16   573.85   1145.68   1145.60   0.08 0  67  3.1e-005 1  K.SNQQAAISSIK.S
 34   759.87   1517.72   1517.65   0.08 0  20  1.5 1  K.GITYSPYSDNGGCK.S
 55   924.46   1846.90   1846.82   0.08 1  63  6.5e-005 1  K.ADGPYNAEKYWGIYSN.-
 59   994.52   1987.03   1986.95   0.08 0  71  9.4e-006 1  K.SSCGASALLFTAFNDLWK.A
 62   1025.57   2049.13   2049.04   0.09 0  156  2.9e-014 1  K.SESQIASEIAQLSGFDVIR.L

3.    mSSR1                             Mass: 20690    Score: 352    Queries matched: 6
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
46   542.98   1625.93   1625.86   0.07 1  87  2.3e-007 1  -.APPACLLACVAKVEK.G
47   815.39   1628.76   1627.70   1.06 0  112  7.7e-010 1  K.CSGLNDLSCICTTK.N
50   854.93   1707.85   1707.78   0.07 0  88  2.1e-007 1  K.EICPNGDADTAISAFK.S
51   855.43   1708.85   1707.78   1.07 0  (51) 0.00095 1  K.EICPNGDADTAISAFK.S
65   704.03   2109.08   2108.99   0.09 1  67  2.2e-005 1  K.CLKEICPNGDADTAISAFK.S
66   1056.04   2110.06   2108.99   1.07 1  (46) 0.0028 1  K.CLKEICPNGDADTAISAFK.S

4.    TRBOTR                            Mass: 24662    Score: 323    Queries matched: 7
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   403.25   804.48   804.41   0.07 0  46  0.0048 1  K.SAASLNSR.V
6   453.79   905.57   905.50   0.07 0  20  1.7 1  K.NKPGVYTK.V
13   523.84   1045.66   1045.59   0.07 1  24  0.6 1  K.LKSAASLNSR.V
69   1082.08   2162.14   2162.05   0.09 0  162  6.6e-015 1  R.LGEDNINVVEGNEQFISASK.S
70   1082.08   2162.14   2162.05   0.09 0  (59) 0.00013 1  R.LGEDNINVVEGNEQFISASK.S
73   1137.13   2272.24   2272.15   0.09 0  71  9e-006 1  K.SIVHPSYNSNTLNNDIMLIK.L
74   758.75   2273.23   2272.15   1.08 0  (31) 0.078 1  K.SIVHPSYNSNTLNNDIMLIK.L

5.    mRBT5                             Mass: 22745    Score: 287    Queries matched: 9
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   618.83   1235.65   1235.59   0.07 0  (26) 0.37 1  R.IYDQLPECAK.E
19   618.84   1235.66   1235.59   0.07 0  (29) 0.19 1  R.IYDQLPECAK.E
20   618.84   1235.66   1235.59   0.07 0  43  0.0076 1  R.IYDQLPECAK.E
21   618.84   1235.66   1235.59   0.07 0  (34) 0.056 1  R.IYDQLPECAK.E
52   876.95   1751.89   1751.82   0.07 1  (47) 0.0022 1  R.IYDQLPECAKECVK.Q
53   585.32   1752.95   1751.82   1.13 1  49  0.0015 1  R.IYDQLPECAKECVK.Q
88   1183.87   3548.59   3548.53   0.06 0  195  2e-018 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
89   1183.89   3548.64   3548.53   0.11 0  (80) 7.4e-007 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
90   1189.23   3564.67   3564.52   0.15 0  (111) 4.6e-010 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N + Oxidation (M)

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 287    Queries matched: 9
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 287    Queries matched: 9
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
6.    mALS3.5eoc                        Mass: 94266    Score: 234    Queries matched: 4
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   352.73   703.45   703.40   0.05 0  33  0.11 1  R.APFTLR.W
 2   385.78   769.54   769.47   0.07 0  11  10 2  R.VIPSLNK.V
64   1047.52   2093.03   2092.94   0.09 0  70  1.2e-005 1  K.GLNDWNYPVSSESFSYTK.T
76   1274.71   2547.40   2547.31   0.10 0  120  1.1e-010 1  K.ALGTVTLPLAFNVGGTGSSVDLEDSK.C

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 234    Queries matched: 4
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 234    Queries matched: 4
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928
7.    mPhr2                             Mass: 57243    Score: 187    Queries matched: 6
 |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   520.29   1038.57   1038.50   0.07 0  52  0.00075 1  K.SNTDASAFVK.A
 25   649.38   1296.75   1296.69   0.06 0  29  0.2 2  -.EDLPAIEIVGNK.F
27   653.32   1304.63   1304.55   0.08 0  15  5.1 1  K.ASGYESATNDYK.N
37   782.92   1563.83   1563.75   0.07 0  73  7.1e-006 1  R.SIPVGYSANDDSAIR.V
71   756.74   2267.19   2267.12   0.08 0  18  1.7 1  K.NLGIPIFFSEYGCNEVRPR.K
80   1307.62   2613.23   2613.13   0.10 1  1  86 1  K.CVVDDKVDSDDYSDLFSYICAK.I

8.    mEcm33.3                          Mass: 41984    Score: 183    Queries matched: 7
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   410.78   819.55   819.49   0.06 0  17  3 1  R.VSGGFILK.T
7   463.76   925.51   925.43   0.07 0  15  4 1  K.LSCSAFNK.L
17   611.38   1220.74   1220.68   0.07 1  83  8.4e-007 1  R.VSGGFILKTDGK.L
 31   702.90   1403.78   1403.73   0.06 0  3  70 6  -.ANNSTLTTATPSVK.S
38   787.44   1572.86   1572.81   0.05 0  65  4.3e-005 1  K.TIGGALQISDNSELR.S
39   787.45   1572.89   1572.81   0.08 0  (37) 0.023 1  K.TIGGALQISDNSELR.S
40   787.45   1572.89   1572.81   0.08 0  (40) 0.014 1  K.TIGGALQISDNSELR.S

9.    mALS4.5f                          Mass: 167909   Score: 174    Queries matched: 2
 |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
48   825.96   1649.90   1649.83   0.08 0  104  5.8e-009 1  K.FITDQTSIDLVADGR.T
87   1180.57   3538.69   3538.54   0.15 0  70  6.2e-006 1  R.TYATCNLNSAEEFTTFSSVSCTVTTTMTADTK.A

 
      Proteins matching the same set of peptides:
      13010.2                           Mass: 169769   Score: 174    Queries matched: 2
 |Als4.5'| CONTIG=Contig2201 POSCDS1=7312 POSCDS2=12093
10.   mUTR2                             Mass: 49676    Score: 139    Queries matched: 3
 |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
44   803.93   1605.85   1605.78   0.07 0  49  0.0014 1  R.IQFSLWPGGDSSNAK.G
67   711.39   2131.15   2131.06   0.09 1  90  1.1e-007 1  K.GTIEWAGGLINWDSEDIKK.Y
68   1066.58   2131.15   2131.06   0.09 1  (20) 1 1  K.GTIEWAGGLINWDSEDIKK.Y

 
      Proteins matching the same set of peptides:
      8080.2                            Mass: 52187    Score: 139    Queries matched: 3
 |Utr2| CONTIG=Contig20123 POSCDS1=148155 POSCDS2=149567
      29345.1                           Mass: 54908    Score: 139    Queries matched: 3
 CONTIG=Contig10123 POSCDS1=148333 POSCDS2=149745
11.   24611.1                           Mass: 47890    Score: 123    Queries matched: 7
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   427.74   853.47   853.40   0.07 0  22  0.77 1  R.FDNPSFK.S
10   505.79   1009.57   1009.50   0.07 1  23  0.7 1  K.RFDNPSFK.S
15   548.29   1094.56   1094.49   0.08 0  23  0.65 1  R.YDQAQDDIK.K
 18   618.83   1235.65   1236.63   -0.98 0  (3) 80 3  K.NDTHHILIMK.F + Oxidation (M)
 19   618.84   1235.66   1236.63   -0.97 0  7  26 2  K.NDTHHILIMK.F + Oxidation (M)
 21   618.84   1235.66   1236.63   -0.97 0  (4) 55 4  K.NDTHHILIMK.F + Oxidation (M)
31   702.90   1403.78   1403.70   0.08 0  48  0.0022 1  K.DAVTWSVDGSVIR.T

12.   19771.1                           Mass: 142317   Score: 120    Queries matched: 1
 |Als5| CONTIG=Contig10233 POSCDS1=63367 POSCDS2=67410
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 76   1274.71   2547.40   2547.31   0.10 0  120  1.1e-010 1  K.ALGTVTLPIAFNVGGTGSSVDLEDSK.C

 
      Proteins matching the same set of peptides:
      21493.1                           Mass: 142567   Score: 120    Queries matched: 1
 CONTIG=Contig20233 POSCDS1=62616 POSCDS2=66659
13.   mTOS1                             Mass: 47812    Score: 112    Queries matched: 1
 |predicted| C. albicans |CA2303| 468 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
57   956.98   1911.95   1911.89   0.07 0  112  8e-010 1  K.TGCGELDLFEVLSSGSNK.M

 
      Proteins matching the same set of peptides:
      6517.2                            Mass: 49921    Score: 112    Queries matched: 1
 |Tos1| (no GPI) CONTIG=Contig10123 POSCDS1=187827 POSCDS2=189233
      25628.1                           Mass: 51833    Score: 109    Queries matched: 1
 CONTIG=Contig20123 POSCDS1=187678 POSCDS2=189084
14.   mPga4                             Mass: 47426    Score: 89     Queries matched: 2
 |predicted| mIPF8796 C. albicans CA4800| 451 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
22   618.85   1235.69   1235.61   0.08 1  50  0.0015 1  K.TKNPSGDGGYLK.S
36   770.89   1539.76   1539.67   0.09 0  39  0.017 1  K.GDSVTTNDDFDNLK.S

 
      Proteins matching the same set of peptides:
      8796.1                            Mass: 49422    Score: 89     Queries matched: 2
 |Pga4| CONTIG=Contig10194 POSCDS1=248535 POSCDS2=249890
      23247.1                           Mass: 53324    Score: 89     Queries matched: 2
 CONTIG=Contig20194 POSCDS1=251401 POSCDS2=252756
15.   mSod4/Pga2                        Mass: 22239    Score: 84     Queries matched: 3
 |predicted| mIPF1218 C. albicans |CA4835| 232 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   503.77   1005.53   1005.46   0.07 0  13  7.8 1  -.GDSPISTDSK.G
25   649.38   1296.75   1298.68   -1.93 0  (46) 0.0032 1  K.TPAALELGDLSGR.H
26   650.39   1298.76   1298.68   0.07 0  71  1.2e-005 1  K.TPAALELGDLSGR.H

16.   mCHT2                             Mass: 59565    Score: 82     Queries matched: 2
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   510.32   1018.63   1018.54   0.08 0  24  0.72 1  K.GENFVVQVK.N
58   970.05   1938.09   1938.01   0.08 0  58  0.00018 1  K.LFVGVPATSNIAGYVDTSK.L

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 82     Queries matched: 2
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
      19719.2                           Mass: 51350    Score: 82     Queries matched: 2
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
17.   15363.2                           Mass: 40824    Score: 76     Queries matched: 1
 |Pir1| CONTIG=Contig20045 POSCDS1=52307 POSCDS2=53464
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
60   995.51   1989.01   1988.93   0.08 0  76  3e-006 1  K.ACSSANNLEMTLHDSVLK.D

 
      Proteins matching the same set of peptides:
      m15363.2                          Mass: 38940    Score: 76     Queries matched: 1
 |mPir1| 367 aa Candida albicans
      19968.1                           Mass: 36680    Score: 76     Queries matched: 1
 |Pir1| CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
      m19968.1                          Mass: 34796    Score: 76     Queries matched: 1
 |mPir1| 328 aa CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
18.   8527.1                            Mass: 21461    Score: 56     Queries matched: 2
 |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   453.79   905.57   904.50   1.06 0  13  8.1 3  K.QIFQELK.T
29   679.91   1357.81   1357.75   0.06 1  43  0.0069 1  K.KTDDSAPITIVAK.F

 
      Proteins matching the same set of peptides:
      mIPF8527|mPga29:                  Mass: 19928    Score: 56     Queries matched: 2
 189 aa - Candida albicans unknown function
      21875.1                           Mass: 22824    Score: 56     Queries matched: 2
 CONTIG=Contig20225 POSCDS1=30286 POSCDS2=30900
19.   mPga24                            Mass: 52805    Score: 33     Queries matched: 1
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   635.87   1269.72   1269.64   0.08 0  33  0.063 1  K.VITVVACDEHK.C

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 33     Queries matched: 1
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 33     Queries matched: 1
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
20.   22365.1                           Score: 29     Queries matched: 1
 CONTIG=Contig20215 POSCDS1=355726 POSCDS2=355977
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 1   352.73   703.45   703.37   0.09 0  29  0.25 2  R.APFDVR.G

 
      Proteins matching the same set of peptides:
      28240.1                           Score: 29     Queries matched: 1
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   385.78   769.54   771.46   -1.92 0  15  4.7 1  TLKPASR
33   729.93   1457.85   1457.86   -0.01 1  13  6.9 1  IQSILALPSNFKK
8   469.27   936.54   934.59   1.95 1  12  8.5 1  TIKYIAVK
72   1134.61   2267.20   2268.10   -0.90 0  9  14 1  QNEMILTTSLDDLEQLMFK
14   547.31   1092.61   1091.61   1.01 2  8  26 1  KFAAGKSQQK
28   664.38   1326.74   1326.77   -0.02 1  8  25 1  KHGAIPLSTYLK
61   683.02   2046.04   2044.98   1.06 1  6  27 1  SMTQTMPDKFTQISASLK + 2 Oxidation (M)
56   931.93   1861.84   1859.96   1.88 1  5  38 1  TPSLTSNSKITNDNIQK
43   532.29   1593.84   1593.95   -0.11 1  4  49 1  KFFNISVVIVTLSK
98   1147.10   4584.36   4586.24   -1.88 2  4  18 1  GCLFNDTSFLSAMDVMDYSLVIGIDDSSKKLYLGIIDWLR + Oxidation (M)
54   604.33   1809.96   1808.93   1.03 2  3  65 1  QILTGKGEDKMLSFDK
82   1000.47   2998.39   2997.46   0.93 2  3  43 1  GVISEPTKCPREVCGQTNSMVLIHNR + Oxidation (M)
45   806.38   1610.74   1611.85   -1.11 2  3  69 1  IQIEEAKDFYKTK
84   1108.49   3322.46   3321.67   0.79 2  2  44 1  NIPSRGFSGTVYFWGILGLMSFGFYKYSK
32   478.27   1431.79   1430.78   1.01 1  2  85 1  SGSLTRAANINLSK
24   643.87   1285.72   1285.74   -0.01 1  1  1.1e+002 1  QSIKILQQSNK
35   769.39   1536.77   1536.76   0.01 1  1  98 1  TANSSALDSSEKVTK
93   1212.24   3633.71   3632.61   1.10 0  1  47 1  SSSVSSTSSVASSSNANTPSSSCSTTSTTPLGMTPHK + Oxidation (M)
63   1047.03   2092.04   2093.07   -1.03 2  1  90 1  QYYCLNIHSKINVGEKK
95   1318.57   3952.70   3952.18   0.52 1  1  40 1  TAAFAIPILQSLWHAQQPYFALVLAPTRELAFQIK
81   672.09   2684.32   2682.44   1.88 1  1  77 1  IVAPDLYIAVGISGAIQHLAGMKDSK + Oxidation (M)
78   1275.67   2549.32   2549.19   0.13 2  0  86 1  GASEEKSAQNKITTPEEVSMDNGK
83   1023.50   3067.47   3066.53   0.93 0  0  79 1  LYEIEDFNLIQSLSMGQNAVNTVNINK
30   1381.37   1380.36        
42   797.92   1593.83        
49   564.31   1689.91        
75   790.05   2367.14        
77   850.78   2549.32        
79   645.83   2579.30        
85   1164.22   3489.63        
86   1178.20   3531.56        
91   1197.24   3588.68        
92   1202.89   3605.66        
94   1267.80   3800.37        
96   1354.54   4060.59        
97   1394.93   4181.75        
99   1202.86   4807.42        
100   1313.97   5251.85        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 2 Da
Fragment Mass Tolerance: ± 0.8 Da
Max Missed Cleavages   : 2
Instrument type        : ESI-QUAD-TOF
Number of queries      : 100

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 36 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 32.9    0.05    6  mALS3.5eoc R.APFTLR.W
 29.2    0.09   20  22365.1    R.APFDVR.G
  8.3    0.12                  K.ADPMVR.R
  4.8    0.09                  R.EWTIR.K
  4.6    0.10                  K.AEESLR.M
  4.2   -1.91                  K.ESTTIR.F
  4.2    0.09                  K.GGSNTIR.S
  4.2    1.05                  M.LNSTIR.S
  4.2   -1.93                  -.MGITIR.Q
  4.2    1.07                  R.QWTIR.K
Top scoring peptide matches to query 2
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 14.8   -1.92                  K.TLKPASR.Y
 11.5    0.07    6  mALS3.5eoc R.VIPSLNK.V
  6.4    1.12                  K.NPPVTNK.V
  5.1   -0.86                  K.VNQPADK.A
  4.2    0.06                  K.VLPSKAR.L
  4.1   -1.92                  K.TIPSKAR.I
  1.1   -0.93                  K.AIALDLR.T
  0.7   -0.93                  K.VNPSKVK.V
  0.3    1.10                  R.SPIDPIK.L
Top scoring peptide matches to query 3
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 45.7    0.07    4  TRBOTR K.SAASLNSR.V
 23.8    0.11              R.SNDINSR.G
 19.6    1.09              R.GNGSINSR.A
 16.2    0.09              K.QTSLNDK.C
 12.2    0.07              R.SADRAASK.T
  6.9    1.01              K.VESITKK.K
  6.2    1.07              R.SPSISASR.A
  5.5    1.13              M.NDQNWK.N
  4.8    0.05              K.GATTGTGIK.K
  4.5    1.07              K.LDSSNLR.K
Top scoring peptide matches to query 4
Score greater than 27 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 17.4    0.06    8  mEcm33.3 R.VSGGFILK.T
 13.2    0.09                K.VMKSSIR.K
 11.9    0.15                K.DASTGELK.W
 11.7    0.13                R.VCSDVIK.T
 10.8    0.03                K.KVFSVIK.K
  8.9    0.15                K.DKDSDLK.A
  8.9    0.10                R.VSSVSSVR.G
  8.4   -1.86                R.TSLEGSTK.S
  8.2    0.10                K.VEKMGLK.N
  7.8   -1.83                K.TDKESDK.R
Top scoring peptide matches to query 5
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.7    0.07   11  24611.1 R.FDNPSFK.S
 13.1    1.11               -.MSEEVDK.V
 10.3    1.02               K.NFNAIFK.F
  5.6    1.03               K.YAGKDATK.A
  5.3    1.09               K.HPEDMPK.L
  3.5    1.01               K.MSKMKTK.M
  0.3    0.97               R.KPRTSHK.S
  0.3    1.03               -.MSSVASKK.I
Top scoring peptide matches to query 6
Score greater than 31 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.0    0.07    4  TRBOTR K.NKPGVYTK.V
 17.5   -1.92              K.LMKMIEK.K
 13.2    1.06   18  8527.1 K.QIFQELK.T
 12.8    0.08              K.MIKELEK.E
 12.7    1.02              R.KIMELKK.E
 11.5    0.07              R.NQKELFK.Q
 11.4    0.07              R.NKKPEYK.-
 11.4    0.09              K.NQFKNQK.L
 11.3    0.99              K.LKFKELK.S
 11.1    1.02              K.IKKEMLK.A
Top scoring peptide matches to query 7
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 15.1    0.07    8  mEcm33.3 K.LSCSAFNK.L
 11.2    0.06                -.LSCMFIR.S
  1.1   -0.00                R.LSRAHSQK.S
Top scoring peptide matches to query 8
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.0    1.95              K.TIKYIAVK.G
 10.6   -1.06              K.VAQIPIIGK.I
  9.4    0.07              K.KSTNCISK.H
  5.5    1.03              K.DFKDKGVK.K
  5.5    1.02              R.TQYLQRK.S
  3.9    0.07    2  9023.3 K.AYVDEGRK.A
  2.0    0.08              -.MSDSIEKK.D
  1.7    0.01              R.KSTPIYTK.H
  1.4   -1.00              K.YKARSSVK.E
  1.3   -1.97              K.NLNASKHR.V
Top scoring peptide matches to query 9
Score greater than 18 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 13.4    0.07   15  mSod4/Pga2 -.GDSPISTDSK.G
  5.3    1.03                  K.ELIAESESK.Q
Top scoring peptide matches to query 10
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.5    0.07   11  24611.1 K.RFDNPSFK.S
  6.7   -0.98               R.MFELVTKK.N
  6.1   -0.83               K.FFSYCCK.R
  6.1   -0.94               MFSIPVSSK
  6.1   -0.99               -.MFTRSLIK.G
  6.1    0.12               K.NSSNNISMK.I
  6.0    0.07               K.INSKCNFK.Y
  6.0    0.03               K.ITTNSSLFK.T
  5.8    0.03               K.TASETKFVK.S
  5.4    0.03               K.KQFERFR.S
Top scoring peptide matches to query 11
Score greater than 32 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 23.7    0.08   16  mCHT2 K.GENFVVQVK.N
 17.8   -0.90             K.GEFDVNLVK.K
  7.5   -0.83             R.GEEGMISANL.-
  7.5    0.06             K.VKKESDSVK.T
  4.8    0.08             K.DANVFVLNK.E
  2.8    0.15             K.YHRDCLR.C
  2.8   -1.91             K.SVNALFSQR.W
  2.2   -0.87             K.MAGENELIK.S
  1.8   -1.89             K.SMVAMQRAK.L
  0.9   -0.99             K.YQLSRLLK.G
Top scoring peptide matches to query 12
Score greater than 26 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 52.4    0.07    7  mPhr2 SNTDASAFVK
 10.7    0.07             R.NMHPEQRK.Q
  8.3    1.03             K.SITFKAEDK.R
  7.8   -1.01             -.MATVIPPPSK.K
  6.3    0.02             K.SNVIDNLHK.N
  5.8    1.10             R.GLMDCLMAK.C
  5.7    0.08             -.CQSIMSSVK.Y
  5.6   -1.98             R.KKYASTESK.W
  5.4    0.97             K.KKFFALER.D
  3.9   -0.05             K.SGPSVIVPRK.A
Top scoring peptide matches to query 13
Score greater than 29 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.4    0.07    4  TRBOTR K.LKSAASLNSR.V
 15.0    0.11              R.IQSQSNLTR.G
 14.8    0.08              QLSSENKLK
  9.3   -0.88              K.NQSNSISIGK.E
  7.9   -0.01              K.IKTLGLFVR.I
  7.4    0.08              K.IQKSLENSK.H
  7.2   -1.91              R.SRSSSPTKAK.-
  6.9    0.10              R.KQWWRSR.F
  6.8   -1.91              R.ETFRLSAPK.F
  6.6   -0.88              K.QNSDLVMLK.Q
Top scoring peptide matches to query 14
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.7    1.01        K.KFAAGKSQQK.L
  7.5    0.98        K.YLKENVAKK.L
  4.5   -1.98        K.RYAEKVAMK.K
  3.3    1.07        R.FHNVTEFAK.Y
  2.7   -0.01        K.KMKLSTLEK.S
  1.9    0.02        K.FKSWVEAVK.E
  1.3    1.21        R.GCDCFSFSL.-
Top scoring peptide matches to query 15
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 23.3    0.08   11  24611.1 R.YDQAQDDIK.K
  6.2    0.07               -.MTGVTEGGDTK.V
  1.6    1.94               K.QIKPTIEHK.N
  0.8    0.00               K.DYASAVGTLAK.I
  0.7    1.02               K.YNQTAQELK.S
Top scoring peptide matches to query 16
Score greater than 26 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 67.2    0.08    1+ 15898.1 K.SNQQAAISSIK.S
  9.2    0.07               R.NGPSMILSSIK.L
  7.3    1.07               R.DVNKTIQEAK.Q
  6.8   -0.97               K.ELSETIKSLK.T
  1.3   -0.92               K.TGTSSQKPVSR.F
  1.1   -1.91               R.MISTNIVGEGK.T
  0.8   -0.95               R.GDLMLAIMKR.S
  0.7   -0.98               K.KKEITISSNK.K
  0.1    1.11               K.AQQAGDLDLSK.G
Top scoring peptide matches to query 17
Score greater than 26 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 82.5    0.07    8  mEcm33.3 R.VSGGFILKTDGK.L
  7.9   -1.93                R.TTVRSLMSKGK.D
  7.4    1.05                R.VIPHDAITAVGK.G
  7.1    0.16                K.SVASESNPTTTK.Q
  5.5   -1.88                R.TSVDSRRTSSK.T
  5.0   -1.82                R.NMIGQSQSGTGK.T
  3.1    0.09                K.YNNRIISDVK.V
  3.0    0.10                R.SSWLSKLTGDK.K
  2.6    1.15                K.ISEDDTIDKGK.N
  2.2   -1.85                R.TCNRLKSCGK.H
Top scoring peptide matches to query 18
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.0    0.07    5  mRBT5   IYDQLPECAK
  8.3    1.01               K.VDSSSKIDKEK.K
  2.6   -0.98   11  24611.1 K.NDTHHILIMK.F
  0.6   -1.03               K.FIKNTIYPNK.F
  0.6   -0.08               R.HRLLTEIINK.D
  0.5    0.96               K.KIQFSKLDEK.W
  0.3    2.00               K.KQSSSLGAITDK.N
  0.1   -0.97               -.MQESKDIKMK.D
  0.1    0.08               R.SIHHELEEDK.K
  0.0    2.00               K.SSTNTIELNKK.G
Top scoring peptide matches to query 19
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 28.8    0.07    5  mRBT5   IYDQLPECAK
  7.5   -0.97   11  24611.1 K.NDTHHILIMK.F
  5.6    0.08               R.SIHHELEEDK.K
  4.5    0.05               K.FIDVELSDNGK.E
  4.1    0.93               K.YLTLKIVETR.-
  3.0    1.96               R.SLRMNLILMK.I
  2.9    1.02               K.VDSSSKIDKEK.K
  2.5   -0.08               R.HRLLTEIINK.D
  1.6    0.04               R.ENFEGGKEKAK.Q
  1.3    0.01               K.GAGSFVNEKTVK.V
Top scoring peptide matches to query 20
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.9    0.07    5  mRBT5 IYDQLPECAK
  7.0    1.02             K.VDSSSKIDKEK.K
  5.0    1.08             K.GRNEMIQSER.L
  4.8    0.96             K.KIQFSKLDEK.W
  3.0    0.05             K.VGSNSTSQTVTR.V
  0.4    0.02             K.IDYQSIQIEK.S
  0.3    0.93             K.YLTLKIVETR.-
Top scoring peptide matches to query 21
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 34.1    0.07    5  mRBT5   IYDQLPECAK
  8.2    1.02               K.VDSSSKIDKEK.K
  5.0    0.93               K.YLTLKIVETR.-
  4.2   -0.97   11  24611.1 K.NDTHHILIMK.F
  3.6    2.00               R.ELQENITLFK.L
  2.7   -0.97               K.LMMMKTLPPK.M
  1.7    0.02               K.IDYQSIQIEK.S
  1.4    0.97               K.KIQFSKLDEK.W
  0.7    1.99               K.ELMIKQELSK.N
  0.5   -1.03               K.FIKNTIYPNK.F
Top scoring peptide matches to query 22
Score greater than 33 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 49.9    0.08   14  mPga4 K.TKNPSGDGGYLK.S
 17.4    0.01             K.TKNEKITQFK.V
  8.0    1.03             K.DLIWGIDYIK.V
  5.4    0.14             K.DDIESINSDTK.Q
  4.7    0.06             K.KTTTNGKTEEK.K
  4.4   -1.99             K.LFYLSGVINGR.Y
  4.1    0.05             R.QTLEVITTMGK.F
  4.0    1.07             K.QTMETLKAGEK.L
  3.5    0.05             R.KTGLEADIDFK.T
  3.3    0.08             K.IDDKQFQTNK.L
Top scoring peptide matches to query 23
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 33.4    0.08   19  mPga24 K.VITVVACDEHK.C
  3.0   -0.01              R.IVLSQVNEIQK.H
  1.2   -1.98              K.LVRGAYIHSEK.N
  1.1   -0.93              K.RKEVHSQEMK.E
  1.0    0.08              R.SNISLPMVEHK.G
  0.6   -0.05              K.LISVEKLNNLK.V
  0.6    1.03              K.LGSSHQQSGLKK.G
  0.5    1.99              K.VILSPLNFTHK.V
Top scoring peptide matches to query 24
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5   -0.01        R.QSIKILQQSNK.I
Top scoring peptide matches to query 25
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 46.4   -1.93   15  mSod4/Pga2 K.TPAALELGDLSGR.H
 28.5    0.06    7  mPhr2      -.EDLPAIEIVGNK.F
  6.0    0.10                  -.PSPGLGEEVDGIK.S
  2.5    1.04                  K.KVEPEVKNEPK.A
  0.5   -0.05                  R.VVIVATIDNLLK.G
Top scoring peptide matches to query 26
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 71.0    0.07   15  mSod4/Pga2 K.TPAALELGDLSGR.H
  5.0   -0.05                  K.LLIPQRFITAK.K
  1.5    0.07                  R.AGVLEPEGMVGIK.Y
Top scoring peptide matches to query 27
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.6    0.08    7  mPhr2 K.ASGYESATNDYK.N
Top scoring peptide matches to query 28
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.5   -0.02        K.KHGAIPLSTYLK.V
  3.7   -0.05        R.KRLDLELAELK.R
  2.2   -1.07        K.KLSKIEQELIK.E
  0.7    0.13        K.QASEMYNDIIK.Q
  0.3   -0.96        K.ITDLKPLDDNGK.V
Top scoring peptide matches to query 29
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 43.3    0.06   18  8527.1 K.KTDDSAPITIVAK.F
  9.4    1.05              K.KVVDSNGKVHFK.W
  4.1   -0.87              R.KAYTPCIAHNGK.L
  3.9   -0.94              K.KESTPTPATATKK.E
  0.6   -0.85              R.KTTIMASTMTSR.D
  0.2    0.11              K.QPTMPGLSSSPIK.E
Top scoring peptide matches to query 30
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 31
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 48.0    0.08   11  24611.1  K.DAVTWSVDGSVIR.T
  9.8   -0.86                K.NFYSEHPDVAAR.S
  5.3    0.03                K.LIDCFKPGDIVK.A
  5.2   -1.09                R.LKYKQLTTAIVK.F
  3.8   -0.01                K.KLTEEIVTSSVAK.N
  3.1    0.06    8  mEcm33.3 -.ANNSTLTTATPSVK.S
  3.0   -0.95                K.LPPTNPTNPQQAK.T
  1.0    0.06                K.LTITTTQVDQER.S
  0.6   -1.89                K.QTEDTTEDAKIR.S
  0.5    0.07                R.ICLLDIDMQGVK.S
Top scoring peptide matches to query 32
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.0    1.01        R.SGSLTRAANINLSK.I
Top scoring peptide matches to query 33
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.2   -0.01        K.IQSILALPSNFKK.I
  8.1    0.00        R.INTILDKLNSSIK.Y
  6.7    0.20        K.APCSVVDGDTYFK.W
  6.0    0.04        K.DQIKSEAIKAVEK.E
  5.4    0.93        K.KFVVVVAIVAERK.K
  3.9   -0.86        K.EMIEGPLNGNLEK.R
  3.9    0.15        M.DNLDPNSSLQVEK.L
  2.3   -0.80        R.EFQSYEEETGLK.R
  1.1    0.10        K.RPTSCVMIVPGGGK.S
  1.1   -0.81        K.STEHSAGENALSEK.N
Top scoring peptide matches to query 34
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.7    0.08    1+ 15898.1 K.GITYSPYSDNGGCK.S
  1.3   -0.98               K.SCQPPPSSLMKCK.Y
  0.1    0.08               K.SSDGSSSSNSSSSSKK.G
Top scoring peptide matches to query 35
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.4    0.01        K.TANSSALDSSEKVTK.I
  1.4    0.08        K.RRSQSPSEDMSNK.Q
  0.3   -0.02        K.SNFATTRLPSTNTK.V
  0.3    1.98        R.EKMLELALPSSSSK.R
Top scoring peptide matches to query 36
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 38.9    0.09   14  mPga4 K.GDSVTTNDDFDNLK.S
  3.9   -1.16             K.KITEKLINLDNLK.L
  2.2    0.01             K.NFPTTSISFSHFR.F
  1.7    1.03             K.TCNPSNLSFMAGLK.R
  1.6    0.03             K.TGYKNMENDDIIK.L
  1.4   -0.81             K.ENDTMDNWDEEK.L
  0.0   -0.96             R.KMGESFNDKDNIK.R
Top scoring peptide matches to query 37
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 72.8    0.07    7  mPhr2 R.SIPVGYSANDDSAIR.V
  6.9    0.03             R.SLFKNNSSLLDGNR.L
Top scoring peptide matches to query 38
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 64.7    0.05    8  mEcm33.3 K.TIGGALQISDNSELR.S
  3.5   -1.00                R.INEREIWFNILK.F
Top scoring peptide matches to query 39
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 37.5    0.08    8  mEcm33.3 K.TIGGALQISDNSELR.S
Top scoring peptide matches to query 40
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 39.5    0.08    8  mEcm33.3 K.TIGGALQISDNSELR.S
Top scoring peptide matches to query 41
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 58.0    1.07    1  15898.1 R.LYGVDCSQVEAVLK.A
  2.7    0.06               -.IRWGCHNVNNLAK.K
  2.6   -0.05               K.LLHSELDSLKSVIK.D
  1.5    0.02               K.FEKTSKSNIEGTIK.F
Top scoring peptide matches to query 42
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 43
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.2   -0.11        R.KFFNISVVIVTLSK.M
  3.1   -0.92        K.IAADKEVMMDDLTK.Y
  0.2   -0.01        R.NSQIMIELLNIYK.L
  0.0    0.98        R.SPTPEEPHALLFKK.R
Top scoring peptide matches to query 44
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 49.4    0.07   10  mUTR2 R.IQFSLWPGGDSSNAK.G
  3.4   -1.98             K.STSSLSRIASHTSFK.A
  2.7    0.95             R.LKAYGIVSADKWVR.N
  1.7    1.09             K.AKEEMSRQEQAGGGK.K
  1.5    0.10             R.NDEISTDNEINKSK.N
Top scoring peptide matches to query 45
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6   -1.11        K.IQIEEAKDFYKTK.G
  2.1   -0.07        K.EATPDVQQVAETVPK.T
  0.6   -1.14        R.RGEARSVLNEVQVR.H
Top scoring peptide matches to query 46
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 87.3    0.07    3  mSSR1 -.APPACLLACVAKVEK.G
  4.0   -1.02             K.APLCSIELLIRKSK.K
Top scoring peptide matches to query 47
Score greater than 26 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
112.1    1.06    3  mSSR1 K.CSGLNDLSCICTTK.N
  6.7    1.85             K.IERNKNLLDNTLGK.L
  2.1   -1.10             K.IVEISSLGEGNGGAVTK.C
  1.8   -1.06             K.TVSVVYEACKVGYR.H
Top scoring peptide matches to query 48
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
103.6    0.08    9  mALS4.5f K.FITDQTSIDLVADGR.T
  8.3    0.07                K.CMLLSIAYLSHTNK.E
  8.0    0.05                K.VFDYAQQPLRATNK.D
  7.9    0.04                K.YLSLDNNINEIKSK.L
  4.8   -0.96                R.RLDFAKQSTIEESK.E
  4.0   -1.93                K.MDKFVKVVWELNE.-
  2.1   -0.89                K.QMGGGLKSGIPGGMSMK.H
  1.6    0.00                K.IGDKTFLKIASDNTK.Q
  1.6   -0.96                K.SNKFLPSLLDGVSMK.L
  1.1    0.00                K.TIIYLGDLGNQTSKK.G
Top scoring peptide matches to query 49
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 50
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 87.7    0.07    3  mSSR1 K.EICPNGDADTAISAFK.S
  3.0    1.91             K.ITAVIPQFPYSKQSK.M
  1.6    0.96             R.LQSAGSSGGITTLQMIK.T
Top scoring peptide matches to query 51
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 51.1    1.07    3  mSSR1 K.EICPNGDADTAISAFK.S
  3.8   -0.99             K.SGPGPRCGHSMTLLPK.F
  2.1   -1.16             K.LVVISKDEGIRPGVTK.E
  0.8   -1.94             R.GSAKVCSATNFSPVSAE.-
Top scoring peptide matches to query 52
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 47.3    0.07    5  mRBT5 IYDQLPECAKECVK
 19.1    1.06             R.TTQSTLNFEPLGDSNK.R
 12.5    0.06             K.DFEKAMSLRDHEFK.E
 11.3    1.05             R.IYDQIPKCAQECVK.Q
 11.1    0.00             R.SWLPSIYLCITGTNK.L
  6.9   -1.00             R.MMWHYMLKILIMK.F
  6.8   -0.10             K.YLEFFKVIKPVQNK.N
  4.6    1.90             K.YLILMFIPQNKSKR.L
  1.9   -0.19             R.IMILKPKKPNSALRK.C
  1.9   -0.01             K.CPYDNSVQLRIFIK.R
Top scoring peptide matches to query 53
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 49.2    1.13    5  mRBT5 IYDQLPECAKECVK
  4.6    1.04             K.FENKKLSEELQMLK.E
  2.1   -1.82             R.DYGPQEAAAAMNRMAK.L
  2.1    1.02             K.IYNLYLFLSGQFFK.N
  1.0    0.16             R.NTGRTVSMCNGGPSTAK.Y
Top scoring peptide matches to query 54
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7    1.03        K.QILTGKGEDKMLSFDK.T
  2.1    1.91        K.ISNVNIKDLNLKNVPK.K
  1.6    0.93        R.QLETKGPIDVLITTPGK.I
  0.8    1.04        K.KKSFPVDDEIIDEFK.N
Top scoring peptide matches to query 55
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 62.9    0.08    1+ 15898.1 K.ADGPYNAEKYWGIYSN.-
Top scoring peptide matches to query 56
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    1.88        K.TPSLTSNSKITNDNIQK.K
  4.7    1.79        K.DIPPPPSRESLIGNLKK.V
  0.5   -0.12        K.TDKDTLHSPLGTIHAEK.I
Top scoring peptide matches to query 57
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
111.8    0.07   13  mTOS1 K.TGCGELDLFEVLSSGSNK.M
  9.7    0.09             K.QNQTSTMLYHGMFPNK.H
  1.6    1.13             R.GMNSALMDTLAACGDVNR.N
  0.9   -1.96             K.RLQSHLPEYDPSEDTK.N
Top scoring peptide matches to query 58
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 57.9    0.08   16  mCHT2 K.LFVGVPATSNIAGYVDTSK.L
  7.2   -0.82             K.EEGQEYAQITKMLGNGR.I
  4.7    1.16             K.LNTSVYYEYAKAEQMK.S
  2.2    0.90             K.RLLNSVLMLKVSIPLNK.K
  1.7   -0.81             R.EMNNIANLDGKNQYMGK.L
  1.2    0.05             K.EAEWILERRIYYAVK.T
  1.1   -0.95             K.TPQEINADIAKIEKQNK.K
  0.9    0.12             K.LSNVGTGSFDVFAQMPRL.-
  0.6    0.07             K.LHDSAQSELSNLKQQLK.E
  0.2    1.23             K.VCVCVCVSVGGGGGSNNQK.K
Top scoring peptide matches to query 59
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 70.9    0.08    1  15898.1 K.SSCGASAILFTAFNDLWK.A
 70.9    0.08    2  9023.3  K.SSCGASALLFTAFNDLWK.A
  3.1   -0.99               K.YPSMSQVHVPIDRKTSK.N
  2.1    0.09               K.VDDSMGLSFQFNKQDLK.N
  1.6    0.01               K.ISLVNGDPESEITLEMLK.N
  1.5   -0.95               M.SRHQYDLIQCMKQPGK.S
  0.9   -1.04               R.GQGGRFLTAAEIAELEKAK.Q
Top scoring peptide matches to query 60
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 76.0    0.08   17  15363.2 K.ACSSANNLEMTLHDSVLK.D
  1.5    1.96               K.KTVPSNYLVTPSEPAAWK.R
  0.7    0.97               K.SATHEHEVIPSKDLANLK.N
Top scoring peptide matches to query 61
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.2    1.06        R.SMTQTMPDKFTQISASLK.I
  2.3   -0.01        R.RAVFSHITMQPGSVPFTR.V
Top scoring peptide matches to query 62
Score greater than 31 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
155.9    0.09    1+ 15898.1 K.SESQIASEIAQLSGFDVIR.L
  9.0    0.05               R.GPSSTLKFLRGIDDITDSK.V
  7.6    1.09               R.TNSPSSNWRLISILSMKD.-
  6.3    1.03               R.TRSTTSSLRPSATSIASGIR.N
  6.1    1.33               K.DNNDNQEGDDNEKEEQR.E
  3.5   -0.98               K.SQVTPSTDKSKVSFGLLTR.K
  3.4   -1.67               M.CDNLVNTEPTNCDNDDR.I
  2.4   -0.84               K.SKESLETDDVQDTVDNKK.L
  1.7   -0.79               K.IKIMNSNNKMMMMSSSR.I
  1.7   -0.79               K.IKIMNSNNKMMMMSSSR.I
Top scoring peptide matches to query 63
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2   -1.03        -.QYYCLNIHSKINVGEKK.R
Top scoring peptide matches to query 64
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 69.9    0.09    6  mALS3.5eoc K.GLNDWNYPVSSESFSYTK.T
Top scoring peptide matches to query 65
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 67.1    0.09    3  mSSR1 K.CLKEICPNGDADTAISAFK.S
  4.8    0.10             K.KQCPECNLYFSNLATHK.S
  1.7   -1.09             R.SIIKSFKPSASFSSSIISPK.S
Top scoring peptide matches to query 66
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.0    1.07    3  mSSR1 K.CLKEICPNGDADTAISAFK.S
  2.2    1.08             K.TYAYGSKTAEETRNSFER.K
Top scoring peptide matches to query 67
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 90.0    0.09   10  mUTR2 K.GTIEWAGGLINWDSEDIKK.Y
  1.8   -1.90             K.DQFEGLELKNWGESTKPR.V
  1.2    0.15             R.QVLMSDPNWNRGFYYNK.I
Top scoring peptide matches to query 68
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.3    0.09   10  mUTR2 K.GTIEWAGGLINWDSEDIKK.Y
  0.8   -1.88             K.DRAIGFDASGKMVYLHPEQ.-
Top scoring peptide matches to query 69
Score greater than 31 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
162.3    0.09    4  TRBOTR R.LGEDNINVVEGNEQFISASK.S
  8.4   -0.03              K.IVSVKDNLGLVMFAVSDVEK.C
  5.6    0.09              K.LGEEYCDWNAAKVAPPKSK.E
  1.5    0.01              R.NIDDLRPMKDFIMRIASK.H
  1.5    1.13              M.GLSNDQSPLLGGDSLTCWNK.K
  1.1   -0.10              R.AAIKENKPQTKVNEIAIPAK.F
  0.3   -1.05              K.NIAKYLPIQDLLSFSQVSK.N
Top scoring peptide matches to query 70
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 59.4    0.09    4  TRBOTR R.LGEDNINVVEGNEQFISASK.S
  1.9   -0.10              R.AAIKENKPQTKVNEIAIPAK.F
Top scoring peptide matches to query 71
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.1    0.08    7  mPhr2 K.NLGIPIFFSEYGCNEVRPR.K
  4.6    0.07             R.GRALGITFQLPEMDKVDMSK.Q
  3.0    0.80             R.QLRIIALTAFVLGLIFTLHK.V
  2.3   -0.93             K.REIPVFWDEIYFPVAEMK.T
Top scoring peptide matches to query 72
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8   -0.90        K.QNEMILTTSLDDLEQLMFK.Y
  8.7    1.13        R.DNNHQQQHQQVHQQTQLR.T
  8.7   -0.90        R.IVHLSLDMNNSSEHLREMK.K
  8.7   -0.03        K.LYSIILRTNGDLYCPKTIK.L
  8.7   -1.88        K.SKTTKTAESTPEVTETSDTEK.E
  8.7   -0.90        K.TPEQIEYDNKVRELTYDR.R
  8.2    0.05        -.MFQFIPFPISFTKMNIFK.K
  2.1    1.17        -.MTTSPPIQDDEQDEEFKLK.Q
  1.2    1.06        R.HGFLYSLLGDGIFTLDGAGWK.H
  1.2    1.96        K.LLLKNTINGTKSMFVDSGSLK.S
Top scoring peptide matches to query 73
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 70.7    0.09    4  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 11.8   -1.83              K.FPNLVFEDGFTEEDLLFDK.Y
  9.4   -0.01              R.RDPPSFSKIPPALLHLDELK.D
  5.8   -0.82              R.MLGGLLSAYHFSNDDVYLDK.A
  5.7   -1.01              K.FISIKDHSLLDVHHLSVSVK.T
  4.9   -0.93              K.MNLLRMDFIHDTIRQNLK.L
  4.9    0.21              -.YHTTGELPMSEEEEDKHLK.S
  4.4   -0.97              R.SDLGKWWSLESISVGRINVK.Q
  4.2   -0.77              R.FGCMSVFAAIACCNYFVLK.L
  3.9    0.01              K.DNTKVNLIYGNLTPEDILLK.K
Top scoring peptide matches to query 74
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 31.3    1.08    4  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 23.5   -1.00              R.KKPPFFFTSSFLACILMIK.L
  6.4   -0.97              K.QILAGVHYLHSMGLAHRDLK.L
  0.6   -1.08              -.KLLLTMIPNHILILGSPNSGK.L
  0.4   -1.93              R.QILEQLDQDTTFVLQEIDK.N
Top scoring peptide matches to query 75
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 76
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
119.6    0.10   12  19771.1    K.ALGTVTLPIAFNVGGTGSSVDLEDSK.C
119.6    0.10    6  mALS3.5eoc K.ALGTVTLPLAFNVGGTGSSVDLEDSK.C
  1.7    0.11                  R.IAIHGAGNRMTLGGIDEVAKFMSK.H
Top scoring peptide matches to query 77
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 78
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5    0.13        K.GASEEKSAQNKITTPEEVSMDNGK.C
Top scoring peptide matches to query 79
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 80
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.6    0.10    7  mPhr2 K.CVVDDKVDSDDYSDLFSYICAK.I
Top scoring peptide matches to query 81
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.6    1.88        K.IVAPDLYIAVGISGAIQHLAGMKDSK.V
Top scoring peptide matches to query 82
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7    0.93        R.GVISEPTKCPREVCGQTNSMVLIHNR.S
  0.1    1.93        R.AAVKDNNYFGDSAKSADIDADVDLLIEK.F
Top scoring peptide matches to query 83
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.1    0.93        R.LYEIEDFNLIQSLSMGQNAVNTVNINK.T
Top scoring peptide matches to query 84
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.2    0.79        R.NIPSRGFSGTVYFWGILGLMSFGFYKYSK.V
  1.0   -1.26        K.YDNWALNLASLNLIAFYLKNLKPSQDGDK.A
Top scoring peptide matches to query 85
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 86
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 87
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 70.2    0.15    9  mALS4.5f R.TYATCNLNSAEEFTTFSSVSCTVTTTMTADTK.A
Top scoring peptide matches to query 88
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
195.3    0.06    5  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
  1.5    0.02             K.MDVNNVCPWSEQMDNKSGAPAADTPANPEFIK.L
Top scoring peptide matches to query 89
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 79.6    0.11    5  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
  0.1    0.08             K.MDVNNVCPWSEQMDNKSGAPAADTPANPEFIK.L
Top scoring peptide matches to query 90
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
111.4    0.15    5  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
Top scoring peptide matches to query 91
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 92
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 93
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2    1.10        R.SSSVSSTSSVASSSNANTPSSSCSTTSTTPLGMTPHK.R
Top scoring peptide matches to query 94
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 95
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.1    0.52        K.TAAFAIPILQSLWHAQQPYFALVLAPTRELAFQIK.D
  1.1    0.76        K.NAIHVLDFGYTLKYSITSYEKQAEFYAQPQSGQR.I
  1.1    1.82        K.LDITIVADHLPGDIDHTYTSPFAGANWHSFATPEDK.R
  1.0    0.61        K.LREIGLIGVFAGYGFSLVKESFGFAFYFSTFEIIK.T
  1.0    0.56        K.DRSHILLQHVQSVTNSGHFQIDSIKLQITIQLQR.K
  1.0    1.78        K.INGMDVLATYQASKFAKDWASQGNGPLVLEYETYR.Y
Top scoring peptide matches to query 96
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 97
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 98
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6   -1.88        R.GCLFNDTSFLSAMDVMDYSLVIGIDDSSKKLYLGIIDWLR.T
  3.6   -1.88        R.GCLFNDTSFLSAMDVMDYSLVIGIDDSSKKLYLGIIDWLR.T
  2.9   -0.01        K.DSSVGTNIMIAGIAAQVVAMTIFLVFWFEFLNRLYFKNSR.S
Top scoring peptide matches to query 99
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 100
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide