Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0308_q2.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 22 Mar 2007 at 17:25:45 GMT
Significant hits: mALS3.5eoc  |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mALS1.5eoc  |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  mCHT2       583 aa - chitinase 2 precursor Candida albicans
                  mRBT5       |predicted| C. albicans fungus|CA2558| 241 aa
                  8527.1      |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
                  TRBOTR      trypsin (EC3.4.21.4 ) precursor-bovine
                  12297.1     CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
                  mALS4.5f    |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
                  mPga10      |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
                  19516.2     |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
                  15898.1     |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 43 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mALS3.5eoc                        Mass: 94266    Score: 900    Queries matched: 19
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   352.71   703.41   703.40   0.01 0  37  0.25 1  R.APFTLR.W
6   385.75   769.49   769.47   0.02 0  14  30 1  R.VIPSLNK.V
 19   448.24   894.46   894.41   0.05 0  13  45 2  L.NMPCVFK.F
26   533.82   1065.62   1065.55   0.08 1  20  11 1  N.TVTFNDGGKK.I
30   556.83   1111.64   1111.57   0.07 0  17  18 1  K.GPGTPTWNAVL.G
32   564.83   1127.66   1127.58   0.08 0  47  0.021 1  D.CSNIHVGITK.G
43   628.40   1254.78   1254.66   0.12 0  64  0.00053 1  S.QTSVDLTAHGVK.Y
46   659.86   1317.71   1317.60   0.11 0  48  0.019 1  L.TWSNAATYNYK.G
52   695.90   1389.79   1389.66   0.13 0  60  0.0011 1  K.TCSSNGIFITYK.N
54   711.43   1420.84   1420.72   0.12 0  84  5.7e-006 1  L.TCTVSNTLTPSIK.A
55   714.92   1427.83   1427.73   0.10 1  70  0.00012 1  -.KTITGVFNSFNSL.T + Deamidation (NQ)
 57   732.91   1463.80   1463.67   0.13 0  3  5.2e+002 4  F.NVGGTGSSVDLEDSK.C
58   734.92   1467.83   1467.71   0.11 0  35  0.36 1  K.NVPAGYRPFVDAY.I
72   816.95   1631.89   1631.76   0.13 0  85  3.6e-006 1  F.NSLTWSNAATYNYK.G
79   878.51   1755.00   1754.86   0.14 0  100  1.2e-007 1  Y.GDVQIDCSNIHVGITK.G
85   913.46   1824.90   1824.75   0.15 0  86  2.6e-006 1  L.SYANEYTCAGGYWQR.A
86   921.02   1840.03   1839.92   0.12 0  13  61 1  K.NVPAGYRPFVDAYISAT.D
105   1020.52   2039.03   2038.88   0.15 0  108  1.8e-008 1  Y.TLSYANEYTCAGGYWQR.A
109   698.71   2093.11   2092.94   0.17 0  21  8 1  K.GLNDWNYPVSSESFSYTK.T

2.    mALS1.5eoc                        Mass: 69052    Score: 351    Queries matched: 8
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   448.24   894.46   894.41   0.05 0  13  45 2  L.NMPCVFK.Y
25   532.33   1062.65   1062.58   0.07 0  33  0.54 1  R.SQSKPFTLR.W
41   617.37   1232.72   1232.62   0.09 0  22  8 1  S.QTSVDLTADGVK.Y
48   661.89   1321.77   1321.65   0.11 0  70  0.00012 1  F.STLTCTVNDALK.S
 55   714.92   1427.83   1427.73   0.10 1  70  0.00012 1  -.KTITGVFDSFNSL.T
76   843.49   1684.96   1684.82   0.14 0  78  1.8e-005 1  K.YTTSQTSVDLTADGVK.Y
82   887.50   1772.99   1772.85   0.14 0  56  0.0033 1  K.YQNVPAGYRPFIDAY.I
 109   698.71   2093.11   2092.94   0.17 0  21  8 1  K.GLNDWNYPVSSESFSYTK.T

3.    mCHT2                             Mass: 59565    Score: 307    Queries matched: 6
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   425.23   848.45   848.40   0.05 0  26  2.7 1  K.FADSAPNK.N
 27   545.83   1089.64   1089.58   0.06 0  9  1.4e+002 4  T.GYPELATALR.G
78   860.95   1719.88   1719.72   0.16 0  70  0.00012 1  Y.CSINGQFNYDTWSK.F + Deamidation (NQ)
91   952.04   1902.06   1901.92   0.14 0  105  3.8e-008 1  S.AAPQCPYPDASLGDLLSK.V
95   968.52   1935.03   1934.89   0.15 0  79  1.5e-005 1  -.SNQVALYWGQNGAGGQER.L + Deamidation (NQ)
96   970.57   1939.12   1938.99   0.13 0  25  4.2 1  K.LFVGVPATSNIAGYVDTSK.L + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 306    Queries matched: 6
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
      19719.2                           Mass: 51350    Score: 305    Queries matched: 6
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
4.    mRBT5                             Mass: 22745    Score: 274    Queries matched: 5
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
28   547.31   1092.61   1092.54   0.07 0  46  0.026 1  Q.FAGAVGNCVAK.N
42   618.83   1235.65   1235.59   0.07 0  52  0.0069 1  R.IYDQLPECAK.E
65   775.44   1548.87   1548.74   0.13 0  65  0.00035 1  C.VMPQFAGAVGNCVAK.N + Deamidation (NQ)
88   930.45   1858.88   1858.75   0.13 0  63  0.00051 1  K.QSTSSTPCPYWDTGCL.C
103   1010.47   2018.92   2018.78   0.14 0  51  0.0085 1  K.QSTSSTPCPYWDTGCLC.V

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 274    Queries matched: 5
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 274    Queries matched: 5
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
5.    8527.1                            Mass: 21461    Score: 258    Queries matched: 4
 |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
49   679.92   1357.83   1357.75   0.09 1  (58) 0.0019 1  K.KTDDSAPITIVAK.F
50   679.94   1357.86   1357.75   0.11 1  104  5.5e-008 1  K.KTDDSAPITIVAK.F
104   678.40   2032.19   2032.03   0.17 1  64  0.00065 1  K.HEGAAIDYLFLGKNGADLK.Y + Deamidation (NQ)
110   1062.11   2122.20   2122.06   0.14 0  92  9e-007 1  L.GGDVYELGATDNFIPVTINK.D

 
      Proteins matching the same set of peptides:
      mIPF8527|mPga29:                  Mass: 19928    Score: 258    Queries matched: 4
 189 aa - Candida albicans unknown function
      21875.1                           Mass: 22824    Score: 258    Queries matched: 4
 CONTIG=Contig20225 POSCDS1=30286 POSCDS2=30900
6.    TRBOTR                            Mass: 24662    Score: 188    Queries matched: 5
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
36   587.87   1173.73   1173.64   0.09 0  60  0.0014 1  N.TLNNDIMLIK.L
62   745.94   1489.86   1489.73   0.12 0  22  7.4 1  K.LQGIVSWGSGCAQK.N
99   974.56   1947.11   1947.91   -0.79 0  61  0.0012 1  R.LGEDNINVVEGNEQFISA.S + Deamidation (NQ)
117   758.78   2273.31   2273.14   0.17 0  42  0.092 1  K.SIVHPSYNSNTLNNDIMLIK.L + Deamidation (NQ)
127   1071.24   3210.69   3210.33   0.36 1  9  1.3e+002 1  K.SAYPGQITSNMFCAGYLEGGKDSCQGDSGGP.V

7.    12297.1                           Mass: 15525    Score: 143    Queries matched: 3
 CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 42   618.83   1235.65   1235.59   0.07 1  29  1.4 3  R.IYDQIPKCAQ.E + Deamidation (NQ)
 88   930.45   1858.88   1858.75   0.13 0  63  0.00051 1  K.QSTSSTPCPYWDTGCL.C
 103   1010.47   2018.92   2018.78   0.14 0  51  0.0085 1  K.QSTSSTPCPYWDTGCLC.V

 
      Proteins matching the same set of peptides:
      24214.1                           Mass: 16067    Score: 143    Queries matched: 3
 CONTIG=Contig20166 POSCDS1=63254 POSCDS2=63697
8.    mALS4.5f                          Mass: 167909   Score: 119    Queries matched: 1
 |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
74   825.99   1649.96   1649.83   0.13 0  119  1.5e-009 1  K.FITDQTSIDLVADGR.T

 
      Proteins matching the same set of peptides:
      13010.2                           Mass: 169769   Score: 118    Queries matched: 1
 |Als4.5'| CONTIG=Contig2201 POSCDS1=7312 POSCDS2=12093
9.    mPga10                            Mass: 23610    Score: 83     Queries matched: 2
 |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 42   618.83   1235.65   1235.59   0.07 0  52  0.0069 1  K.IYDQLPECAK.E
 65   775.44   1548.87   1548.74   0.13 0  33  0.6 3  C.VMPQFGGAIGDCVAK.N

 
      Proteins matching the same set of peptides:
      20169.1                           Mass: 25603    Score: 83     Queries matched: 2
 |Pga10| CONTIG=Contig10231 POSCDS1=59560 POSCDS2=60312
      21543.1                           Mass: 25731    Score: 83     Queries matched: 2
 CONTIG=Contig20231 POSCDS1=59564 POSCDS2=60316
10.   19516.2                           Mass: 94340    Score: 81     Queries matched: 2
 |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
24   521.81   1041.60   1041.52   0.07 0  50  0.0095 1  R.HQDFVPATK.I
93   965.53   1929.04   1928.89   0.15 0  35  0.35 1  K.NAVTYDGPVPNNEIPAVC.L

 
      Proteins matching the same set of peptides:
      mIPF19516                         Mass: 90303    Score: 81     Queries matched: 2
 |mHYR1| validated by us| C. albicans fungus|CA1576| 900 aa
      19734.1                           Mass: 94169    Score: 81     Queries matched: 2
 |Hyr1| CONTIG=Contig20216 POSCDS1=152490 POSCDS2=155303
      m19734.1                          Mass: 91992    Score: 81     Queries matched: 2
 |mHyr1| validated by us| C. albicans fungus 917 aa
11.   15898.1                           Mass: 39582    Score: 57     Queries matched: 1
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
67   790.97   1579.92   1579.79   0.13 0  57  0.0025 1  R.LYGVDCSQVEAVLK.A

 
      Proteins matching the same set of peptides:
      m15898.1|mSCW1:                   Mass: 35901    Score: 57     Queries matched: 1
 346 aa - glucanase (by homology) Candida albicans
12.   12218.2                           Mass: 65733    Score: 41     Queries matched: 3
 CONTIG=Contig20218 POSCDS1=16569 POSCDS2=18287
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   352.71   703.41   703.37   0.05 0  20  13 3  N.WQTLR.F + Deamidation (NQ)
 36   587.87   1173.73   1173.54   0.19 1  21  9.4 2  H.VNNNNNNDKK.T + Deamidation (NQ)
 70   803.50   1604.98   1604.75   0.23 0  9  2.1e+002 2  K.NDPIIVNGSTTTTNGT.N + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      28150.1                           Mass: 69785    Score: 41     Queries matched: 3
 CONTIG=Contig10218 POSCDS1=16594 POSCDS2=18312
13.   9787.2                            Mass: 55630    Score: 35     Queries matched: 2
 CONTIG=Contig10137 POSCDS1=15402 POSCDS2=16865
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   441.82   881.62   881.46   0.16 0  14  47 2  I.EQHINLK.L + Deamidation (NQ)
 28   547.31   1092.61   1092.58   0.02 1  21  9.3 2  K.KMTVLTGAGIS.C + Oxidation (M)

 
      Proteins matching the same set of peptides:
      25371.1                           Mass: 55632    Score: 35     Queries matched: 2
 CONTIG=Contig20137 POSCDS1=15149 POSCDS2=16609
14.   23541.1                           Mass: 15844    Score: 33     Queries matched: 2
 CONTIG=Contig20190 POSCDS1=21807 POSCDS2=22214
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   360.71   719.41   719.39   0.03 0  8  1.9e+002 9  I.PYINTI.-
12   417.26   832.51   832.47   0.04 0  27  2.3 1  C.IPYINTI.-

 
      Proteins matching the same set of peptides:
      28663.1                           Mass: 15936    Score: 31     Queries matched: 2
 CONTIG=Contig10190 POSCDS1=21805 POSCDS2=22212
15.   23914.1                           Mass: 9196     Score: 31     Queries matched: 2
 CONTIG=Contig20173 POSCDS1=109358 POSCDS2=109597
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
64   755.43   1508.84   1508.84   0.00 1  20  10 1  N.PNSIDAWQLKLPK.Y
 83   895.50   1789.00   1788.80   0.20 0  12  84 8  E.DCEVNPNSIDAWQLK.L + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      28801.1                           Mass: 9196     Score: 31     Queries matched: 2
 CONTIG=Contig10173 POSCDS1=109092 POSCDS2=109331
16.   2998.1                            Mass: 50169    Score: 30     Queries matched: 2
 CONTIG=Contig2500 POSCDS1=42778 POSCDS2=44067
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   436.28   870.56   870.55   0.00 1  27  1.8 1  L.KQLELIK.L
 95   968.52   1935.03   1935.01   0.03 1  6  2.6e+002 6  Q.QRKPQQHQQYIIDPR.K + Deamidation (NQ)

17.   22365.1                           Score: 28     Queries matched: 1
 CONTIG=Contig20215 POSCDS1=355726 POSCDS2=355977
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   352.71   703.41   703.37   0.05 0  28  1.7 2  R.APFDVR.G

 
      Proteins matching the same set of peptides:
      28240.1                           Score: 28     Queries matched: 1
18.   16267.2                           Score: 27     Queries matched: 2
 CONTIG=Contig10125 POSCDS1=67135 POSCDS2=70089
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   514.35   1026.68   1026.62   0.06 1  21  9.3 1  D.QINRILIR.L + 2 Deamidation (NQ)
 50   679.94   1357.86   1357.71   0.15 1  14  53 9  E.GKDIDTDSPIVAK.K

 
      Proteins matching the same set of peptides:
      25546.1                           Score: 27     Queries matched: 2
19.   1361.1                            Score: 27     Queries matched: 1
 CONTIG=Contig10247 POSCDS1=93801 POSCDS2=96101
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   436.28   870.56   870.55   0.00 1  27  1.8 1  S.KQIELLK.S

 
      Proteins matching the same set of peptides:
      20711.1                           Score: 27     Queries matched: 1
20.   6279.2                            Score: 27     Queries matched: 1
 CONTIG=Contig10244 POSCDS1=29332 POSCDS2=33444
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   436.28   870.56   870.55   0.00 1  27  1.8 1  D.KQLELLK.I

 
      Proteins matching the same set of peptides:
      20840.1                           Score: 27     Queries matched: 1
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   441.82   881.62   881.46   0.16 0  30  1.3 1  LQGPDQPK
5   375.23   748.44   748.39   0.05 1  26  2.8 1  MGELKR + Oxidation (M)
13   419.74   837.46   837.37   0.09 0  25  2.7 1  SSSEETAK
47   660.87   1319.72   1319.65   0.07 0  22  6.2 1  LQQNFGVNSNAK + Deamidation (NQ)
20   461.29   920.57   920.51   0.05 1  22  6.6 1  FIQVWKT
53   701.97   1401.92   1401.71   0.21 0  21  14 1  INEVENISESLR
125   1323.16   2644.31   2644.42   -0.11 0  20  8.6 1  ALIGILEGGFIADLVLWLSYFFTS
38   606.37   1210.73   1210.69   0.05 1  20  11 1  LHDAIMIVKR + Oxidation (M)
29   556.32   1110.63   1110.58   0.05 1  19  11 1  ETLNHVNKR + Deamidation (NQ)
4   360.71   719.41   719.35   0.06 0  18  19 1  IMSVSAP + Oxidation (M)
39   606.89   1211.77   1211.64   0.13 0  17  25 1  VVDKPTTANIGP + Deamidation (NQ)
22   501.81   1001.60   1001.58   0.03 0  17  21 1  TGLVGSQIVK + Deamidation (NQ)
11   415.77   829.54   829.47   0.06 0  17  22 1  KPPTMIK + Oxidation (M)
83   895.50   1789.00   1788.81   0.19 1  17  27 1  NLQFPAAEDQRSHMK + 2 Deamidation (NQ); Oxidation (M)
44   631.88   1261.75   1261.63   0.12 1  17  26 1  DKLVAQYPNGR + 2 Deamidation (NQ)
33   574.87   1147.72   1147.47   0.25 1  16  34 1  QDPQRESNSS + Deamidation (NQ)
10   412.72   823.43   823.39   0.04 0  15  23 1  YMNGIIN
27   545.83   1089.64   1089.54   0.11 0  15  33 1  CIATVVQEGL + Deamidation (NQ)
73   822.45   1642.89   1642.78   0.11 0  15  35 1  MITGDNPLTACHVAK + Oxidation (M)
51   685.38   1368.75   1368.66   0.09 0  15  34 1  YGTELAQMQSLI + Oxidation (M)
7   401.26   800.51   800.39   0.11 0  14  35 1  QGIPEEK + Deamidation (NQ)
31   561.31   1120.60   1120.52   0.08 0  14  45 1  DLNSMEQIR + Oxidation (M)
14   423.24   844.46   844.46   0.00 1  14  45 1  GEIWGRK
97   647.71   1940.10   1939.87   0.23 0  14  57 1  HAIIDYQYAQNGFENR + 2 Deamidation (NQ)
19   448.24   894.46   894.52   -0.06 1  13  44 1  SIKSSFVK
66   780.49   1558.97   1558.82   0.16 1  13  76 1  KLGANYAPCVKPQL + Deamidation (NQ)
8   406.07   810.13   810.42   -0.30 0  13  74 1  DLLAHDK
77   849.97   1697.92   1697.78   0.15 1  13  60 1  KSFLDQEAPEGYVAGS + Deamidation (NQ)
57   732.91   1463.80   1464.60   -0.79 1  13  59 1  ANSNNSKNDESTSP + Deamidation (NQ)
61   742.94   1483.87   1483.68   0.19 0  13  67 1  MSNFSNLSLNNLM
116   1137.16   2272.30   2272.20   0.10 1  13  80 1  FYMIFLALLNAAKITFSFF + Oxidation (M)
45   652.93   1303.84   1303.74   0.10 1  12  90 1  QQRKPVLLQHG + Deamidation (NQ)
9   406.25   810.49   810.34   0.15 1  12  44 1  KQDEYQ + Deamidation (NQ)
87   921.57   1841.12   1840.95   0.17 1  12  98 1  DPTITALIKEGDDNLAR
123   1275.68   2549.35   2549.39   -0.04 1  12  71 1  LLTGDYSLQQRVLILSATLMAAR + Deamidation (NQ); Oxidation (M)
68   531.97   1592.88   1592.81   0.07 0  11  93 1  LTQSIATAAFLFYF + Deamidation (NQ)
34   577.89   1153.76   1153.66   0.10 1  10  1.2e+002 1  QNTLIVRGPR + Deamidation (NQ)
70   803.50   1604.98   1604.74   0.25 1  10  1.6e+002 1  SVSPNASTPNMEKNI + Deamidation (NQ); Oxidation (M)
75   840.49   1678.97   1678.80   0.17 1  10  1.5e+002 1  REMDNQIVLFFLH + 2 Deamidation (NQ); Oxidation (M)
108   1035.04   2068.07   2068.00   0.07 0  10  1.2e+002 1  FIGQSLGPMFGNWINSIGK + 3 Deamidation (NQ)
37   601.83   1201.65   1201.58   0.07 0  9  1.2e+002 1  NGENLSVQLLD + Deamidation (NQ)
89   931.96   1861.90   1861.91   -0.01 0  9  1.3e+002 1  TNENDAPFLMAISPTLK + Deamidation (NQ)
56   727.94   1453.87   1453.76   0.12 1  9  1.7e+002 1  DIPNRHLALEYL + Deamidation (NQ)
106   1024.06   2046.10   2046.02   0.08 0  8  1.6e+002 1  YIPGSGTIISNINIPSPNTS + 2 Deamidation (NQ)
119   1189.09   2376.17   2376.41   -0.24 1  8  1.4e+002 1  NLPLKFTIVFTIIIQFITAAL + Deamidation (NQ)
60   739.40   1476.79   1476.78   0.00 1  8  1.6e+002 1  KAVYKPEISAEDK
40   614.42   1226.82   1226.63   0.19 0  8  2.4e+002 1  SPLPNSTNQLR + Deamidation (NQ)
98   648.03   1941.07   1940.74   0.33 1  7  2.3e+002 1  TSDMNNRNSSINNNNNN + 3 Deamidation (NQ); Oxidation (M)
35   583.79   1165.57   1165.52   0.04 0  7  2.1e+002 1  QSSSNAQQSTK + Deamidation (NQ)
107   1027.05   2052.08   2052.00   0.08 1  7  2.5e+002 1  TTNLKANNIYPSNSISNAK + 3 Deamidation (NQ)
71   809.00   1615.99   1615.77   0.22 0  6  3.8e+002 1  QISVAFVCLGNMYV + Oxidation (M)
115   1117.06   2232.11   2232.09   0.02 1  6  2.7e+002 1  DHIVQDSLQYIKTNSDNLK + 2 Deamidation (NQ)
134   1489.71   4466.11   4465.88   0.23 0  6  1.7e+002 1  LLNDTNSTFVQLDNSDTDIDDSSSNSEDVSSNDEQIALMNS + Deamidation (NQ); Oxidation (M)
81   590.69   1769.05   1768.67   0.38 0  5  4.3e+002 1  EQLDQNDPDQFQGSM + 2 Deamidation (NQ); Oxidation (M)
92   636.74   1907.19   1907.96   -0.77 1  5  5.3e+002 1  SIVKPIYQRSFQSEQP + 2 Deamidation (NQ)
15   424.23   846.45   846.41   0.04 0  5  3.4e+002 1  NQADGTLK + Deamidation (NQ)
102   1007.49   2012.97   2013.06   -0.09 1  5  3.4e+002 1  NVGDGDGLSQLKLLNNILK + 3 Deamidation (NQ)
118   1188.58   2375.15   2374.82   0.32 0  4  3.5e+002 1  YNNGNPFNNNNNNNNNNEGSK + 9 Deamidation (NQ)
111   1088.52   2175.02   2174.88   0.14 1  4  3.7e+002 1  SEGEDIDEYGFPKDSLDME
84   909.53   1817.04   1816.77   0.28 1  4  5.1e+002 1  QSKSQVQPSQESMTSF + 3 Deamidation (NQ); Oxidation (M)
129   1203.63   3607.88   3607.69   0.19 1  4  4.1e+002 1  ENLATNPIDMLELVQSFLSSYKPNSKENEHSA + 3 Deamidation (NQ)
121   1269.61   2537.20   2537.14   0.06 1  4  4.2e+002 1  NVGYDFDLRVMQFFTEGLCPN + Oxidation (M)
94   967.05   1932.09   1931.99   0.11 1  3  6.1e+002 1  QALRSVVNEHYDLFNK
130   1368.99   4103.95   4103.73   0.21 1  3  3.5e+002 1  ITSRLISQPQSSHNQHHNHNHHQQQQQQQQQTGSS + 11 Deamidation (NQ)
90   946.52   1891.03   1890.99   0.05 1  3  6.2e+002 1  YFHKITSPSQLTGLWI + Deamidation (NQ)
114   1108.07   2214.12   2214.13   -0.01 1  3  5.2e+002 1  IQQNQVTRQSILQEIIQLG + 6 Deamidation (NQ)
63   751.88   1501.74   1501.70   0.04 0  2  6.4e+002 1  QAPASASPGGSGAAASSK + Deamidation (NQ)
113   1107.55   2213.09   2213.04   0.05 1  2  6.1e+002 1  SGPNLGETRDEWHLVDFQI + Deamidation (NQ)
69   797.95   1593.88   1593.95   -0.07 1  2  7.4e+002 1  KFFNISVVIVTLSK
59   735.91   1469.80   1469.64   0.16 0  2  6.8e+002 1  IPQKPGGNNNNEW + 3 Deamidation (NQ)
80   442.80   1767.17   1766.84   0.32 0  2  1.3e+003 1  GITSLGSGNNTSFLNQR + 2 Deamidation (NQ)
100   989.05   1976.09   1976.09   -0.00 1  2  8.4e+002 1  LPELNQPLIPQLRSAASK + 2 Deamidation (NQ)
2   525.32   524.31   524.19   0.12 0  1  51 1  MSTNG + Oxidation (M)
132   1423.00   4265.98   4265.97   0.01 1  1  5.8e+002 1  YSEGDIVFLINKYLDSSGNQDEYLPPTDTGNQMDLIAK + 3 Deamidation (NQ)
122   849.82   2546.45   2547.15   -0.71 1  0  1.3e+003 1  FQFSDMKGVYAYHAQQWLEQA + Deamidation (NQ)
21   491.29   980.57   980.53   0.04 1  0  9.8e+002 1  IRTQIYTS
112   731.73   2192.17   2192.02   0.15 0  0  1.1e+003 1  AGINSTSNQSSNISGSSQPINK + 2 Deamidation (NQ)
1   453.78   452.77        
101   995.55   1989.08        
120   833.47   2497.39        
124   867.83   2600.47        
126   912.83   2735.46        
128   1197.25   3588.72        
131   1404.00   4208.98        
133   1477.01   4428.02        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 134

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.4    0.12        R.MSTNG.I
Top scoring peptide matches to query 3
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 36.9    0.01    1  mALS3.5eoc APFTLR
 28.4    0.05   17  22365.1    R.APFDVR.G
 19.6    0.06                  E.QGETIR.K
 19.6    0.03                  S.SVETIR.M
 19.6    0.05   12  12218.2    N.WQTLR.F
 18.1    0.08                  R.APQTMR.Q
 16.9    0.10                  L.ADEDVR.K
 16.9    0.06                  L.ADQITR.R
 15.1    0.01                  PAFLTR
 15.1    0.05                  D.PAFVNR.I
Top scoring peptide matches to query 4
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.7    0.06               -.IMSVSAP.E
 10.8    0.14               K.NTNAGAGN.G
 10.6    0.10               K.LNGSSAGN.G
 10.1    0.10               N.DSGEAKN.-
  8.6    0.07               R.DGSLSKN.A
  8.1    0.10               K.NSGEANK.N
  8.0    0.04               K.ALTSSQI.E
  7.9    0.12               R.SANWQN.I
  7.6    0.03   14  23541.1 I.PYINTI.-
  6.7    0.10               R.NSANANK.L
Top scoring peptide matches to query 5
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.0    0.05        T.MGELKR.H
 20.1    0.03        R.FGLPKST.D
 16.8    0.02        K.FGLKER.T
 16.4    0.02        N.FLGEKR.V
 16.0    0.07        K.FGLLNDA.Y
 14.9    0.02        T.GFIEKR.I
 12.3    0.05        I.FGDRVR.R
 12.3    0.02        F.FGKQIR.V
 12.3    0.06        L.FGQQLR.T
 12.3    0.06        L.FGQQLR.T
Top scoring peptide matches to query 6
Score greater than 26 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 13.9    0.02    1  mALS3.5eoc R.VIPSLNK.V
 12.5    0.13                  K.SPFEPPP.T
 11.0    0.09                  K.NPPVTNK.V
 11.0    0.03                  K.VIPSIIQ.E
 10.3    0.02                  N.VLPISGGK.H
  7.9    0.06                  K.GPEILNK.Y
  7.9    0.06                  K.GPELLNK.Y
  5.7    0.02                  N.PSLVLNK.I
  4.4    0.09                  H.PSIYYK.R
  4.4    0.09                  T.SPLYYK.I
Top scoring peptide matches to query 7
Score greater than 27 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.5    0.11        E.QGIPEEK.D
 13.4    0.04        F.DAILLQK.S
 11.8    0.04        E.GELILQK.K
  9.8    0.03        H.EGILITR.S
  9.6    0.04        M.QVAIIQK.V
  9.3    0.19        K.QPQPESN.S
  8.1   -0.80        K.QPQPESN.S
  7.5    0.08        NPSLLEK
  7.5    0.04        L.AIDLLEK.L
  7.5    0.04        L.ALDLLEK.L
Top scoring peptide matches to query 8
Score greater than 20 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.8   -0.30        L.DLLAHDK.Y
 12.8   -0.30        ILDAHNK
 12.8   -0.27        R.NGIKHNE.A
 12.8   -0.30        N.VIEAHNK.L
  7.0    0.80        R.GNARDDY.G
  7.0    0.72        R.GNINFVF.T
  7.0   -0.27        S.GNNIHEK.L
  3.9   -0.35        K.QNRAPLI.W
  3.2    0.73        K.SSIYAVGN.D
  3.1    0.72        V.GNPNSPPK.N
Top scoring peptide matches to query 9
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.4    0.15        K.KQDEYQ.E
 12.4    0.15        K.QKQDYQ.P
 10.1    0.19        QNQEYQ
 10.1    0.19        QNQEYQ
  6.7    0.02        V.KSIQAHK.S
  5.7    0.06        V.KMIEYK.S
  5.2    0.03        Q.QLPGTAPK.L
  4.2   -0.01        N.KILFYK.T
  4.0    0.06        P.KLMEYK.Q
  4.0    0.15        K.KQDEYQ.E
Top scoring peptide matches to query 10
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.3    0.04        R.YMNGIIN.S
  5.6    0.04        R.FMNGIIN.N
  5.3   -0.02        D.FFNGVIK.V
  5.2   -0.02        N.FFGNIVK.S
  4.3    0.04        R.YNMVAIN.S
  3.4   -0.06        S.IPTPQLR.S
  3.0    0.01        K.FFNAVNL.H
  2.7   -0.01        D.YKSQVAK.L
  2.7    0.03        I.YQTDGIK.G
  2.6    0.06        K.YKQSPNS.K
Top scoring peptide matches to query 11
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.8    0.06        Y.KPPTMIK.N
 16.3    0.09        T.GRGGAGNIK.T
 15.4    0.01        T.KVTELIK.K
 15.4    0.04        N.QVTQLIK.K
 15.3    0.08        S.QAEEIIK.N
 15.3    0.08        P.QALEQLK.H
 15.0    0.09        N.YLMFLK.Y
 14.6    0.13        S.EFFMIK.N
 14.1    0.06        S.NVPMLLK.D
 13.6    0.04        C.KVLDDIK.W
Top scoring peptide matches to query 12
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.9    0.04   14  23541.1 C.IPYINTI.-
 19.5    0.07               E.LNKQSSR.N
 14.9    0.08               V.IPYTPDK.N
 14.9    0.01               N.LPYLVTK.G
 13.4    0.01               R.IFIVQTI.A
 13.4    0.08               K.LPMKSLE.T
 13.4    0.08               R.LPSFQQL.S
 12.9    0.03               R.IFLKANQ.I
 11.7    0.05               Q.IDQKTTK.E
 11.7    0.12               K.INKQSQD.P
Top scoring peptide matches to query 13
Score greater than 26 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.0    0.09        K.SSSEETAK.S
 12.0    0.07        G.DKMETAK.T
 12.0    0.04        K.DQLYTAK.F
 12.0    0.04        S.GIGYETAK.V
 12.0    0.06        K.GNSFNTAK.A
 12.0    0.04        D.KEFDTAK.G
 12.0    0.04        D.KFENTAK.T
 12.0    0.00        F.KQYVTAK.L
 12.0    0.00        H.LYNKTAK.R
 12.0    0.04        V.MTIGTTAK.G
Top scoring peptide matches to query 14
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.8    0.00        I.GEIWGRK.L
 13.8    0.05        R.GELNERQ.Q
 13.8    0.02        Y.NAINERK.T
 13.8   -0.04        L.VSIKDGVK.E
 13.8    0.00        E.WIENRK.E
 13.8    0.00        T.WLENRK.Q
 13.8    0.00        T.WLQDRK.Q
 12.8    0.04        G.DRPCLGK.R
 11.6    0.05        R.EGLENQR.N
 11.6    0.02        F.EGLKNAGR.S
Top scoring peptide matches to query 15
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.04        Y.NQADGTLK.Q
  5.1    0.04        Y.NQADGTLK.Q
  4.5    0.00        I.NKEDTLK.Q
  2.6   -0.03        D.NTTASLLK.Q
  2.5    0.04        K.GSLNNQIT.N
  2.5    0.04        K.GSLNNQIT.N
  1.8    0.03        -.TNRNQLT.T
  1.8    0.01        K.DEEILKT.L
  1.8    0.05        R.DQLEQLT.D
  1.8    0.01        R.ENIEKIT.P
Top scoring peptide matches to query 16
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.0    0.05    3  mCHT2 K.FADSAPNK.N
 15.8    0.02             MVLVGDVT
 13.1    0.11             M.ENLESGAQ.D
 12.9   -0.03             -.FLLERAT.T
 12.9    0.05             K.MRFHAAT.P
 12.7    0.07             R.QVQASDIS.G
  9.4    0.05             N.FADAPNSK.D
  9.4    0.01             S.FADQQLK.S
  8.8    0.12             -.MSHATDST.L
  7.7    0.09             K.EWVQNAT.N
Top scoring peptide matches to query 17
Score greater than 38 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.9    0.00              S.KQIEILK.V
 26.9    0.00   19  1361.1 S.KQIELLK.S
 26.9    0.04              K.KQIELLQ.L
 26.9    0.00   16  2998.1 L.KQLELIK.L
 26.9    0.00   20  6279.2 D.KQLELLK.I
 24.1    0.12              R.QQMSHLK.L
 21.0    0.00              I.QIKELLK.M
 21.0    0.00              A.QLKEILK.G
 18.3    0.03              K.KQINQLK.K
 18.3    0.03              Q.QQLNKLK.N
Top scoring peptide matches to query 18
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 29.7    0.16              V.LQGPDQPK.F
 14.2    0.16   13  9787.2 I.EQHINLK.L
 11.2   -0.80              L.IEQHNNK.C
 11.1   -0.80              L.IEQHNNK.C
 10.9    0.16              K.KDHQLLE.T
 10.8    0.10              M.IAPNLLQI.I
 10.5    0.15              M.LKEHNNK.R
 10.4    0.15              T.LQHKDNK.Q
 10.1    0.16              R.IKHQDEL.D
 10.1    0.16              R.IKNHEEI.Y
Top scoring peptide matches to query 19
Score greater than 24 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 13.3   -0.06                  N.SIKSSFVK.S
 13.2    0.05    1+ mALS3.5eoc NMPCVFK
 12.8    0.01                  I.SASVQEFK.L
 11.1   -0.02                  S.KVTFDSAK.Y
  7.7    0.04                  K.NINSTMAK.Q
  6.5   -0.06                  D.NINVPPIK.E
  6.4    0.03                  E.QMDKMVK.L
  6.4   -0.06                  H.ASSVKYLK.V
  6.3    0.12                  N.NMDDSNAK.N
  6.2    0.04                  K.NINSTMAK.Q
Top scoring peptide matches to query 20
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.3    0.05        R.FIQVWKT.P
 19.9    0.11        R.QFINASIQ.D
 14.9    0.19        K.GANSIDTNQ.F
 13.0    0.04        K.FDSIILIT.A
 12.5    0.02        A.FIKSTGIR.Y
 12.5    0.14        K.FIQTSDNP.L
 12.5    0.17        -.MIQSTNNP.L
 12.5    0.17        -.MIQSTNNP.L
 11.8    0.06        K.FIRTNGTL.T
 11.6    0.10        R.IMAGIKNGT.L
Top scoring peptide matches to query 21
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.0    0.04        K.IRTQIYTS.S
Top scoring peptide matches to query 22
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.0    0.03        A.TGLVGSQIVK.V
 12.4    0.06        K.GTLQNLDLK.S
 11.0    0.07        I.ASIHAFTQK.G
  8.6    0.10        F.TSNPDLVEK.L
  8.4    0.02        A.TGLLGITATR.D
  7.4    0.06        R.ASIENVIEK.G
  6.8    0.06        T.GLTQVENIK.F
  6.5    0.05        T.ASLQQQLSK.Q
  6.5    0.04        P.ASIKNSNIR.E
  6.5    0.08        K.GTIQLNSNR.Q
Top scoring peptide matches to query 23
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.1    0.04               A.EILLASILR.L
 21.1    0.08               A.EPLISSIIR.L
 21.1    0.04               S.QILLGTIIR.H
 21.1    0.06   18  16267.2 D.QINRILIR.L
 20.9    0.11               F.QTPELVALR.N
 20.9    0.04               S.VTVLVNILR.R
 20.6    0.08               M.IDVALDLLR.S
 20.5    0.18               K.EGEPTLQPR.E
 19.0    0.20               E.SSLYSDDIK.N
 16.4    0.08               G.VNGLLQILR.E
Top scoring peptide matches to query 24
Score greater than 34 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 50.0    0.07   10  19516.2 R.HQDFVPATK.I
 19.0    0.16               K.HAGLDDNATQ.L
 14.4    0.08               I.KTANVDHTR.H
 11.4    0.04               I.YNIVHPTAK.K
 10.7    0.14               I.ENFMAWTK.M
 10.5    0.05               R.VKSTEIHTQ.R
  9.3    0.08               E.LNSTQHNTK.Q
  9.2    0.08               K.HKDLSGETR.D
  9.1    0.11               L.HKASMMGHK.V
  9.1    0.11               L.HKASMMGHK.V
Top scoring peptide matches to query 25
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 33.5    0.07    2  mALS1.5eoc R.SQSKPFTLR.W
 18.1    0.10                  K.QSTITKIEGS.K
 17.0    0.09                  G.SKSQLTGTNK.H
 17.0    0.12                  S.SQSQKSSPSK.K
 16.6    0.15                  S.NTNASSGQKR.I
 16.2    0.12                  N.NTNTSSAIQK.Y
 15.1    0.13                  G.NTSKQVEQK.R
 14.4    0.16                  K.QSSGPSAKSSQ.I
 13.6    0.09                  I.QSQSSGKLTK.F
 13.3    0.15                  D.KSSSNAAEGGR.A
Top scoring peptide matches to query 26
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 19.6    0.08    1  mALS3.5eoc N.TVTFNDGGKK.I
 10.8    0.05                  R.KGVFTSINSI.E
 10.7    0.20                  R.LSTSNSNNNN.N
 10.7    0.20                  R.LSTSNSNNNN.N
 10.4    0.11                  V.ISFTNNQNK.V
  9.4    0.20                  R.LSTSNSNNNN.N
  9.1   -0.80                  K.KSSSNNNNNS.S
  8.7    0.21                  K.DWMNDEAGL.E
  8.7    0.16                  K.MIGFNDSWP.L
  7.7    0.13                  A.EATSQTQSSK.T
Top scoring peptide matches to query 27
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.3    0.11             K.CIATVVQEGL.T
 10.2    0.11             A.SNNIDSIGLR.Y
 10.2    0.08             TTDLDLSGIR
  9.1    0.06    3  mCHT2 T.GYPELATALR.G
  8.3    0.09             R.TKNGEIIISN.D
  7.8    0.18             -.DMAVINQPNS.Q
  7.8    0.20             R.AASDAELNNSP.I
  7.4    0.08             K.SRTISLNEVA.F
  6.6    0.07             K.MGNLKVLLDS.G
  6.2    0.11             K.FAVLNIDPDS.I
Top scoring peptide matches to query 28
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.1    0.07    4  mRBT5  Q.FAGAVGNCVAK.N
 20.6    0.02   13  9787.2 K.KMTVLTGAGIS.C
 15.2    0.13              K.KSMVDQQQQ.Q
 15.2    0.13              K.KSMVDQQQQ.Q
 15.1    0.05              K.KFVTNFHVT.W
 14.9    0.11              R.NSTIADGSAGVT.S
 13.5    0.10              K.MANIVNSIQS.E
 13.3    0.10              K.KMLNQDINT.I
 12.9    0.12              T.MAQGVQEWK.N
  9.7    0.10              K.KTSNQSGNGTV.T
Top scoring peptide matches to query 29
Score greater than 26 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.3    0.05        M.ETLNHVNKR.F
 12.3   -0.07        L.KLVLLSPDVK.R
 10.7   -0.80        K.ETNNGGLMNM.G
  8.6    0.05        S.KMLQSMITK.M
  8.1    0.10        A.QASHNNIPTK.Q
  8.0    0.07        S.QTNKNIYTK.K
  7.6    0.11        K.ASSSPSSFLTGA.L
  7.4    0.10        A.QASHNNIPTK.Q
  6.6    0.13        -.ETNQLTMQF.L
  6.4    0.05        K.QLKSHVNER.I
Top scoring peptide matches to query 30
Score greater than 20 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 17.3    0.07    1  mALS3.5eoc K.GPGTPTWNAVL.G
  6.8   -0.06                  K.LQVAKLTQVI.Q
  3.1    0.09                  R.QELSLMYVL.N
  3.0    0.17                  K.MADPQEKYM.R
  2.4    0.12                  -.MPELVPPTNN.R
  2.3    0.03                  K.LNNLLTNPVI.I
  1.7    0.09                  R.IQEASHSQVL.T
  0.9    0.18                  K.DDAWKYWE.T
  0.8    0.14                  R.NNGSITSTGFL.Q
  0.1    0.11                  K.QERHLISNN.Q
Top scoring peptide matches to query 31
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.9    0.08        P.DLNSMEQIR.R
  7.8    0.12        N.NNISNGSNGSR.F
  7.8    0.12        N.NNISNGSNGSR.F
  6.7    0.15        E.NNNSSSNNNR.G
  6.7    0.15        E.NNNSSSNNNR.G
  6.7    0.15        E.NNNSSSNNNR.G
  6.7    0.05        P.VSRSSLDSNR.F
  6.5    0.12        N.NNISNGSNGSR.F
  6.5    0.12        N.NNISNGSNGSR.F
  6.1    0.05        Y.TAAANFGDVVR.S
Top scoring peptide matches to query 32
Score greater than 31 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 46.7    0.08    1  mALS3.5eoc D.CSNIHVGITK.G
 15.7    0.11                  K.EQTNHQKLK.D
 15.3    0.03                  K.LMVDSPPLLK.V
 15.3   -0.01                  T.QNAIIIARTK.F
 15.0   -0.01                  T.QNAIIIARTK.F
  9.3   -0.75                  R.TMCSSADLNN.W
  9.2    0.06                  L.SQPNSPIRTK.T
  9.1    0.19                  S.EENTSTMSTK.Q
  8.9    0.01                  T.YLPTHTRIK.R
  8.8    0.06                  L.AGTSSHLGGTIK.T
Top scoring peptide matches to query 33
Score greater than 26 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.8    0.25        K.QDPQRESNSS.E
 13.1    0.02        E.KPNLIPQIPK.I
 12.5    0.09        S.ILNLTTAAMGK.T
 11.8    0.13        F.VGSPLMNSSIK.S
 10.8    0.11        R.RSPLLGGNPTH.R
 10.6    0.18        N.NEPSQKSETK.K
  9.2    0.13        K.KPDSQIKGFQ.P
  8.2    0.11        K.KIVSQQSLSGT.G
  8.1    0.12        F.ENPIYAKWK.L
  8.0    0.18        K.KIVTDNQQSD.E
Top scoring peptide matches to query 34
Score greater than 23 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.4    0.10        G.QNTLIVRGPR.N
  9.8    0.12        K.KLNEVPNNLI.K
  9.8    0.12        K.KLNEVPNNLI.K
  9.6    0.21        K.KELEAVSYSQ.-
  6.5    0.21        K.QGSHFINTHI.Y
  5.4    0.15        G.RGGNVWVNPR.G
  5.0   -0.77        K.NASLVEYVTC.Y
  4.9    0.12        K.SIGLGGNPNLIV.D
  4.8    0.10        G.QNTLIVRGPR.N
  4.4    0.21        K.KGDIVAHHYD.T
Top scoring peptide matches to query 35
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0    0.04        P.QSSSNAQQSTK.S
  5.7    0.07        V.DNDNAVMSGVK.M
  5.1   -0.08        K.QILSHREGIL.S
  4.7    0.00        T.SSKSSMNSPLK.K
  4.6    0.04        P.QSSSNAQQSTK.S
  3.8   -0.07        K.LTSVNTGTFVK.A
  3.5   -0.09        K.STLSTKTTSLK.S
  3.5   -0.07        K.RFSLETSITI.T
  3.5    0.01        T.DWVNFNSRK.S
  3.3    0.04        K.QESSAQTSTAR.R
Top scoring peptide matches to query 36
Score greater than 37 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 59.7    0.09    6  TRBOTR  TLNNDIMLIK
 21.4    0.18               E.VNDINDLDEK.C
 21.4    0.19   12  12218.2 H.VNNNNNNDKK.T
 21.4   -0.79   12  12218.2 H.VNNNNNNDKK.T
 20.9    0.10               I.TNIQTLLDTR.D
 19.6    0.12               T.TLDDIINELK.L
 18.8    0.13               I.SQLNNLNNKK.S
 18.8    0.13               I.SQLNNLNNKK.S
 18.1    0.07               E.TNKITNELLK.L
 17.8    0.19   12  12218.2 H.VNNNNNNDKK.T
Top scoring peptide matches to query 37
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.4    0.07        K.NGENLSVQLLD.S
  4.9    0.03        T.SAWNAAIQGRK.L
  3.2    0.03        I.DLEDLEAKAAK.H
  2.8    0.22        K.HQQTQEQQGN.I
  2.3    0.08        K.TNNDRIALNNG.N
  2.3    0.08        K.TNNDRIALNNG.N
  2.3    0.02        K.SQEILETLRN.I
  1.9   -0.01        G.IGSSLKEAQIR.A
  1.5    0.07        D.DNVNLEQVAAK.C
  1.1    0.08        K.LQQQQSEARN.G
Top scoring peptide matches to query 38
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.4    0.05        S.LHDAIMIVKR.S
 15.1    0.17        K.LHEWNDVLQG.C
 14.3    0.18        R.IHWDKCQQP.K
 14.3    0.11        A.LHNAGQLINTK.R
 10.0   -0.01        I.PLLLLGQSRSK.L
  9.5    0.17        K.LHEWNDVLQG.C
  9.3    0.22        R.LEHGENDGNKP.R
  8.9    0.04        K.LPLLLNVFGEP.D
  8.8    0.19        K.TNKSVNELMSS.Y
  8.7    0.17        K.IHEHQSPYLS.T
Top scoring peptide matches to query 39
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.2    0.13        K.VVDKPTTANIGP.H
 10.3    0.06        R.SILKNSQVPII.V
  9.5    0.30        R.LSICQADMEE.E
  8.8    0.09        T.VTLKQLHMSR.F
  8.8    0.06        P.EAIQDIILGLK.Q
  8.8    0.06        F.ISIKGPEILNK.Y
  8.8    0.06        F.ISIKGPELLNK.Y
  8.7    0.15        K.LSLKQCSYLT.D
  8.7    0.13        R.SIIKDLVNYF.K
  8.7    0.06        R.SILKNSQVPII.V
Top scoring peptide matches to query 40
Score greater than 19 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.9    0.19        R.SPLPNSTNQLR.Y
  6.5   -0.64        K.DSGYNSQNLDD.E
  2.5    0.38        N.NNNNNNNDYK.I
  2.4   -0.64        K.DSGYNSQNLDD.E
  2.4   -0.64        K.DSGYNSQNLDD.E
  2.3   -0.75        N.HTANNSEWLR.E
  1.9   -0.73        A.PSTNDTNHQSK.D
  1.7   -0.72        I.NSMMNLSMKR.I
  1.7   -0.72        I.NSMMNLSMKR.I
  1.7   -0.79        R.ALAFNSIVYET.L
Top scoring peptide matches to query 41
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 21.6    0.09    2  mALS1.5eoc QTSVDLTADGVK
 21.6    0.09                  T.QTSVDLTANGVK.Y
 12.6    0.19                  G.KGVMNMDFMK.K
  5.2    0.10                  -.TMSNVGLQVRQ.A
  5.0    0.08                  K.FVIRIVDNEQ.V
  5.0    0.12                  D.NASSIRVDQNK.G
  4.8    0.08                  T.SSVAASKNQNVK.V
  4.8    0.04                  S.DLIFVDNLRK.F
  4.5    0.15                  F.SGEAGSLDNLNR.R
  4.1    0.12                  K.ILNMVNNLGLN.L
Top scoring peptide matches to query 42
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 51.9    0.07    4+ mRBT5   IYDQLPECAK
 51.9    0.07               K.LYDQLPECAK.P
 28.8    0.07    7  12297.1 R.IYDQIPKCAQ.E
 19.7    0.04               S.LYENLINDSR.F
 18.2    0.01               I.YLNKLNDLDK.A
 17.9    0.06               K.LTQFLIQNEE.Q
 17.9    0.06               K.LTQFLIQNEE.Q
 17.1    0.05               R.YINKILNDDQ.S
 16.7    0.07    7  12297.1 R.IYDQIPKCAQ.E
 16.1    0.01               I.YLGGEIQELSK.K
Top scoring peptide matches to query 43
Score greater than 34 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 63.8    0.12    1  mALS3.5eoc S.QTSVDLTAHGVK.Y
 17.8    0.02                  S.TKPAITISSPLK.R
 11.2    0.19                  H.IDNPGNNNTAPK.I
 10.0    0.11                  K.QNRDLQQLIQ.F
  8.6    0.05                  N.EVNGIVLNIRK.Q
  7.5    0.02                  K.AVLSKILPISSQ.F
  7.0    0.19                  Q.RLQDNMYGIK.K
  6.6    0.29                  N.DNSNHSNSNHK.M
  6.6    0.29                  N.DNSNHSNSNHK.M
  6.5    0.06                  A.KADIIALSPEAK.L
Top scoring peptide matches to query 44
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.6    0.12        I.DKLVAQYPNGR.S
 13.1    0.23        K.VQEVDMDYYT.K
  6.6   -0.78        K.DAGNVEDDLTNT.K
  6.1    0.06        F.VDKLANFVIDK.S
  4.9    0.11        K.TQVNIHLVSHN.K
  4.6    0.06        R.QLNLSGKLELF.N
  4.5    0.08        R.EINVYQGNVKV.L
  3.5    0.13        K.LTAAQKEQQIM.Q
  3.5    0.13        K.LTAAQKEQQIM.Q
  3.5    0.20        F.QVQEQSNTDGR.I
Top scoring peptide matches to query 45
Score greater than 23 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.4    0.10        R.QQRKPVLLQHG.L
  9.6    0.13        R.RSPLLGGNPTHR.K
  8.1    0.11        S.SYFRPSLLPPK.S
  8.0    0.09        S.IINLFLSTQQK.L
  7.9    0.15        K.KVILQMAWSQV.K
  7.6    0.32        D.PDKDHEECMK.I
  7.4    0.16        K.VLQNFSQLINQ.T
  7.4    0.16        K.VLQNFSQLINQ.T
  7.3    0.13        R.KDQVLQHLPPK.I
  7.2    0.13        K.KVILQPGHSPLD.W
Top scoring peptide matches to query 46
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 47.5    0.11    1  mALS3.5eoc L.TWSNAATYNYK.G
 15.2    0.03                  W.KMLGGGGGATSNIR.K
 13.6   -0.01                  N.VMGFINPGKSLR.K
 13.6    0.03                  S.VTSNNSRNASIR.K
 12.8    0.10                  N.NGNSNPTIQNKK.K
 12.5   -0.03                  L.IFGGNAANVSKLK.N
 12.3    0.10                  N.NGNSNPTIQNKK.K
 11.7   -0.01                  R.KPFQQRLMIR.I
 11.3    0.03                  S.SSLLNSNINNIK.V
 10.9    0.03                  R.SEASIAEAKVNSL.S
Top scoring peptide matches to query 47
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.5    0.07        Q.LQQNFGVNSNAK.S
 22.5    0.07        Q.LQQNFGVNSNAK.S
 22.5    0.07        Q.LQQNFGVNSNAK.S
  9.3    0.02        K.VQFPTTITTALQ.A
  8.4    0.06        R.VYHFAANGSNIK.K
  7.6    0.03        Q.GFGHVLSQFSIK.S
  7.2   -0.04        I.KGVSFLGQLMLK.R
  6.8   -0.02        N.VVGNYLKETGIK.K
  6.4    0.06        R.LQSAGSSGGITTLQ.M
  6.3    0.08        K.KANSNASTTANNK.T
Top scoring peptide matches to query 48
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 70.0    0.11    2  mALS1.5eoc F.STLTCTVNDALK.S
 17.3    0.05                  K.YGTKLINETIVA.S
 13.3    0.05                  R.TSLTTTNSKTIR.F
 12.8    0.20                  K.SIDSAANTNVDES.K
 12.2    0.11                  I.TSNQLIFNINR.L
 10.2    0.17                  I.STINENCESLR.Y
  9.8    0.18                  N.STIQQSVENADK.I
  9.6    0.16                  K.TSIIPIMSDNGSS.D
  9.4    0.19                  K.VNSNKNTNTNTN.T
  9.4    0.06                  K.KMIQQFQTIVA.F
Top scoring peptide matches to query 49
Score greater than 40 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 58.5    0.09    5  8527.1 K.KTDDSAPITIVAK.F
 24.8    0.01              H.KALLEVSTSIGLK.T
 13.9    0.20              N.ENTDAPPKQQTK.K
 11.4    0.10              T.KQSINQSINQAK.L
 11.2    0.14              K.KPVDAAMIAEDAK.Q
 11.0    0.11              F.DNSLLTFPPNLK.K
 10.7    0.12              A.LSDNAIIEANLGK.F
 10.6    0.21              N.NKSTSTSTSTDTK.K
 10.6    0.12              L.QNSVTPINNKIK.N
 10.5    0.16              K.KEATPVAQITDGQ.V
Top scoring peptide matches to query 50
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
104.2    0.11    5  8527.1  K.KTDDSAPITIVAK.F
 25.9    0.04               H.KALLEVSTSIGLK.T
 21.2    0.15               L.QNSVTPINNKIK.N
 18.9    0.23               T.KTSDDHYGPNPK.V
 15.4    0.18               V.QTNDPAEIQTIK.L
 15.3    0.09               V.QMSIEKVPILGK.E
 15.0   -0.74               L.DNNNASAALDQPK.R
 14.7    0.22               K.QTSTDLLSYFPS.G
 14.3    0.15   18  16267.2 E.GKDIDTDSPIVAK.K
 14.3   -0.74               L.DNNNASAALDQPK.R
Top scoring peptide matches to query 51
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.9    0.09        R.YGTELAQMQSLI.S
 12.5    0.12        K.VYQTQFDSREP.T
 11.4    0.04        K.SITFQNRNYLI.T
  9.9    0.24        K.QNSHHEQNKNQ.Q
  7.2    0.12        K.LYNNQNKQTIM.I
  7.2    0.12        K.LYNNQNKQTIM.I
  7.0    0.15        K.MNISMSEWQLI.V
  6.9   -0.76        R.NCDDDNLYDIN.V
  6.1   -0.01        K.FDISTILFTILS.K
  5.9    0.19        R.QNKQNQTQLNF.W
Top scoring peptide matches to query 52
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 60.3    0.13    1  mALS3.5eoc K.TCSSNGIFITYK.N
 12.3    0.15                  C.SSSSSFFPKDSSK.T
 11.1    0.15                  R.TTLHTSQNASSKN.G
 11.1    0.15                  R.TTLHTSQNASSKN.G
  8.6    0.24                  K.FNDFNNNLNYD.L
  8.6    0.24                  K.FNDFNNNLNYD.L
  8.6    0.24                  K.FNDFNNNLNYD.L
  6.5    0.26                  S.NDESTHNNQSDK.Q
  5.9    0.15                  K.TPSSQSLPRSDSQ.S
  5.8    0.19                  K.NVLVNQWNAQSN.I
Top scoring peptide matches to query 53
Score greater than 32 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.9    0.21        D.INEVENISESLR.N
 18.6    0.10        S.SSLVLSLMSKPIK.S
 18.4    0.16        R.PYNVNLVEKGIR.E
 17.1    0.30        S.SSANNNNKNNPAR.T
 15.3    0.11        C.QVQFIAIKWLR.D
 15.3    0.11        C.QVQFIAIKWLR.D
 15.3    0.20        F.RLNAQSEINSLR.E
 14.9    0.20        S.PSNSSKLSQANLR.K
 14.4    0.21        K.KLNDELQSANIR.R
 13.9    0.27        I.SSSIVEFLMMNK.N
Top scoring peptide matches to query 54
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 83.6    0.12    1  mALS3.5eoc L.TCTVSNTLTPSIK.A
 28.6    0.20                  I.NKEGNDNTSVTDK.L
 16.1    0.19                  G.NNGRHHNQVTNK.N
 14.8    0.18                  Q.TNFHPSTNIFNK.S
 14.4   -0.79                  I.NKEGNDNTSVTDK.L
 13.3    0.17                  K.DNVSKVDSNVDTK.V
 13.3    0.07                  K.VIHPKTINGVQQS.T
 13.2    0.15                  S.MILGNLWDVTDK.D
 13.2    0.04                  R.NHEKPLKILSNK.Y
 13.1    0.19                  G.NNGRHHNQVTNK.N
Top scoring peptide matches to query 55
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 69.9    0.10    2  mALS1.5eoc -.KTITGVFDSFNSL.T
 69.9    0.10    1  mALS3.5eoc -.KTITGVFNSFNSL.T
 32.3    0.10    1  mALS3.5eoc -.KTITGVFNSFNSL.T
 14.8    0.16                  R.MPNLYETFVNSI.A
 12.6    0.04                  K.VTGNVKLNTLAPSI.I
 10.6    0.30                  -.MSNNPHPQDDGSQ.L
  9.4   -0.05                  -.MSNKIAILLTVLI.A
  8.7    0.15                  R.DTRYYHIFNSI.P
  8.3    0.17                  K.LNQQPANASNGNVT.V
  8.2    0.08                  K.EVPQKILTANNSI.N
Top scoring peptide matches to query 56
Score greater than 21 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.0    0.12        K.DIPNRHLALEYL.V
  7.8    0.23        K.NFNLPYPMNLET.N
  5.2    0.14        E.NAHPEINANSFLK.L
  5.1    0.15        K.NFSKMYPIQVDI.T
  2.9    0.20        R.DPIKIMNFNASST.H
  2.9    0.20        R.DPIKIMNFNASST.H
  2.5   -0.78        R.SQSFFHINFSNQ.L
  1.7    0.29        R.MKGLDNDWVSEC.V
  1.4    0.28        G.NDLMMVDNMENK.N
  1.4    0.10        L.NPNGQTLIVQIEK.Q
Top scoring peptide matches to query 57
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 12.8   -0.79                  K.ANSNNSKNDESTSP.K
  9.1   -0.73                  K.LEEENTDPDSNNS.E
  4.8   -0.79                  K.SNGNINMNSNWVN.N
  3.3    0.13    1  mALS3.5eoc F.NVGGTGSSVDLEDSK.C
  3.3    0.13                  F.NVGGTGSSVNIQDSK.C
  2.9    0.20                  R.TNENNAANVVSTNGG.L
  2.9    0.20                  R.TNENNAANVVSTNGG.L
  2.6   -0.01                  E.QGIQTLESPHVKK.F
  2.5    0.00                  L.NALKNTLSLFNTK.F
  2.3    0.19                  K.ANSNNSKNDESTSP.K
Top scoring peptide matches to query 58
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 35.0    0.11    1  mALS3.5eoc K.NVPAGYRPFVDAY.I
  4.5    0.14                  Y.YNSTDQLTEIQR.I
  4.5    0.02                  R.GRGYIVTIASVLGY.M
  2.4   -0.72                  K.KGLDEQTNDDMSD.I
  0.7    0.15                  K.NVQKTMNWSVGGF.F
  0.7    0.29                  K.NVDDPHNYSNEY.Y
  0.5   -0.69                  K.TIDMSYSNNNEY.L
  0.4    0.10                  D.NAVATFGGAVMFQR.T
  0.4   -0.80                  I.ITNHTSGSMDSYR.Y
  0.2    0.10                  K.NVYDALEKFLQQ.-
Top scoring peptide matches to query 59
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.9    0.16        R.IPQKPGGNNNNEW.V
  1.9    0.16        R.IPQKPGGNNNNEW.V
  1.6    0.09        K.LMALLNHNLQTAE.P
  1.5    0.13        K.QQFRESPEFTLS.N
  0.4    0.23        N.CLIYQMMFSMD.-
  0.3    0.21        K.DSSIFKDYEDHN.S
Top scoring peptide matches to query 60
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.2    0.00        C.KAVYKPEISAEDK.L
  6.9   -0.07        K.KFTVNSIGGIVLTK.D
  6.2    0.00        V.GNELFVLDDSKIK.S
  4.2    0.04        G.QDGINYINIAINK.L
  3.8    0.03        K.FISNKPISTNNDK.D
  3.3   -0.01        A.TAGAISAENAVAFKK.I
  2.5    0.03        V.DFIVRQEQNSIK.T
  2.5    0.05        I.MNGLGEEIGLGMIK.S
  1.8    0.06        V.LIYLSYYWDNK.S
  1.8    0.15        S.GTSNNNPNTISNNK.F
Top scoring peptide matches to query 61
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.7    0.19        R.MSNFSNLSLNNLM.F
  4.6    0.17        R.NSMFISPTMDLKT.F
  3.6    0.18        E.TMRQQLGGYVANK.K
  3.1   -0.79        R.MSNFSNLSLNNLM.F
  2.7    0.17        K.IPSFALCQSFAKN.M
  2.7    0.19        K.NKSGNLEPYFNVT.K
  2.5    0.19        R.TELSPQQHETNVT.T
  2.5   -0.79        R.TELSPQQHETNVT.T
  2.3    0.16        Q.MEFQELINFWK.Q
  2.1    0.18        P.SIDPFYNAPEGFK.N
Top scoring peptide matches to query 62
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.2    0.12    6  TRBOTR K.LQGIVSWGSGCAQK.N
  3.2    0.05              K.IVAKVSNYPGQVTI.K
Top scoring peptide matches to query 63
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.1    0.04        T.QAPASASPGGSGAAASSK.K
  1.3   -0.05        P.NSGALAAALTIGNAMK.Q
Top scoring peptide matches to query 64
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.4    0.00   15  23914.1 N.PNSIDAWQLKLPK.Y
 12.3   -0.03               Q.LKGGQNVPLQQSLK.K
 10.7    0.05               E.QIGILQSEINQHK.Q
 10.7    0.05               E.QIGILQSEINQHK.Q
 10.7    0.05               E.QIGILQSEINQHK.Q
 10.7    0.01               L.VAAGLNDIQRPVEK.L
  9.5   -0.79               S.NGNSLQQEGSTMDK.D
  6.1   -0.02               L.LKQINELKPDPSK.G
  6.0   -0.79               S.NGNSLQQEGSTMDK.D
  5.0    0.01               L.LNALDTPKRPAADK.E
Top scoring peptide matches to query 65
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 65.4    0.13    4  mRBT5  C.VMPQFAGAVGNCVAK.N
 44.0    0.13    4  mRBT5  C.VMPQFAGAVGNCVAK.N
 33.0    0.13    9  mPga10 C.VMPQFGGAIGDCVAK.N
 12.9    0.06              T.NDVRYVINEIVSK.R
  8.4    0.28              E.NNNNNNNNNNKEK.N
  6.8    0.13              K.QLYQGGGAVATLNQQ.M
  6.6    0.11              N.NNNESQLLDFLIK.K
  5.8    0.16              K.NNPPSHPDTSPTRK.R
  5.8    0.18              N.NNNNNSNINSSIIK.Q
  5.8    0.16              Y.DNIIDSARNPMTGK.K
Top scoring peptide matches to query 66
Score greater than 23 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.3    0.16        K.KLGANYAPCVKPQL.E
  9.6    0.21        K.KLSGNIVSCDNAIAP.L
  7.3    0.14        R.KVIIGNSLNEMTKP.R
  6.6    0.17        I.QISRLTMNFFFR.R
  6.3    0.14        I.INKEQIIVQYGPR.R
  4.5    0.19        K.KNIQLSENGLESVQ.T
  4.1   -0.71        K.KNQNQNQNQTLNN.M
  4.0    0.21        D.QLPQFDQNNDVIK.E
  3.6   -0.78        K.QLQPVSSIDEITET.G
  3.1    0.22        K.QIKSLNQTENQQQ.Q
Top scoring peptide matches to query 67
Score greater than 30 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 57.1    0.13   11  15898.1 R.LYGVDCSQVEAVLK.A
 14.1   -0.77               K.QFGANSNNGCLSAIQ.L
 13.4    0.11               V.LYGTHQVPHVTNSK.D
 11.3    0.18               K.LYQNEIDNLTNKN.K
 11.2    0.13               R.YIGVSNFDIPQLNT.L
 10.8    0.13               K.YIGSKINEILMGQN.V
  8.5    0.18               K.LYQNEIDNLTNKN.K
  7.6    0.29               A.LSNNNNNNTNNSQK.K
  7.5    0.25               I.QFGAHCQFQDVDK.V
  7.5    0.07               S.WMAYIQLLQLRK.L
Top scoring peptide matches to query 68
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.0    0.07        K.LTQSIATAAFLFYF.K
Top scoring peptide matches to query 69
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.0   -0.07        R.KFFNISVVIVTLSK.M
  1.3   -0.01        E.FNNLQKLSIINYK.S
  0.8    0.28        R.IVGTDNNNNNNNNSS.N
  0.8   -0.71        R.IVGTDNNNNNNNNSS.N
  0.8   -0.71        R.IVGTDNNNNNNNNSS.N
  0.8    0.28        R.IVGTDNNNNNNNNSS.N
  0.8   -0.71        R.IVGTDNNNNNNNNSS.N
  0.5    0.13        G.NPLDPNMQYDIFK.W
  0.5   -0.68        K.QGNFQHENVPDCM.E
  0.1    0.02        R.NLPATILIFWLMY.V
Top scoring peptide matches to query 70
Score greater than 22 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.9    0.25               K.SVSPNASTPNMEKNI.A
  8.6    0.23   12  12218.2 K.NDPIIVNGSTTTTNGT.N
  8.6    0.27               Q.NQNQNQNQLLMNK.L
  8.2    0.25               K.NAYSLYLNSASASSGT.I
  7.8    0.31               K.QQQHEQLGNGNSYT.R
  7.8    0.31               K.QQQHEQLGNGNSYT.R
  7.8   -0.67               K.QQQHEQLGNGNSYT.R
  7.8    0.31               K.QQQHEQLGNGNSYT.R
  7.2    0.21               N.DDIPPPQPQNQNIK.F
  7.0   -0.75   12  12218.2 K.NDPIIVNGSTTTTNGT.N
Top scoring peptide matches to query 71
Score greater than 15 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.0    0.22        K.QISVAFVCLGNMYV.-
  2.3    0.11        K.QISTHKIIAMSFQI.Q
  2.1    0.15        T.ISIRGGNTNLLNNVK.Y
  1.5    0.25        K.SINEDKIQTYYNQ.S
  1.3    0.17        A.IIVVAATDGQMPQTR.E
  1.0    0.15        V.VIITHNYSSRNGVR.V
  1.0    0.39        R.VVLDMNMNMNDANT.A
  0.8    0.19        P.IQNNNDNKDLGMLK.V
  0.7    0.11        D.AIAVLVLENQVGNFK.Q
  0.6   -0.73        K.LEKLTNQNEPDWE.M
Top scoring peptide matches to query 72
Score greater than 41 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 84.9    0.13    1  mALS3.5eoc F.NSLTWSNAATYNYK.G
 22.9    0.15                  V.DQANRTATQDNTAPK.L
 22.7    0.15                  V.DQANRTATQDNTAPK.L
 19.6    0.15                  V.DQANRTATQDNTAPK.L
 19.6    0.15                  V.DQANRTATQDNTAPK.L
 14.4    0.08                  K.SNINQFKLIGHSMGA.Y
 13.9    0.01                  M.SNIPQPISDHQRIK.S
 13.9   -0.00                  A.SNITPVSAQVKFVDK.L
 13.9    0.10                  R.SNLTIMSSDNFFIK.N
 13.9    0.05                  A.SNLTPDSIPGYILNK.K
Top scoring peptide matches to query 73
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.0    0.11        I.MITGDNPLTACHVAK.E
 13.2    0.08        D.LSSDMNHDASIRVAK.E
 11.3    0.14        P.KTSEFMNDPQFVAK.L
  8.7    0.12        S.NDSVNNDVEPLQVAK.L
  8.7    0.12        S.NDSVNNDVEPLQVAK.L
  8.7    0.12        S.NDSVNNDVEPLQVAK.L
  8.6    0.07        G.YQFTIQNSVPFVAK.S
  7.9    0.05        H.GEPPEAVVHQPWVAK.V
  7.9    0.11        L.SMLTKAVQFNNTSGK.S
  7.2    0.07        G.YQFTIQNSVPFVAK.S
Top scoring peptide matches to query 74
Score greater than 40 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
119.4    0.13    8  mALS4.5f K.FITDQTSIDLVADGR.T
 20.8    0.27                K.QLNDENSDEKNTLQ.G
 20.8    0.27                K.QLNDENSDEKNTLQ.G
 16.2    0.19                -.MEVTQRTQSQTQPT.Q
 14.0    0.24                K.SVGNSMQIFAHDELT.K
 13.3    0.18                R.MLIGSSTQFFQQFT.G
 13.3    0.27                K.QLNDENSDEKNTLQ.G
 13.2    0.17                T.PVPKLEEHENDTNK.V
 13.0    0.13                -.FLNRNNNLTSIEIT.R
 13.0    0.13                -.FLNRNNNLTSIEIT.R
Top scoring peptide matches to query 75
Score greater than 22 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.7    0.17        K.REMDNQIVLFFLH.Y
  9.3    0.23        K.KNTIGEGEEDHEALH.Q
  9.3   -0.75        K.QEPQPISNQKQQDH.L
  9.1    0.15        K.QKPQQLTSQQRPTH.G
  8.7    0.15        K.QKPQQLTSQQRPTH.G
  8.6   -0.69        G.QQGNNNSSAWDNTDK.L
  8.6   -0.69        G.QQGNNNSSAWDNTDK.L
  8.4    0.15        K.QKPQQLTSQQRPTH.G
  7.9    0.18        R.NNYTLINKFWNLH.P
  7.9    0.18        R.NNYTLINKFWNLH.P
Top scoring peptide matches to query 76
Score greater than 33 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 78.4    0.14    2  mALS1.5eoc K.YTTSQTSVDLTADGVK.Y
 15.8    0.13                  D.HDKTVTSVDISPDGSK.I
  9.1    0.17                  R.VNVLSPMCKTSSTMV.S
  7.8    0.19                  N.HQADQELQSQQSRK.Y
  7.8    0.19                  N.HQADQELQSQQSRK.Y
  7.8    0.17                  P.QPQPQPQQMSQSRK.S
  6.4    0.31                  K.DEVEEESEDEEVFT.D
  6.4    0.19                  N.HQADQELQSQQSRK.Y
  5.8    0.17                  E.TYTYSSYNSKLETK.S
  5.7    0.21                  R.YTIDEFLQDPWMQ.K
Top scoring peptide matches to query 77
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.8    0.15        R.KSFLDQEAPEGYVAGS.A
  9.8    0.21        G.QCTLSISPDSMQDSK.Y
  9.6    0.11        D.SMQVYQKLDQITNK.H
  9.0    0.07        K.FSINFETGVLDDLKT.R
  7.3    0.08        K.AGNKSFNNFCLLIIS.S
  6.1    0.13        -.FLKIMDPNIQYGGNS.L
  6.1    0.13        -.FLKIMDPNIQYGGNS.L
  4.2    0.09        K.AQMEQLNGVLLHLES.E
  3.8    0.09        K.AQMEQLNGVLLHLES.E
  3.4    0.17        K.AGNDFVDENIGNFAKS.L
Top scoring peptide matches to query 78
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 69.6    0.16    3  mCHT2 Y.CSINGQFNYDTWSK.F
 56.7    0.16    3  mCHT2 Y.CSINGQFNYDTWSK.F
 35.4    0.16    3  mCHT2 Y.CSINGQFNYDTWSK.F
 16.3   -0.01             S.IDNISSNISNTSILTK.D
 13.9   -0.01             S.IDNISSNISNTSILTK.D
 11.0    0.01             N.QVLSTNNKNQMVLTK.D
 11.0    0.01             N.QVLSTNNKNQMVLTK.D
 11.0    0.01             N.QVLSTNNKNQMVLTK.D
 11.0    0.01             N.QVLSTNNKNQMVLTK.D
 10.6    0.21             N.NNNNNNNNNNNNTTK.S
Top scoring peptide matches to query 79
Score greater than 32 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
100.5    0.14    1  mALS3.5eoc Y.GDVQIDCSNIHVGITK.G
 13.2    0.10                  A.NKMNNTPVLVNLQPR.D
 13.2    0.10                  A.NKMNNTPVLVNLQPR.D
 13.2    0.10                  A.NKMNNTPVLVNLQPR.D
 13.0    0.16                  N.TTSKLNDPSFAMTPTK.Y
 12.2    0.18                  L.PSARTLSIYQSDMNR.R
 11.6    0.23                  D.AVNDTTRNNNHNNNR.N
 11.6    0.23                  D.AVNDTTRNNNHNNNR.N
 11.5    0.12                  -.MSNYHLIILVHGVWG.N
  9.4    0.07                  Y.GDNLLDLNLAYRIHK.L
Top scoring peptide matches to query 80
Score greater than 14 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8    0.32        S.GITSLGSGNNTSFLNQR.I
  1.7   -0.66        S.GITSLGSGNNTSFLNQR.I
  1.6    0.16        T.ALSVIIMALYFGSVRK.T
Top scoring peptide matches to query 81
Score greater than 18 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4    0.38        R.EQLDQNDPDQFQGSM.S
  4.7   -0.73        R.DLEDNLQPPSILQGND.I
  2.5   -0.76        R.QGFTYDKVNEVLNDE.I
  1.1   -0.61        R.EQLDQNDPDQFQGSM.S
  0.9   -0.61        R.EQLDQNDPDQFQGSM.S
  0.1    0.21        K.KGELLQESGHKPDGGMA.W
Top scoring peptide matches to query 82
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 55.7    0.14    2  mALS1.5eoc K.YQNVPAGYRPFIDAY.I
  8.0    0.06                  S.QGGYVFLYELVKQTK.N
  3.4    0.22                  R.YKVNFEQLADESSED.E
  3.4    0.26                  R.YKSSDIMNQSPNELE.S
  3.3    0.17                  MSGSSSELFNLVKNSR
  3.0    0.25                  -.FPPYSMSNQSPNLHH.R
  3.0    0.25                  -.FPPYSMSNQSPNLHH.R
  2.9    0.13                  K.INYLMNDLIYIESR.L
  2.8    0.26                  R.QSMMGNNLHQQHQYG.S
  2.6    0.20                  K.KYFNAVNGMLDEQID.F
Top scoring peptide matches to query 83
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.6    0.19               C.NLQFPAAEDQRSHMK.S
 13.3    0.06               E.LIEVFLNNARTLNNR.L
 12.7    0.31               Y.NNDNDNDNNANANANGK.L
 12.7    0.07               D.QLMNLVLENVTETLR.G
 12.7   -0.05               K.GFIAGVGIVMIITSSIIV.L
 12.6    0.06               E.LIEVFLNNARTLNNR.L
 12.1    0.12               K.WSQISLPQAVMTVTNN.A
 11.7    0.20   15  23914.1 E.DCEVNPNSIDAWQLK.L
 11.6    0.09               R.KSSFPMPSKPTQLNLN.V
 11.4    0.14               I.ENDGVSISDNKIQSQR.-
Top scoring peptide matches to query 84
Score greater than 16 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.2    0.28        K.QSKSQVQPSQESMTSF.Q
  3.0   -0.75        D.NSIDEDGWFHSGDIAR.I
  2.9   -0.71        K.QSKSQVQPSQESMTSF.Q
  1.7    0.18        I.SNINQDLTNHFKDAAK.S
  1.7    0.07        K.FVKPNAVKFINPTVQN.A
  1.4    0.24        R.NSLNNFNNLNSLSNHN.L
  1.3   -0.74        Q.VQQPQQTQQQQQQSK.F
  0.8    0.04        M.TPVLEFTLLSRLTGDR.Q
Top scoring peptide matches to query 85
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 85.9    0.15    1  mALS3.5eoc L.SYANEYTCAGGYWQR.A
 11.2    0.06                  H.SLFHRSHHNGSNFQR.D
  9.9    0.11                  K.FSNSFQSNLFSNRFE.E
  7.9    0.04                  R.IQPPQYEMEEYILR.V
  7.9    0.04                  R.IQPPQYEMEEYLLR.I
  7.0    0.08                  S.QNPNQSYLSLLQNMR.E
  7.0    0.08                  S.QNPNQSYLSLLQNMR.E
  6.8    0.06                  H.SLFHRSHHNGSNFQR.D
  6.5   -0.01                  S.SSESSSPLIKSSISSSSR.S
  6.5    0.03                  K.QHQQQLQLQQESSRS.S
Top scoring peptide matches to query 86
Score greater than 14 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 13.2    0.12    1  mALS3.5eoc K.NVPAGYRPFVDAYISAT.D
  1.0    0.28                  K.NVNMQQMIDEKTENE.A
  0.0   -0.80                  -.MFGSPFTNNPTQKSSTP.T
Top scoring peptide matches to query 87
Score greater than 23 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.2    0.17        A.DPTITALIKEGDDNLAR.I
 12.1    0.34        R.EHGMGAIMNGIAAFGANY.K
 10.3    0.17        K.LNLVSPSLNLFLFSFQ.H
 10.0   -0.79        N.DYSYQNIAVLRGNAMK.F
  9.4    0.29        R.NPQELQLMKDDLMQH.T
  9.3    0.18        V.AVLEGENKLVGAYMYGK.D
  9.2    0.21        N.DLLQQIELWENFHR.G
  7.6    0.20        K.NKDPGSLINIQHDYIL.N
  7.3    0.34        R.HMQNAIQPVENLNEDA.A
  7.3    0.34        R.HMQNAIQPVENLNEDA.A
Top scoring peptide matches to query 88
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 63.0    0.13    4+ mRBT5 K.QSTSSTPCPYWDTGCL.C
 11.0    0.17             M.SSSSTNNTNNNNTSALNL.Q
 10.7    0.19             K.NSTTSTSTSNANGNGNGNGT.E
  9.5    0.19             K.NSTTSTSTSNANGNGNGNGT.E
  9.5    0.19             K.NSTTSTSTSNANGNGNGNGT.E
  8.0    0.19             K.NSTTSTSTSNANGNGNGNGT.E
  5.7   -0.06             R.VLDYTPPEELQIQLSL.I
  4.0   -0.01             E.SSQSTFDIKEYEAVGAK.I
  2.8    0.07             K.FNLDYNGDKIINSQES.Q
  1.4    0.03             R.EQEERPLEESSEREL.T
Top scoring peptide matches to query 89
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.1   -0.01        L.TNENDAPFLMAISPTLK.L
  9.1   -0.01        L.TNENDAPFLMAISPTLK.L
  8.1   -0.04        R.ERQIVLVSMNMLAQQS.T
  8.0   -0.00        R.TDIAFMGTLVRDGHGSGI.V
  8.0   -0.02        N.TLESTQWFKITGHDAK.K
  8.0    0.10        R.TLQIDEESYQQQHNQ.Q
  8.0    0.10        R.TLQIDEESYQQQHNQ.Q
  8.0    0.10        R.TLQIDEESYQQQHNQ.Q
  8.0    0.10        R.TLQIDEESYQQQHNQ.Q
  8.0    0.10        R.TLQIDEESYQQQHNQ.Q
Top scoring peptide matches to query 90
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.05        R.YFHKITSPSQLTGLXI.X
  2.6   -0.76        -.MQGQNRTTSMNNHTNR.R
  0.9   -0.71        R.RAPYPNNSDNESDDDSP.P
  0.1    0.12        S.GSTNSEIVLQQQQQTTK.R
  0.1    0.23        -.MQGQNRTTSMNNHTNR.R
Top scoring peptide matches to query 91
Score greater than 41 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
105.3    0.14    3  mCHT2 S.AAPQCPYPDASLGDLLSK.V
 21.6    0.16             S.AAGQVTVEMDAAPGVDLNK.I
 13.4    0.14             I.QPTTFNPTINQNGSINR.Q
  7.8    0.19             A.AANQSDRLNDGLNDGALR.S
  7.8    0.19             A.AANQSDRLNDGLNDGALR.S
  5.7    0.19             Q.QQQRQQLSNLQQNQR.G
  5.5    0.05             R.AANVATELTAAAPYELGKL.Y
  5.2    0.03             V.AAAGKEISTRPFQLVTGR.V
  3.8    0.21             P.DELELNGTNYIEYNSK.A
  3.6    0.19             K.AAFQLDQELMSTGEFSI.D
Top scoring peptide matches to query 92
Score greater than 17 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3   -0.77        R.SIVKPIYQRSFQSEQP.L
  4.5   -0.61        Q.AQIEDTQMPQNNRESK.M
  4.5   -0.61        Q.AQIEDTQMPQNNRESK.M
  4.5   -0.61        Q.AQIEDTQMPQNNRESK.M
  4.5   -0.61        Q.AQIEDTQMPQNNRESK.M
  4.0    0.34        K.SISSSSSEAISNFRSNSF.S
  4.0    0.28        D.SLPPLNRGPSYNGNYTR.S
  4.0   -0.73        L.VTIFIQSRPNNSNSNSK.Q
  3.7    0.21        R.SLMYPPFRINELSLLN.T
  3.2    0.24        K.SLQLGENTVESFIAAASLG.A
Top scoring peptide matches to query 93
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.1    0.15   10  19516.2 K.NAVTYDGPVPNNEIPAVC.L
  8.4    0.09               T.TNNNNNNKQGVIVQTIR.N
  6.2    0.04               R.NQMGLNNKLQTELNLSL.D
  3.1    0.06               N.TQDIETLDIIIDLPSNK.V
  3.0    0.16               K.KAMNSNFNFLSDIQNLA.N
  3.0    0.16               K.KAMNSNFNFLSDIQNLA.N
  2.9    0.16               K.NHELYPEMDIILNDTP.N
  2.8    0.16               K.KAMNSNFNFLSDIQNLA.N
  2.8    0.16               K.KAMNSNFNFLSDIQNLA.N
  2.1    0.27               R.GMGSIDAMQQTNTNANAST.S
Top scoring peptide matches to query 94
Score greater than 16 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.4    0.11        E.QALRSVVNEHYDLFNK.S
  3.2   -0.74        R.AELQVFVNNYESSNFGN.Q
  3.2   -0.74        R.AELQVFVNNYESSNFGN.Q
  3.2   -0.74        R.AELQVFVNNYESSNFGN.Q
  3.0    0.20        K.TLQENDTNNAATLEDLAV.R
  2.8    0.19        P.QAITTVQQQQGQQQSQK.V
  2.8    0.06        D.EQHQQPVQLLKDDILK.K
  2.8    0.17        F.QAIEGETPEQTMERVSK.D
  2.5   -0.80        P.QAITTVQQQQGQQQSQK.V
  1.9    0.13        L.PNIFIGCNVKEGNLLDK.S
Top scoring peptide matches to query 95
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 78.8    0.15    3  mCHT2  SNQVALYWGQNGAGGQER
 65.5    0.15    3  mCHT2  SNQVALYWGQNGAGGQER
 45.0    0.15    3  mCHT2  SNQVALYWGQNGAGGQER
  9.6    0.15    3  mCHT2  SNQVALYWGQNGAGGQER
  7.7   -0.03              L.AIIFAIMSSFIINNPIR.N
  6.3    0.03   16  2998.1 Q.QRKPQQHQQYIIDPR.K
  6.3    0.03   16  2998.1 Q.QRKPQQHQQYIIDPR.K
  6.3    0.03   16  2998.1 Q.QRKPQQHQQYIIDPR.K
  6.3    0.03   16  2998.1 Q.QRKPQQHQQYIIDPR.K
  6.0    0.07              L.VDSVVIGNFEFFSSIFK.D
Top scoring peptide matches to query 96
Score greater than 25 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.4    0.13    3  mCHT2 K.LFVGVPATSNIAGYVDTSK.L
 11.2    0.19             G.EYNIAVSEGGEQFINAAK.I
 10.7    0.12             D.TTGAGDTFFGAIVSNLALGK.S
  9.3    0.11             K.NISISYLQMGLFIPTNK.L
  7.6   -0.74             G.SRANSDSSADQSLSLDTGK.R
  6.2   -0.70             V.SNNSNLLHNNNSNNQPR.H
  6.2    0.16             P.TTLTTNTTTIINDNTKGK.D
  5.7    0.20             M.GAYICGEETALIESIEGK.A
  5.6   -0.71             F.SNFGGNDKQTMQNLNDR.L
  5.6   -0.71             F.SNFGGNDKQTMQNLNDR.L
Top scoring peptide matches to query 97
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.7    0.23        E.HAIIDYQYAQNGFENR.K
 13.7    0.23        E.HAIIDYQYAQNGFENR.K
 11.0    0.11        S.SSNLPPVKLTSPGSNQANK.I
 11.0    0.11        S.SSNLPPVKLTSPGSNQANK.I
 11.0    0.11        S.SSNLPPVKLTSPGSNQANK.I
  6.9    0.27        A.KSHNGNMSTSSFLSNGNR.H
  6.8    0.18        K.NPSNESLFVSICRFDR.V
  6.0    0.05        F.LIIQIFFQQETTFRR.S
  5.8    0.04        H.RLSIIPQDSQLLEGTIR.Q
  5.6    0.24        T.FGDSNDINHFILFENR.V
Top scoring peptide matches to query 98
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.3    0.33        R.TSDMNNRNSSINNNNNN.N
  6.4    0.31        K.CGLDYLYNTHNNNNNN.N
  5.0    0.23        H.NVFNNSSDNQVQINKSK.I
  3.1    0.23        H.NVFNNSSDNQVQINKSK.I
  2.9    0.19        K.TFNNNATTENKFNNLQA.M
  2.9    0.19        K.TFNNNATTENKFNNLQA.M
  2.5    0.36        R.LVFSNNTNNNNNNNNNN.N
  1.8    0.24        E.NDDMINDDLNYYLPPK.S
  0.5    0.23        H.NVFNNSSDNQVQINKSK.I
Top scoring peptide matches to query 99
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 60.7   -0.79    6  TRBOTR R.LGEDNINVVEGNEQFISA.S
 50.8   -0.79    6  TRBOTR R.LGEDNINVVEGNEQFISA.S
 42.9   -0.79    6  TRBOTR R.LGEDNINVVEGNEQFISA.S
 38.6    0.19    6  TRBOTR R.LGEDNINVVEGNEQFISA.S
 30.8   -0.79    6  TRBOTR R.LGEDNINVVEGNEQFISA.S
 12.2    0.19              K.ISQLSQTPTSGNNNNTGIT.N
 12.2    0.19              K.ISQLSQTPTSGNNNNTGIT.N
 12.2    0.19              K.ISQLSQTPTSGNNNNTGIT.N
 12.2    0.19              K.ISQLSQTPTSGNNNNTGIT.N
  7.5   -0.79              K.ISQLSQTPTSGNNNNTGIT.N
Top scoring peptide matches to query 100
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.00        H.LPELNQPLIPQLRSAASK.C
  1.1    0.06        V.LPKNYQLPDIVYNLQR.I
Top scoring peptide matches to query 101
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 102
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.7   -0.09        K.NVGDGDGLSQLKLLNNILK.E
  4.4    0.00        N.QIFHTNLEQLVNSPENK.Q
  4.4    0.00        N.QIFHTNLEQLVNSPENK.Q
  2.8   -0.00        K.EQDFKVLFDALNGVTGPY.G
  2.3   -0.10        G.VTIDQIYTTGYSAVLQLK.K
  2.0    0.15        Q.LSLQDMMANINEDENNK.A
  2.0   -0.04        K.NQQTKYGFQEVVTPLIF.K
  2.0   -0.04        K.NQQTKYGFQEVVTPLIF.K
  1.8   -0.04        -.GTVLWNSGINQLQSNALPT.K
  1.8   -0.04        -.GTVLWNSGINQLQSNALPT.K
Top scoring peptide matches to query 103
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 50.8    0.14    4+ mRBT5 K.QSTSSTPCPYWDTGCLC.V
  7.3   -0.01             R.NFELETNFIDADNAHLR.P
  4.3    0.01             R.GVSTCSTRFVSGGSAGGYGGGV.S
  3.0   -0.01             R.NFELETNFIDADNAHLR.P
  2.0    0.06             K.SYNTSMSASPLNRSGSSLC.T
  0.7   -0.04             -.MEFFSSSLILQAMRAIC.L
Top scoring peptide matches to query 104
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 63.7    0.17    5  8527.1 K.HEGAAIDYLFLGKNGADLK.Y
  7.1    0.17              F.QLEKVSTQMEYVTHLPK.E
  4.3    0.26              K.QDFSFTNQFEKLPESTI.T
  4.2    0.11              T.ILDRIDYNLVNTVQDLK.Q
  4.0    0.32              V.QANMLDNIMDYISDETK.R
  3.5    0.08              V.LKFTPSELSVISINGQAVK.S
  3.3    0.19              Q.GNMDLSKIEQLIIDEADK.L
  2.8    0.06              W.LPKHTPEITAPIVDNFLK.R
  2.7    0.19              N.LQEAVNSIIYSANHTELK.E
  1.1    0.17              N.TIDNNNKIDDQILTTAIK.Y
Top scoring peptide matches to query 105
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
107.5    0.15    1  mALS3.5eoc Y.TLSYANEYTCAGGYWQR.A
  9.6    0.31                  R.WNQDDIFQSHDNANENS.N
  6.1    0.26                  R.LSTSNSNNNNNNNNNNNSS.T
  5.5    0.22                  K.VNSCQGTYTNFVNLADMS.A
  5.5    0.22                  K.VNSCQGTYTNFVNLADMS.A
  3.9    0.23                  L.NTMAESSPYGGYGNSSMNR.Y
  3.9   -0.09                  P.VLLPLWGYYTFLKQNGK.E
  3.4    0.26                  R.LSTSNSNNNNNNNNNNNSS.T
  3.3    0.23                  L.NTMAESSPYGGYGNSSMNR.Y
  3.2    0.21                  I.SYSPTSRCEDSYQQSSR.H
Top scoring peptide matches to query 106
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.4    0.08        K.YIPGSGTIISNINIPSPNTS.T
  8.4    0.08        K.YIPGSGTIISNINIPSPNTS.T
  8.4    0.33        K.NNQTNNDDVNQSLTVYDS.L
  8.4    0.33        K.NNQTNNDDVNQSLTVYDS.L
  8.4    0.33        K.NNQTNNDDVNQSLTVYDS.L
  8.4    0.33        K.NNQTNNDDVNQSLTVYDS.L
  6.3    0.18        R.NFIVNSHTTSSRSNHSNGS.N
  5.8    0.18        K.LTRNTSQTTQDSSSSQFAS.V
  5.8    0.18        K.LTRNTSQTTQDSSSSQFAS.V
  5.8    0.33        K.QQGHFDSMNTLCYSPDGS.R
Top scoring peptide matches to query 107
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.5    0.08        K.TTNLKANNIYPSNSISNAK.Y
  5.5   -0.00        L.AGCLSKMPQLVHVSLLGNK.N
  5.1    0.13        K.YFAIQEIAEQNSQPLTTP.E
  5.1    0.13        K.YFAIQEIAEQNSQPLTTP.E
  5.1    0.13        K.YFAIQEIAEQNSQPLTTP.E
  4.8    0.02        R.TYLGTLLSFDKHMNLVLS.D
  4.8   -0.77        T.GQSSQNNSTSNLNSSGNGNGK.R
  4.0    0.12        M.AVFQECLQQFNASPVNAK.K
  4.0    0.12        M.AVFQECLQQFNASPVNAK.K
  3.9    0.12        M.AVFQECLQQFNASPVNAK.K
Top scoring peptide matches to query 108
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.6    0.07        L.FIGQSLGPMFGNWINSIGK.H
  4.0    0.07        G.DSPMQVFNYILNGDAAAVK.E
  3.7   -0.11        A.SVSVPASVQVQVQKIQIMK.V
  2.5   -0.11        D.LNQESVNLISLLGIVRGLK.L
  2.0    0.01        K.TIASPIKGILAPGGGSGGNGGSGGS.G
  1.8   -0.78        E.PNLNSQTHNYNNNNYKK.I
  1.8   -0.78        E.PNLNSQTHNYNNNNYKK.I
  1.2    0.00        K.VGPLPQKFNIDDLPSNWK.K
  1.2    0.00        K.VGPLPQKFNIDDLPSNWK.K
  1.1    0.16        R.ASSIQSGQPSFFSAQQYFS.R
Top scoring peptide matches to query 109
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 21.4    0.17    1+ mALS3.5eoc K.GLNDWNYPVSSESFSYTK.T
  0.7    0.18                  E.TQEVETENSENIAETGDVK.I
Top scoring peptide matches to query 110
Score greater than 31 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 91.9    0.14    5  8527.1 L.GGDVYELGATDNFIPVTINK.D
 13.3    0.25              I.ENDNVAVNDWTKLINSCK.N
 11.3    0.15              K.ILSAYANKMNNTPVLVNLQ.P
 11.3    0.24              V.SFKEIENNENHIDQYNK.L
  9.9    0.29              H.MDPNFCSRIFDEGYLNK.H
  9.4    0.29              K.QMAQQMGLGGENGPDLSNIM.N
  9.3    0.15              K.ILSAYANKMNNTPVLVNLQ.P
  9.2    0.16              K.SNNASTILLFNSNVPSSLNK.S
  9.2    0.16              K.SNNASTILLFNSNVPSSLNK.S
  8.8    0.06              R.ETLLTLLEIYLSLNKSTGD.K
Top scoring peptide matches to query 111
Score greater than 17 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.3    0.14        -.SEGEDIDEYGFPKDSLDME.I
  3.8   -0.11        E.NNSIWAKIQSVLLISCNSK.R
  3.5    0.11        K.FAPNYDIENPSDNTSTEFI.E
  2.4    0.11        K.FAPNYDIENPSDNTSTEFI.E
  2.2    0.11        R.TETNNSGGIQGGISNGENIYF.S
  2.1   -0.01        R.QPSNSINTNVNKVPSINSPY.V
  2.1   -0.01        R.QPSNSINTNVNKVPSINSPY.V
  2.1    0.04        K.YDQWWRDHTHLYLDNL.E
  1.6    0.06        I.DYENESDGSIMIDDGKFLK.G
  1.5    0.06        K.YDEINSYLQHFEQLDFI.T
Top scoring peptide matches to query 112
Score greater than 13 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.0    0.15        A.AGINSTSNQSSNISGSSQPINK.G
  0.0    0.15        A.AGINSTSNQSSNISGSSQPINK.G
Top scoring peptide matches to query 113
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.0    0.05        K.SGPNLGETRDEWHLVDFQI.E
  0.7    0.01        N.SVSWAPHELGAVLLCTSSDGK.V
  0.5    0.07        K.CYITNDETPQINKINQFI.T
Top scoring peptide matches to query 114
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8   -0.01        K.IQQNQVTRQSILQEIIQLG.N
  2.6    0.19        K.GSTNSSTNSSVIWDKDSNGGGSG.G
  1.6    0.05        K.FNKFQQLINLTNIGGVSSSGS.G
  1.6    0.05        K.FNKFQQLINLTNIGGVSSSGS.G
  1.6    0.05        K.FNKFQQLINLTNIGGVSSSGS.G
  1.6    0.05        K.FNKFQQLINLTNIGGVSSSGS.G
  0.5   -0.10        S.QIISGAGAIMAIQVLLDHHVK.E
  0.2    0.19        K.GSTNSSTNSSVIWDKDSNGGGSG.G
Top scoring peptide matches to query 115
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.8    0.02        R.DHIVQDSLQYIKTNSDNLK.K
  5.3    0.08        K.FYPTNDGLGFNCFRLPANK.D
  5.2   -0.07        N.NIKALGVVLVDYVCELNGEK.K
  5.0    0.07        Y.NLVGPNTPPINLNSNSYTANK.E
  5.0    0.07        Y.NLVGPNTPPINLNSNSYTANK.E
  4.7   -0.77        D.LNCFNEWETMSNGNQPMK.R
  3.5   -0.01        K.QQDYTLSNLLFIYDALSKV.D
  3.5   -0.01        K.QQDYTLSNLLFIYDALSKV.D
  3.5   -0.01        K.QQDYTLSNLLFIYDALSKV.D
  3.3    0.04        Q.PVQQPVQQPVQQPGQEQWK.E
Top scoring peptide matches to query 116
Score greater than 23 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.5    0.10        R.FYMIFLALLNAAKITFSFF.L
 12.5    0.32        R.QISENFNQYGKLYHDDGQI.K
 10.2    0.14        I.NSNLVKLNEIASSADNAQIIR.Q
  2.0    0.27        T.PRSEQNVFGQMPDPNLSPEK.T
Top scoring peptide matches to query 117
Score greater than 22 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.0    0.17    6  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 34.7    0.17    6  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 16.6    0.17    6  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  8.8    0.17    6  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  7.1    0.18              L.TVDGVNVVNFHNFDNLINLK.T
  4.8    0.18              L.TVDGVNVVNFHNFDNLINLK.T
  3.8    0.15              K.LLSNDDAKVNEICVIGGNTIK.G
  0.9    0.18              L.TVDGVNVVNFHNFDNLINLK.T
Top scoring peptide matches to query 118
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4    0.32        F.YNNGNPFNNNNNNNNNNEGSK.N
  3.4    0.03        K.DLVNDLNNSFSSKSHLDELIN.K
  2.3   -0.10        K.ISKLTLSNLLNFSFQLNLMY.F
  2.0   -0.02        K.GITMFNKINIPLIGMVQNMSH.F
  0.8   -0.09        K.TLVAGNVLADVEPQYGVTYLPR.K
  0.5    0.04        K.STVTGFEGEVLLDGGQNIDYIF.A
  0.4    0.15        R.IISGGQVQMSDWVEDYDTISD.T
  0.3    0.02        A.PEPPLDTSDPHVLLDPANYQR.F
  0.2    0.03        K.LIQSNGNQFQNLLSPQQQSLN.H
  0.1   -0.05        K.SQLLNQLFLSLSNREIDSNSP.I
Top scoring peptide matches to query 119
Score greater than 18 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.4   -0.24        M.NLPLKFTIVFTIIIQFITAAL.L
  4.7    0.08        L.SDDGKLVNVWNMTNHVSGMQK.I
  4.7    0.08        L.SDDGKLVNVWNMTNHVSGMQK.I
  3.4   -0.24        M.NLPLKFTIVFTIIIQFITAAL.L
  3.4    0.41        R.NNSEDSQINNNNNNNNNNSSM.H
  3.1    0.10        N.AFLAIYQALGSENCSTNQVCK.T
  3.1    0.10        N.AFLAIYQALGSENCSTNQVCK.T
  3.1    0.25        K.HANSNQSTSEDFVNSTPSSYDS.I
  2.9    0.23        R.NGFETVTRNNLTDDENWSTC.V
  2.9    0.24        N.NNNNNNNNNNNDNDEEIEMK.Q
Top scoring peptide matches to query 120
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 121
Score greater than 14 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6    0.06        K.NVGYDFDLRVMQFFTEGLCPN.Y
  1.8   -0.10        K.NIEPTAPSDKIPSIMPIQPFVLE.E
  0.7    0.09        I.QMNDSSINSNNSMMLSLGFIKR.L
  0.5   -0.18        P.HRGAIEFDNASLAYRPGLPLVLK.N
Top scoring peptide matches to query 122
Score greater than 13 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4   -0.71        K.FQFSDMKGVYAYHAQQWLEQA.H
  0.3    0.24        S.KQPDIGDIISLGGANGMSICANTGR.-
Top scoring peptide matches to query 123
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.1   -0.04        L.LLTGDYSLQQRVLILSATLMAAR.Q
 10.2   -0.71        K.AASDQSFFHQGTNMIEFFSQQE.L
 10.2   -0.71        K.AASDQSFFHQGTNMIEFFSQQE.L
  7.8   -0.04        L.LLTGDYSLQQRVLILSATLMAAR.Q
  6.5    0.13        K.GMTQIEIWEWERLELQWSSK.R
  6.1   -0.00        R.SQEIYKQLSTLPYLQPTNWIK.S
  5.9    0.07        K.RQILQYTGQPSLNLWPQTYIAG.A
  5.5    0.17        S.GNGCDMNLGVLKNDAQELPEVFK.E
  5.5    0.12        K.MVSYLYSTKSNIDSLVENLEIM.E
  5.4    0.22        R.HPLVNSTPSLNNNQPKQNWNNE.W
Top scoring peptide matches to query 124
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 125
Score greater than 24 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.4   -0.11        R.ALIGILEGGFIADLVLWLSYFFTS.K
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.19        R.AKHNTGGAMYQMSPYPTEQFPGQS.Q
 10.1    0.01        K.ASRSFNLQSEDKPPYSYATLIGIS.I
Top scoring peptide matches to query 126
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 127
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3    0.12              A.GTEASGTSNMKFALNGGLIIGTVDGANVEITR.E
  9.3    0.12              A.GTEASGTSNMKFALNGGLIIGTVDGANVEITR.E
  9.3    0.12              A.GTEASGTSNMKFALNGGLIIGTVDGANVEITR.E
  9.3    0.36    6  TRBOTR K.SAYPGQITSNMFCAGYLEGGKDSCQGDSGGP.V
Top scoring peptide matches to query 128
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 129
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.8    0.19        R.ENLATNPIDMLELVQSFLSSYKPNSKENEHSA.E
  3.8   -0.79        R.ENLATNPIDMLELVQSFLSSYKPNSKENEHSA.E
  3.8   -0.79        R.ENLATNPIDMLELVQSFLSSYKPNSKENEHSA.E
  3.5   -0.78        K.QLNLTQAAQINDHQQILGGTGFSTMQFQSVDQA.Y
  3.4   -0.78        K.NIANIIAANDAYIGTMFPNTSFKEIMQSNVDTA.I
Top scoring peptide matches to query 130
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.21        R.ITSRLISQPQSSHNQHHNHNHHQQQQQQQQQTGSS.Q
  2.7    0.25        R.FHNWLLSFNHQHIIGNSNNSNIDNDTIYYNTCGSS.L
  2.7    0.25        R.FHNWLLSFNHQHIIGNSNNSNIDNDTIYYNTCGSS.L
  2.7    0.25        R.FHNWLLSFNHQHIIGNSNNSNIDNDTIYYNTCGSS.L
  2.7    0.25        R.FHNWLLSFNHQHIIGNSNNSNIDNDTIYYNTCGSS.L
  2.7    0.25        R.FHNWLLSFNHQHIIGNSNNSNIDNDTIYYNTCGSS.L
  2.7    0.25        R.FHNWLLSFNHQHIIGNSNNSNIDNDTIYYNTCGSS.L
  2.7    0.25        R.FHNWLLSFNHQHIIGNSNNSNIDNDTIYYNTCGSS.L
  2.7    0.21        R.ITSRLISQPQSSHNQHHNHNHHQQQQQQQQQTGSS.Q
  2.4    0.18        K.SSLVRQLSNMSNVPGVNPCDANNLPPQLNPNCDQFDS.K
Top scoring peptide matches to query 131
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 132
Score greater than 13 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5    0.01        D.YSEGDIVFLINKYLDSSGNQDEYLPPTDTGNQMDLIAK.L
Top scoring peptide matches to query 133
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 134
Score greater than 16 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6    0.23        K.LLNDTNSTFVQLDNSDTDIDDSSSNSEDVSSNDEQIALMNS.S
  2.8    0.20        R.DSYYTPGSTDNCVFLNYHGGSGSGVWSAKFGNSLSYANADNS.G
  2.8    0.23        K.LLNDTNSTFVQLDNSDTDIDDSSSNSEDVSSNDEQIALMNS.S
  2.6    0.23        K.LLNDTNSTFVQLDNSDTDIDDSSSNSEDVSSNDEQIALMNS.S
  1.7   -0.04        R.VDNLFYRILLDQSCGTPMFQLIFNILNALWDQGEVFSS.A
  1.3    0.27        K.IINQPQNQFQQQIQQQQLMYQNTHPNANNGGNEQSSPSS.S
  1.2    0.30        K.QSTISPSLDRPMPMDHPIQEDELGDSTTEVDSEESNQNNS.R
  1.2    0.30        K.QSTISPSLDRPMPMDHPIQEDELGDSTTEVDSEESNQNNS.R
  1.2    0.30        K.QSTISPSLDRPMPMDHPIQEDELGDSTTEVDSEESNQNNS.R
  1.2    0.30        K.QSTISPSLDRPMPMDHPIQEDELGDSTTEVDSEESNQNNS.R