Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0308_q1.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 22 Mar 2007 at 17:22:02 GMT
Significant hits: mALS3.5eoc  |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mCHT2       583 aa - chitinase 2 precursor Candida albicans
                  mALS1.5eoc  |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  mRBT5       |predicted| C. albicans fungus|CA2558| 241 aa
                  8527.1      |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
                  19516.2     |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
                  TRBOTR      trypsin (EC3.4.21.4 ) precursor-bovine
                  mCrh11      |predicted| C. albicans |CA0375|: 453 aa
                  mALS4.5f    |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
                  10894.2     CONTIG=Contig20161 POSCDS1=8470 POSCDS2=9315
                  mPhr1       |experimentally validated by us| C albicans |CA4857| 548 aa
                  mPga24      |predicted| mIPF5185 C. albicans |CA1678| 533 aa

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 43 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mALS3.5eoc                        Mass: 94266    Score: 747    Queries matched: 12
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   352.71   703.40   703.40   0.00 0  37  0.25 1  R.APFTLR.W
12   448.23   894.45   894.41   0.04 0  14  37 1  L.NMPCVFK.F
 24   533.82   1065.62   1065.55   0.07 1  11  81 3  N.TVTFNDGGKK.I
47   659.86   1317.70   1317.60   0.10 0  45  0.035 1  L.TWSNAATYNYK.G
53   695.85   1389.69   1389.58   0.11 0  62  0.00068 1  N.EYTCAGGYWQR.A
54   695.89   1389.77   1389.66   0.11 0  61  0.00093 1  K.TCSSNGIFITYK.N
58   734.93   1467.85   1467.71   0.14 0  22  8.1 1  K.NVPAGYRPFVDAY.I
80   862.53   1723.05   1722.87   0.18 0  97  3.6e-007 1  F.STLTCTVSNTLTPSIK.A + Deamidation (NQ)
81   869.93   1737.85   1737.72   0.13 0  73  4.6e-005 1  S.YANEYTCAGGYWQR.A
82   878.50   1754.99   1754.86   0.13 0  101  9.9e-008 1  Y.GDVQIDCSNIHVGITK.G
87   913.45   1824.89   1824.75   0.13 0  101  7.2e-008 1  L.SYANEYTCAGGYWQR.A
103   1020.52   2039.02   2038.88   0.14 0  140  9.4e-012 1  Y.TLSYANEYTCAGGYWQR.A

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 743    Queries matched: 12
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 743    Queries matched: 12
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928

2.    mCHT2                             Mass: 59565    Score: 331    Queries matched: 6
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   425.23   848.44   848.40   0.04 0  30  0.98 1  K.FADSAPNK.N
16   495.30   988.59   988.54   0.05 0  50  0.011 1  K.LSSAIEEIK.C
25   545.84   1089.66   1089.58   0.07 0  35  0.34 1  T.GYPELATALR.G
48   662.34   1322.67   1322.56   0.11 0  10  1e+002 1  L.YWGQNGAGGQER.L + Deamidation (NQ)
93   952.03   1902.04   1901.92   0.12 0  115  4e-009 1  S.AAPQCPYPDASLGDLLSK.V
97   968.51   1935.02   1934.89   0.13 0  93  5.6e-007 1  -.SNQVALYWGQNGAGGQER.L + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 330    Queries matched: 6
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
      19719.2                           Mass: 51350    Score: 328    Queries matched: 6
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
3.    mALS1.5eoc                        Mass: 69052    Score: 330    Queries matched: 7
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   448.23   894.45   894.41   0.04 0  14  37 1  L.NMPCVFK.Y
18   511.28   1020.55   1020.49   0.06 0  42  0.073 1  L.TCTVNDALK.S
23   532.33   1062.64   1062.58   0.06 0  34  0.47 1  R.SQSKPFTLR.W
39   617.36   1232.71   1232.62   0.08 0  31  0.95 1  S.QTSVDLTADGVK.Y
52   689.84   1377.67   1377.56   0.11 0  44  0.045 1  L.AYTNDYTCAGSR.S
76   843.48   1684.94   1684.82   0.12 0  126  2.9e-010 1  K.YTTSQTSVDLTADGVK.Y
85   887.49   1772.96   1772.85   0.11 0  52  0.0077 1  K.YQNVPAGYRPFIDAY.I

 
      Proteins matching the same set of peptides:
      13002.2                           Mass: 133694   Score: 325    Queries matched: 7
 |Als1| CONTIG=Contig10233 POSCDS1=72223 POSCDS2=76005
      21498.1                           Mass: 133402   Score: 325    Queries matched: 7
 |Als1| CONTIG=Contig20233 POSCDS1=71475 POSCDS2=75257
4.    mRBT5                             Mass: 22745    Score: 232    Queries matched: 4
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
26   547.31   1092.60   1092.54   0.06 0  47  0.021 1  Q.FAGAVGNCVAK.N
62   775.44   1548.86   1548.74   0.12 0  50  0.012 1  C.VMPQFAGAVGNCVAK.N + Deamidation (NQ)
89   930.44   1858.87   1858.75   0.12 0  62  0.00062 1  K.QSTSSTPCPYWDTGCL.C
102   1010.46   2018.91   2018.78   0.13 0  74  3.9e-005 1  K.QSTSSTPCPYWDTGCLC.V

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 232    Queries matched: 4
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 232    Queries matched: 4
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
5.    8527.1                            Mass: 21461    Score: 196    Queries matched: 3
 |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 49   679.92   1357.83   1357.75   0.09 1  (10) 1.4e+002 2  K.KTDDSAPITIVAK.F
50   679.93   1357.84   1357.75   0.10 1  104  5.6e-008 1  K.KTDDSAPITIVAK.F
79   852.47   1702.93   1702.80   0.12 1  92  6.9e-007 1  K.DGTLSFTGDDKVYASK.N

 
      Proteins matching the same set of peptides:
      mIPF8527|mPga29:                  Mass: 19928    Score: 196    Queries matched: 3
 189 aa - Candida albicans unknown function
      21875.1                           Mass: 22824    Score: 196    Queries matched: 3
 CONTIG=Contig20225 POSCDS1=30286 POSCDS2=30900
6.    19516.2                           Mass: 94340    Score: 80     Queries matched: 3
 |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
20   521.80   1041.59   1041.52   0.06 0  35  0.27 1  R.HQDFVPATK.I
33   577.88   1153.75   1153.68   0.07 0  46  0.036 1  K.LGLTLPLTGNR.D
 95   965.52   1929.02   1928.89   0.12 0  5  3.4e+002 2  K.NAVTYDGPVPNNEIPAVC.L

 
      Proteins matching the same set of peptides:
      mIPF19516                         Mass: 90303    Score: 80     Queries matched: 3
 |mHYR1| validated by us| C. albicans fungus|CA1576| 900 aa
      19734.1                           Mass: 94169    Score: 80     Queries matched: 3
 |Hyr1| CONTIG=Contig20216 POSCDS1=152490 POSCDS2=155303
      m19734.1                          Mass: 91992    Score: 80     Queries matched: 3
 |mHyr1| validated by us| C. albicans fungus 917 aa
7.    TRBOTR                            Mass: 24662    Score: 75     Queries matched: 2
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
28   559.31   1116.60   1116.52   0.08 0  18  17 1  K.SIVHPSYNSN.T
35   587.86   1173.71   1173.64   0.07 0  57  0.0022 1  N.TLNNDIMLIK.L

8.    mCrh11                            Mass: 44667    Score: 53     Queries matched: 1
 |predicted| C. albicans |CA0375|: 453 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
78   851.95   1701.89   1701.78   0.11 0  55  0.0033 1  F.GGDPYQWQSNYFIK.G

 
      Proteins matching the same set of peptides:
      14360.2                           Mass: 46818    Score: 53     Queries matched: 1
 |Crh11| CONTIG=Contig10158 POSCDS1=92919 POSCDS2=94280
      24611.1                           Mass: 47890    Score: 53     Queries matched: 1
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
9.    mALS4.5f                          Mass: 167909   Score: 51     Queries matched: 1
 |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
71   825.98   1649.94   1649.83   0.11 0  51  0.01 1  K.FITDQTSIDLVADGR.T

 
      Proteins matching the same set of peptides:
      13010.2                           Mass: 169769   Score: 50     Queries matched: 1
 |Als4.5'| CONTIG=Contig2201 POSCDS1=7312 POSCDS2=12093
10.   10894.2                           Mass: 32947    Score: 47     Queries matched: 2
 CONTIG=Contig20161 POSCDS1=8470 POSCDS2=9315
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   514.35   1026.68   1026.58   0.10 0  31  0.92 9  N.NIQGLNQLK.T
 82   878.50   1754.99   1754.93   0.06 0  16  35 4  S.INDGLDLINAIVEDLK.N + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      10895.3                           Mass: 37579    Score: 47     Queries matched: 2
 CONTIG=Contig10161 POSCDS1=8479 POSCDS2=9324
11.   mPhr1                             Mass: 58075    Score: 45     Queries matched: 1
 |experimentally validated by us| C albicans |CA4857| 548 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
61   757.47   1512.93   1512.81   0.12 0  48  0.026 1  Y.IVADLSEPTVSINR.N

 
      Proteins matching the same set of peptides:
      15932.2                           Mass: 60276    Score: 45     Queries matched: 1
 |Phr1| CONTIG=Contig10192 POSCDS1=117957 POSCDS2=119603
      23455.1                           Mass: 60747    Score: 45     Queries matched: 1
 CONTIG=Contig20192 POSCDS1=117993 POSCDS2=119639
12.   mPga24                            Mass: 52805    Score: 44     Queries matched: 1
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
41   635.87   1269.73   1269.64   0.09 0  44  0.039 1  K.VITVVACDEHK.C

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 44     Queries matched: 1
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 44     Queries matched: 1
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
13.   9099.2                            Score: 42     Queries matched: 1
 CONTIG=Contig10161 POSCDS1=58201 POSCDS2=59367
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   514.35   1026.68   1026.60   0.09 0  42  0.071 1  L.PSIDIELLK.Q

 
      Proteins matching the same set of peptides:
      24490.1                           Score: 42     Queries matched: 1
14.   25992.1                           Score: 42     Queries matched: 1
 CONTIG=Contig20110 POSCDS1=14783 POSCDS2=14974
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   514.35   1026.68   1026.63   0.05 0  42  0.071 1  R.VILSLELIQ.S

15.   10840.2                           Mass: 37010    Score: 41     Queries matched: 1
 CONTIG=Contig10132 POSCDS1=26166 POSCDS2=27185
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   514.35   1026.68   1026.63   0.05 0  42  0.071 1  A.TIPTLQLLK.N + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      25488.1                           Mass: 37010    Score: 41     Queries matched: 1
 CONTIG=Contig20132 POSCDS1=26725 POSCDS2=27744
16.   11835.3                           Mass: 81802    Score: 41     Queries matched: 1
 CONTIG=Contig20204 POSCDS1=19727 POSCDS2=21805
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   514.35   1026.68   1026.67   0.01 0  42  0.071 1  F.IVTVLELIK.R

 
      Proteins matching the same set of peptides:
      28414.1                           Mass: 81914    Score: 41     Queries matched: 1
 CONTIG=Contig10204 POSCDS1=19721 POSCDS2=21799
17.   12218.2                           Score: 41     Queries matched: 3
 CONTIG=Contig20218 POSCDS1=16569 POSCDS2=18287
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   352.71   703.40   703.37   0.04 0  17  22 4  N.WQTLR.F + Deamidation (NQ)
 35   587.86   1173.71   1173.54   0.18 1  23  6.8 5  H.VNNNNNNDKK.T + Deamidation (NQ)
 69   803.49   1604.96   1604.75   0.21 0  8  2e+002 3  K.NDPIIVNGSTTTTNGT.N + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      28150.1                           Score: 41     Queries matched: 3
18.   1801.1                            Score: 39     Queries matched: 1
 CONTIG=Contig10216 POSCDS1=204501 POSCDS2=206183
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   514.35   1026.68   1026.64   0.04 1  42  0.071 1  G.VNKAIQLLK.D + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      22249.1                           Score: 39     Queries matched: 1
19.   921.1                             Score: 38     Queries matched: 1
 CONTIG=Contig2518 POSCDS1=69549 POSCDS2=73868
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   514.35   1026.68   1026.60   0.09 0  42  0.071 1  T.NSPLLELLK.F + Deamidation (NQ)

20.   6242.2                            Score: 38     Queries matched: 1
 CONTIG=Contig10119 POSCDS1=23813 POSCDS2=28810
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   514.35   1026.68   1026.64   0.04 1  42  0.071 1  E.NGKLLELLK.I

 
      Proteins matching the same set of peptides:
      25829.1                           Score: 38     Queries matched: 1
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
70   814.92   1627.82   1627.70   0.12 0  35  0.36 1  CSGLNDLSCICTTK
27   556.32   1110.62   1110.53   0.09 0  29  1.1 1  QASHNNIPTK + 2 Deamidation (NQ)
15   488.82   975.63   975.59   0.05 1  29  1.5 1  RVSGGFILK
6   406.25   810.49   810.48   0.01 0  29  1.1 1  LMHIGLK
9   423.23   844.45   844.43   0.02 0  27  2.1 1  EGGLGDLGK
7   417.26   832.51   832.47   0.04 0  27  2.3 1  IPYINTI
21   528.85   1055.69   1055.60   0.09 1  26  3.1 1  KGQIELGVNV
8   419.74   837.47   837.35   0.12 0  22  5.7 1  ECMGGLR + Oxidation (M)
4   364.74   727.46   727.45   0.01 0  21  6 1  AIEVAII
17   501.80   1001.59   1001.54   0.06 0  21  9.3 1  GTLQNLDLK + Deamidation (NQ)
29   561.30   1120.58   1120.55   0.03 0  19  14 1  LMCATWLAR
13   449.76   897.51   897.47   0.04 0  19  11 1  GLLSSQHR + Deamidation (NQ)
65   790.97   1579.92   1579.77   0.15 0  18  21 1  QADGAITPPPDLNTGI + Deamidation (NQ)
14   453.78   905.54   905.52   0.02 1  17  23 1  ELKEIFK
56   716.91   1431.80   1431.76   0.03 0  17  24 1  ALGMSLIGIDALNK + Deamidation (NQ); Oxidation (M)
44   652.92   1303.83   1303.71   0.11 1  16  34 1  KDQVLQHLPPK + 2 Deamidation (NQ)
38   606.88   1211.76   1211.71   0.04 0  16  28 1  EAIQDIILGLK
31   574.86   1147.70   1147.49   0.21 0  16  30 1  QIVTLNDDND + 2 Deamidation (NQ)
74   839.97   1677.92   1677.85   0.07 1  16  29 1  SIVKNTNYLPSNVIN + 3 Deamidation (NQ)
45   655.35   1308.68   1308.57   0.10 1  16  26 1  KDFIVENDEAE + Deamidation (NQ)
77   849.96   1697.91   1697.82   0.09 1  16  29 1  SMQVYQKLDQITNK + 3 Deamidation (NQ)
46   659.84   1317.66   1317.54   0.12 0  15  35 1  QGTNHEEIEML + 2 Deamidation (NQ); Oxidation (M)
32   574.86   1147.71   1147.70   0.01 0  15  43 1  KPNLIPQIPK + Deamidation (NQ)
64   790.95   1579.89   1579.79   0.10 0  15  42 1  LYGVDCSQVEAVLK
5   751.38   750.37   750.37   0.00 0  14  36 1  QYGQQK
111   1158.06   2314.10   2314.19   -0.08 1  14  37 1  HTLANVPYVPVGTVQCQFKR + Deamidation (NQ)
30   563.33   1124.64   1124.59   0.05 0  14  38 1  YNFNLKPTK + Deamidation (NQ)
88   921.56   1841.11   1840.78   0.33 0  14  64 1  EHGMGAIMNGIAAFGANY + 2 Deamidation (NQ); Oxidation (M)
105   1036.03   2070.04   2070.05   -0.01 0  14  45 1  YCVPIIFLFFFCFLGK
51   685.38   1368.74   1368.70   0.03 1  13  51 1  SITFQNRNYLI + Deamidation (NQ)
115   1266.57   2531.13   2531.42   -0.28 1  13  51 1  IPGIPLPPAMKTTFLQLRPAPLGS + Deamidation (NQ); Oxidation (M)
55   696.92   1391.82   1391.62   0.20 0  13  66 1  TSNNNPNTISSNK + 2 Deamidation (NQ)
24   533.82   1065.62   1065.52   0.10 1  13  58 1  QDTIYRNR + Deamidation (NQ)
10   424.22   846.43   846.39   0.04 0  12  65 1  GQWNQLT + Deamidation (NQ)
40   618.35   1234.68   1234.62   0.06 1  12  78 1  DILELNNRFT + Deamidation (NQ)
86   893.53   1785.05   1784.93   0.12 0  12  1e+002 1  SIGNELVNAGSATPSQIK
36   603.36   1204.71   1204.67   0.04 1  11  86 1  ISVVPISKFNT + Deamidation (NQ)
90   931.96   1861.90   1861.82   0.09 1  11  74 1  NGSLHNVSQKSTPNSTTS + 4 Deamidation (NQ)
49   679.92   1357.83   1357.71   0.12 1  11  1.1e+002 1  QNALIEVQNKAK + 3 Deamidation (NQ)
98   647.70   1940.09   1939.86   0.23 1  10  1.2e+002 1  SMKTESNITAAAWNENR + 2 Deamidation (NQ); Oxidation (M)
69   803.49   1604.96   1604.94   0.02 1  10  1.3e+002 1  KLEEVIIPDILPNI
2   564.82   563.81   564.29   -0.48 0  10  1.1e+002 1  YSAPK
84   590.68   1769.02   1768.71   0.31 0  10  1.4e+002 1  NNNNNNNNHKPNINK + 7 Deamidation (NQ)
43   650.85   1299.68   1299.68   -0.00 1  9  1.2e+002 1  QSLPDLSKAEGR
72   828.00   1653.99   1653.64   0.34 0  9  1.9e+002 1  YFYYGNHSDELSC
124   1489.69   4466.04   4465.91   0.13 1  9  82 1  ANYEIINNNKANQNQMNDINEHTDLCHHQWYSFSIGK + 6 Deamidation (NQ)
67   797.94   1593.86   1593.72   0.14 0  9  1.4e+002 1  LAESNDELNAVSFAN + Deamidation (NQ)
100   989.03   1976.05   1976.09   -0.04 1  9  1.5e+002 1  LPELNQPLIPQLRSAASK + 2 Deamidation (NQ)
1   563.33   562.32   562.27   0.05 0  9  1.1e+002 1  ANSSGK
59   736.42   1470.82   1470.73   0.09 1  9  1.5e+002 1  KLQGDSSITTSHTP
22   1062.57   1061.56   1061.51   0.06 1  9  1.5e+002 1  MQQQVQKAV + 3 Deamidation (NQ)
75   840.49   1678.96   1679.68   -0.72 0  8  1.9e+002 1  QEQEEQQQSDNSTK + 2 Deamidation (NQ)
57   727.94   1453.86   1453.76   0.11 1  8  1.9e+002 1  DIPNRHLALEYL + Deamidation (NQ)
110   1137.14   2272.27   2272.12   0.15 0  8  2e+002 1  TTPSATGTPKPSATQVQLSQDR + 2 Deamidation (NQ)
63   780.48   1558.95   1558.65   0.30 1  8  2.3e+002 1  KIQPANNNNNSNNN + 4 Deamidation (NQ)
34   577.88   1153.75   1153.63   0.12 0  8  2.1e+002 1  SIGLGGNPNLIV + Deamidation (NQ)
101   1007.49   2012.96   2012.90   0.06 1  8  1.6e+002 1  EFIDPSKVNNCVGCNFI + Deamidation (NQ)
104   1024.05   2046.08   2045.92   0.15 1  8  1.9e+002 1  DTSSIGSNTTSTTNKSSAISS + Deamidation (NQ)
123   1477.00   4427.99   4427.75   0.24 0  7  1.4e+002 1  NPNFMQQAMNMLGGAGGGAGGAGGLAGMMNNPAMMQQAQQMMR + 5 Deamidation (NQ); 6 Oxidation (M)
37   606.38   1210.74   1210.42   0.32 0  7  2.6e+002 1  NSTHNFNNMN + 3 Deamidation (NQ); Oxidation (M)
95   965.52   1929.02   1928.97   0.05 1  6  2.5e+002 1  SVNTPTVNSIRSNNSSPR
73   831.97   1661.92   1661.78   0.13 1  6  2.8e+002 1  YENGAVYLTDLEKF + Deamidation (NQ)
92   950.49   1898.96   1898.94   0.02 1  6  2.6e+002 1  DGITHSLANEVIMEGGKK + Deamidation (NQ)
66   531.96   1592.85   1592.77   0.08 1  6  2.9e+002 1  FPTSAVTYYSTKAGT
106   1055.55   2109.08   2108.90   0.18 0  6  2.8e+002 1  NDIIVPSAGTDEEFDNSQAS + Deamidation (NQ)
60   756.44   1510.87   1510.74   0.13 1  6  3.4e+002 1  KLFDTTTNTLLNE + 2 Deamidation (NQ)
113   1198.09   2394.16   2394.02   0.13 1  5  2.9e+002 1  EKNIVHMTSDESSTNSNNSGNK + 2 Deamidation (NQ)
108   731.72   2192.15   2192.05   0.10 1  5  3.3e+002 1  QSTEALTQNRLMIVESEEI + 2 Deamidation (NQ)
94   636.73   1907.18   1906.84   0.34 1  5  5.5e+002 1  ENTKANFFEANMYLAE + Oxidation (M)
96   967.05   1932.09   1932.03   0.07 1  5  4.3e+002 1  VNPVKLPMSTLETLNLY + Deamidation (NQ)
68   535.64   1603.90   1603.73   0.17 1  5  4e+002 1  NNGQAPPPQPQNGARG + 2 Deamidation (NQ)
118   919.17   2754.47   2754.17   0.31 0  5  4.1e+002 1  NYNFYNNNNNNNSIGVGITFNSQK + 5 Deamidation (NQ)
109   1108.06   2214.10   2214.87   -0.77 1  4  3.5e+002 1  VFVCMSGESRVMMDNFCM + Oxidation (M)
107   1088.51   2175.02   2175.03   -0.02 1  4  3.8e+002 1  QPSNSINTNVNKVPSINSPY + 3 Deamidation (NQ)
120   1368.98   4103.91   4103.69   0.22 1  4  2.7e+002 1  GQGSGSRSSLGQSQSQSQSQGQSQGQSQGQGQSQSQSQSQS + 6 Deamidation (NQ)
42   645.31   1288.60   1288.68   -0.08 1  4  4.4e+002 1  QTKFVHLSSNK + Deamidation (NQ)
119   1203.27   3606.79   3606.78   0.01 1  4  3.7e+002 1  SFNYYVQIMTVESTNSFVVPAGTKQIEIAPLGS + Deamidation (NQ); Oxidation (M)
116   1269.59   2537.17   2537.09   0.08 1  3  4.8e+002 1  YFTQGRGNGPSNLNSSTSAQFSTD + 2 Deamidation (NQ)
112   1189.08   2376.15   2376.00   0.16 1  3  5.1e+002 1  GSVYCHPWPENSGWREQGSGS
91   946.52   1891.03   1890.97   0.06 1  2  7.5e+002 1  ASEVFTNQPNAFVRGVR
122   1422.99   4265.94   4265.91   0.03 0  2  4.7e+002 1  NDYSQSSSMLLNDQPQQTIQEGSISTTSSAIIVGIPHPES + 7 Deamidation (NQ)
114   801.43   2401.26   2401.17   0.09 1  1  8.3e+002 1  KIMMIPTHHQTYNINTHQPP + Deamidation (NQ)
83   588.65   1762.94        
99   648.36   1942.07        
117   1275.67   2549.33        
121   1404.00   4208.96        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 124

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 20 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8    0.05        Y.ANSSGK.S
  8.8    0.01        M.GKSSGK.G
  8.8    0.05        R.GQSSGK.G
  8.8    0.09        K.GQSSQG.I
  8.8    0.05        L.NASSGK.F
  8.8    0.09        R.NASSNA.T
  6.7    0.06        K.ADISSA.F
  6.7    0.08        K.ADLNM.D
  6.7    0.06        R.ANLGTS.T
  6.7    0.06        R.DALASS.I
Top scoring peptide matches to query 2
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.1   -0.48        YSAPK
  7.9    0.54        K.GRTSSG.H
  7.9    0.55        K.LSNSSG.D
  7.9    0.54        R.RGTSSG.G
  7.9    0.54        K.RSASSG.G
  7.9    0.55        R.SNLSSG.Q
  7.9    0.55        R.TVNSSG.T
  7.9    0.58        K.WQSSG.G
  6.6   -0.52        YAAIK
  6.6   -0.52        Q.YAALK.V
Top scoring peptide matches to query 3
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 36.9    0.00    1  mALS3.5eoc APFTLR
 28.6    0.04                  R.APFDVR.G
 18.7    0.07                  R.APQTMR.Q
 17.4    0.05                  E.QGETIR.K
 17.4    0.02                  S.SVETIR.M
 17.4    0.04   17  12218.2    N.WQTLR.F
 17.0    0.09                  L.ADEDVR.K
 17.0    0.05                  L.ADQITR.R
 15.4    0.00                  PAFLTR
 15.4    0.04                  D.PAFVNR.I
Top scoring peptide matches to query 4
Score greater than 33 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.7    0.01        K.AIEVAII.R
 19.4    0.00        K.RVVELL.G
 18.8    0.05        K.INSPAIL.L
 17.9    0.13        K.CHDAII.Q
 17.9    0.15        R.EDASHGI.S
 17.9    0.01        R.ELAVAII.M
 17.9    0.01        K.LDLAAIL.K
 17.9   -0.02        R.LVSIALL.M
 17.9    0.01        R.NLALALL.G
 17.9    0.07        K.NNPSALL.E
Top scoring peptide matches to query 5
Score greater than 25 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.3    0.00        D.QYGQQK.D
 11.7   -0.03        F.FGSGKQK.D
 11.3    0.10        K.SADQGNGT.S
  9.8    0.07        G.DASESNK.R
  8.9   -0.02        V.NAIFTGK.R
  8.8    0.05        R.DADGNFI.W
  8.0    0.07        T.QGSEDSK.D
  7.9    0.05        E.VSMDNGK.C
  7.8   -0.01        E.SVNTTTK.T
  7.7    0.07        S.EGSESDK.D
Top scoring peptide matches to query 6
Score greater than 39 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 28.6    0.01        D.LMHIGLK.F
 24.8    0.10        LMQYEK
 23.4   -0.03        V.LIPDILK.G
 21.6   -0.01        L.LNQPVIK.S
 20.0    0.07        P.IHDQGLK.E
 20.0   -0.01        T.IHLSTIK.K
 20.0    0.03        T.LHDSVLK.D
 20.0    0.03        P.LHTEAIK.S
 19.8   -0.01        C.HITSLLK.D
 19.8   -0.01        G.HLTSILK.I
Top scoring peptide matches to query 7
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.8    0.04        C.IPYINTI.-
 17.1    0.07        E.LNKQSSR.N
 14.6    0.07        V.IPYTPDK.N
 14.6    0.00        N.LPYLVTK.G
 12.9    0.00        R.IFIVQTI.A
 12.3    0.07        L.LAKGNSSR.S
 10.9    0.09        S.MQLSPTR.Q
 10.7    0.09        P.IPMTTDR.E
 10.7    0.03        A.IPTFSIR.I
  9.7    0.07        I.LDKSQSR.F
Top scoring peptide matches to query 8
Score greater than 27 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.8    0.12        K.ECMGGLR.Q
 13.0    0.14        P.QTNGMDR.T
 11.3    0.07        I.EKSTSMR.N
 11.3    0.11        V.QQSNFGR.S
 10.5    0.07        M.EAGGFTTR.E
 10.5    0.01        V.EGARHIR.E
  9.9    0.06        Y.RTDYAGR.G
  9.0    0.03        I.RTFATSR.I
  8.6    0.05        N.EGASSLFK.G
  8.6    0.08        I.EKSDTMK.R
Top scoring peptide matches to query 9
Score greater than 37 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 27.1    0.02        Q.EGGLGDLGK.S
 23.2    0.05        R.GELNERQ.Q
 23.2    0.01        Y.NAINERK.T
 14.5   -0.00        R.ADLIVNSI.R
 13.1    0.06        R.QGEVNNAI.I
 12.5    0.02        M.EVANNIGK.L
 12.0    0.10        R.SNNDNIPA.W
 12.0    0.10        R.SNNDNIPA.W
 11.4    0.05        Y.ANLQNAGR.Q
 11.4    0.05        Y.ANLQNAGR.Q
Top scoring peptide matches to query 10
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.4    0.04        K.GQWNQLT.G
 12.4    0.02        K.GSLNNQIT.N
 12.4    0.03        K.LQENLQT.L
 12.4    0.01        -.TNRNQLT.T
 11.3   -0.00        K.EEIVKQT.Y
 11.3    0.03        K.EQINELT.T
 11.3    0.02        R.GSNLQQVT.L
 11.3    0.02        R.GSNLQQVT.L
 11.3   -0.00        K.QELIKDT.K
 11.2    0.06        R.GGNAADAAVT.V
Top scoring peptide matches to query 11
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 30.4    0.04    2  mCHT2 K.FADSAPNK.N
 17.4    0.01             MVLVGDVT
 15.3    0.04             K.HKYSDVT.D
 12.7    0.06             R.QVQASDIS.G
 11.7    0.07             K.YPPASEW.N
  8.7    0.06             R.SMDGMVPI.G
  8.7    0.03             K.GKCIGDSI.N
  8.7    0.05             R.SNEKGDSL.K
  8.6    0.03             K.SQLSVNVT.N
  8.0    0.11             R.FANSHDAS.W
Top scoring peptide matches to query 12
Score greater than 24 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 14.0    0.04    1+ mALS3.5eoc NMPCVFK
 10.4    0.11                  N.NMDDSNAK.N
 10.1   -0.08                  C.NKIPVPAR.S
  9.2    0.01                  I.SASVQEFK.L
  8.4   -0.00                  R.SGLVMLPY.H
  7.5   -0.05                  G.HRVEQVK.E
  6.1   -0.07                  N.SIKSSFVK.S
  5.0    0.04                  K.NINSTMAK.Q
  4.8    0.01                  L.SSALNEFK.S
  4.5    0.08                  I.NNQDEFK.Q
Top scoring peptide matches to query 13
Score greater than 23 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.8    0.04        L.GLLSSQHR.H
  9.6    0.01        D.GIIPTNQR.A
  8.8    0.04        N.GLIMHSPK.L
  7.8    0.06        C.GLLNQHSK.I
  7.1    0.05        V.GLSSIMYK.V
  6.8    0.02        Y.GISLFYAK.E
  5.3    0.06        I.VANDITHK.I
  5.3    0.00        F.GIPLFSHK.S
  5.1    0.01        R.GLQTKHSK.L
  4.6    0.02        D.GINDAPALK.Q
Top scoring peptide matches to query 14
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.8    0.02        E.ELKEIFK.N
 16.8    0.11        R.ELQGMNSK.R
 16.8    0.02        M.QIKELFK.I
 16.8    0.09        L.QLKEMEK.L
 16.8    0.08        K.QLKSGMNK.F
 16.8    0.10        K.QLQSSNTK.G
 14.4    0.02        K.EIKLQFK.K
 14.4    0.02        Q.EIKQFLK.L
 14.4    0.09        D.EIQQMIK.D
 14.4    0.02        L.ELKQFIK.L
Top scoring peptide matches to query 15
Score greater than 35 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 29.1    0.05        K.RVSGGFILK.T
 20.9    0.18        S.NGNNSNLIK.N
 20.6    0.17        R.MGANDNILK.G
 20.3    0.06        A.KFVNNLLK.E
 20.2    0.12        L.RMLSGGDIK.F
 20.1    0.14        R.YPLNDLLQ.F
 19.1    0.20        Y.ENQDDILK.A
 19.0    0.11        N.QMLRSVSR.D
 18.5    0.14        N.EMIDDLLK.L
 18.2    0.13        L.NNGSRSTIK.S
Top scoring peptide matches to query 16
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 50.1    0.05    2  mCHT2 K.LSSAIEEIK.C
 29.0    0.01             H.LSSLISEIK.A
 27.2    0.01             N.LSSTVLELK.K
 22.1    0.07             I.LSRDQEIK.K
 21.5    0.09             K.SLSSPEQIK.E
 20.4    0.10             K.INMIQQQL.S
 17.7    0.04             E.LSASNEKLK.H
 17.5    0.09             R.LSSLQNLVN.S
 17.4    0.01             L.LSSNLTILK.F
 16.6    0.04             K.LSSIAGSKVQ.Y
Top scoring peptide matches to query 17
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.6    0.06        K.GTLQNLDLK.S
 19.4    0.12        R.SAESDLQPR.R
 19.2    0.02        A.TGLVGSQIVK.V
 15.0    0.12        Q.TGANPSEVAR.I
 14.2    0.09        Y.VTAVQSPNGK.T
 14.0    0.07        K.GTIQLNSNR.Q
 12.2    0.02        K.GTLKLLVDGS.G
 11.9    0.02        R.GTIGDVITKV.L
 11.6    0.06        K.GTLQNLDLK.S
 10.9    0.09        P.EQIQQIDK.E
Top scoring peptide matches to query 18
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 41.6    0.06    3  mALS1.5eoc L.TCTVNDALK.S
 29.1    0.04                  G.TNNKTVTNK.S
 17.1    0.04                  G.TNNKTVTNK.S
 14.2    0.15                  R.SQNQTVNGNG.L
 10.2    0.19                  K.TDNDNEANQ.H
  8.9    0.04                  K.NINTKSTNK.S
  8.6    0.17                  R.TNNNNNSNQ.N
  8.3   -0.01                  L.NFTQISLAK.S
  7.9    0.04                  A.TCISLWNK.L
  7.2    0.08                  K.LNTNTNTNK.N
Top scoring peptide matches to query 19
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.2    0.01   16  11835.3 F.IVTVLELIK.R
 42.2    0.04   20  6242.2  E.NGKLLELLK.I
 42.2    0.09   19  921.1   T.NSPLLELLK.F
 42.2    0.09   13  9099.2  L.PSIDIELLK.Q
 42.2    0.05   15  10840.2 A.TIPTLQLLK.N
 42.2    0.05   14  25992.1 R.VILSLELIQ.S
 42.2    0.04   18  1801.1  G.VNKAIQLLK.D
 31.2    0.07               P.AIQGDVAIIK.A
 31.1    0.07               N.NAIINQIIK.S
 31.1    0.10   10  10894.2 N.NIQGLNQLK.T
Top scoring peptide matches to query 20
Score greater than 26 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.4    0.06    6  19516.2 R.HQDFVPATK.I
 11.8    0.07               I.KTANVDHTR.H
 11.6    0.15               K.HAGLDDNATQ.L
 10.0    0.04               K.QTQGPSKPAK.K
  8.7   -0.02               I.RLQIHFTK.E
  8.7   -0.03               K.LRDTLPVTK.N
  8.1    0.11               V.ETGQMVFSK.R
  8.0    0.11               P.SMFNLANTK.N
  7.1    0.07               P.KGETFGFQK.K
  7.0    0.18               F.DNNANHGNGK.T
Top scoring peptide matches to query 21
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.9    0.09        R.KGQIELGVNV.E
 11.6    0.12        A.GAGQILGLDGR.Y
  7.4    0.06        A.NAAGLKILEK.G
  7.3    0.13        R.QKHFNGVAR.P
  7.1    0.29        F.QGNSDDYQK.I
  4.2    0.05        A.NAKLAISIAR.K
  4.1    0.09        D.QKGSLVAPEK.L
  3.8   -0.75        R.KGGMMAANVM.L
  3.5   -0.73        K.KESSSSGSSSN.V
  3.3    0.09        S.QQSNLPLKK.E
Top scoring peptide matches to query 22
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6    0.06        R.MQQQVQKAV.T
  8.6    0.06        K.TSKQDQINQ.E
  2.9    0.01        Q.MGKITSSNPK.S
  2.3    0.12        F.WGEANDQDK.I
  2.3    0.06        K.WGSIQIDDK.N
  2.3    0.11        K.VNNDTNDVLG.K
  2.0    0.09        K.ACLVNDEALG.K
  2.0    0.09        -.MGLSNDQSPL.L
  2.0    0.13        -.STMGELQHC.R
  2.0   -0.01        K.STVFAINPLT.G
Top scoring peptide matches to query 23
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 34.0    0.06    3  mALS1.5eoc R.SQSKPFTLR.W
 28.5    0.11                  S.SQSQKSSPSK.K
 22.5    0.08                  M.QLFQNILVS.I
 20.9    0.16                  I.QSDQESQLK.H
 19.4    0.07                  G.SKSQLTGTNK.H
 18.8    0.15                  K.QSSGPSAKSSQ.I
 17.9    0.10                  N.QSPKSMLEK.G
 15.9    0.12                  G.NTSKQVEQK.R
 15.9    0.13                  S.NTNASSGQKR.I
 15.8    0.10                  K.KSSMKPLEQ.K
Top scoring peptide matches to query 24
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 12.6    0.10                  P.QDTIYRNR.F
 11.6    0.17                  N.STTDSPTNNK.I
 11.1    0.07    1  mALS3.5eoc N.TVTFNDGGKK.I
 10.8    0.11                  V.ISFTNNQNK.V
 10.4    0.08                  K.KSQVGQFSIA.S
 10.4    0.11                  G.VTTNGDISMK.S
 10.2    0.03                  L.LSTSRFINK.S
 10.2    0.08                  Y.SITIFNQNK.S
 10.2    0.08                  Y.SITIFNQNK.S
 10.0    0.12                  K.LSGFLSEANQ.N
Top scoring peptide matches to query 25
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.3    0.07    2  mCHT2 T.GYPELATALR.G
 14.0    0.10             R.TKNGEIIISN.D
 12.4    0.09             R.VVFNSPILSD.K
 10.6    0.11             K.AVMELARVEG.L
 10.2    0.17             K.QQKQQENLA.L
 10.2    0.17             K.QQKQQENLA.L
 10.2    0.17             K.QQKQQENLA.L
 10.2    0.17             K.QQKQQENLA.L
 10.2    0.12             K.WKQISQDLA.K
  8.9    0.13             K.ESNISKNNLA.I
Top scoring peptide matches to query 26
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 47.0    0.06    4  mRBT5 Q.FAGAVGNCVAK.N
 17.2    0.01             K.KMTVLTGAGIS.C
 14.3    0.04             K.KFVTNFHVT.W
 13.4    0.11             R.NSTIADGSAGVT.S
 13.4    0.12             K.KSMVDQQQQ.Q
 13.4    0.12             K.KSMVDQQQQ.Q
 13.2    0.09             K.KMLNQDINT.I
 11.3    0.02             R.FAGCGSLLLR.T
 10.7    0.09             K.MANIVNSIQS.E
  9.5    0.11             T.MAQGVQEWK.N
Top scoring peptide matches to query 27
Score greater than 39 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 29.3    0.09        A.QASHNNIPTK.Q
 25.4    0.04        S.KMLQSMITK.M
 24.6    0.07        S.QTNKNIYTK.K
 22.9    0.10        K.ASSSPSSFLTGA.L
 22.6    0.17        K.KTNSGMVQNN.L
 20.3   -0.08        L.KLVLLSPDVK.R
 20.3   -0.07        C.DLRPLRLTK.Q
 19.7   -0.08        L.LVIKAELPTK.D
 19.5    0.02        I.PQTNNVLPTK.T
 19.0   -0.02        K.LAIRLSPLNN.F
Top scoring peptide matches to query 28
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.8    0.08    7  TRBOTR K.SIVHPSYNSN.T
  7.7    0.04              R.ISDRIAGAGGNS.R
  6.3    0.02              K.SIVNGLGAGKSN.W
  5.3    0.03              K.ENITQNVVSI.S
  4.2    0.11              K.VYRNYSNSN.N
  3.1    0.04              K.KPTSNQNKSN.Q
  2.6    0.07              K.NEIPSEVKSN.Q
  1.9    0.13              K.KNASQQNPDN.F
  1.7   -0.02              K.NLLLLMVSTN.Y
  1.5    0.07              R.ENQGLLELSN.R
Top scoring peptide matches to query 29
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.9    0.03        G.LMCATWLAR.C
 10.8    0.01        Y.IGFEIMNAAR.K
  9.1   -0.01        S.ILDFTTQQR.Q
  8.8    0.03        Y.TAAANFGDVVR.S
  8.8   -0.05        P.IIIANHDVAR.G
  8.8   -0.12        I.ILIILYFAR.N
  8.8    0.00        K.LLINEYQAR.V
  8.3    0.01        N.DSARMWLVK.L
  8.0    0.14        E.MTNNNPDSAR.E
  8.0    0.14        E.MTNNNPDSAR.E
Top scoring peptide matches to query 30
Score greater than 24 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.1    0.05        D.YNFNLKPTK.T
 14.1    0.05        D.YNFNLKPTK.T
 10.8    0.08        K.MFVKGEGLAGT.V
 10.6    0.07        I.GSVFTSEGITK.L
 10.0    0.08        T.KFNGMGEVVK.D
 10.0    0.17        V.QAENSATMQK.I
  8.3   -0.02        D.FKPKLTYTK.T
  7.7    0.14        K.KFTGNVDDTQ.A
  7.6   -0.02        K.NIIIPRGLTQ.K
  7.0    0.04        I.QELSHLNKR.N
Top scoring peptide matches to query 31
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.1    0.21        K.QIVTLNDDND.K
 15.7   -0.76        E.ENVDDSNNNK.I
 15.7   -0.76        E.ENVDDSNNNK.I
 14.9   -0.78        K.QNTKELNANN.S
 14.8    0.20        K.QNTKELNANN.S
 14.1   -0.77        K.EDLNLISDNN.R
 12.6    0.07        F.KNVSTFVPTR.N
  8.9    0.12        Y.QNVSTGSNITK.W
  8.0   -0.75        K.QDVSQDLDDD.D
  7.9    0.03        V.QPFVILIYR.E
Top scoring peptide matches to query 32
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.7    0.01        E.KPNLIPQIPK.I
 12.5    0.12        F.VGSPLMNSSIK.S
 12.2    0.08        S.ILNLTTAAMGK.T
 11.3    0.22        K.EDNLSLEVND.N
 10.6    0.10        R.RSPLLGGNPTH.R
 10.4    0.24        K.QDPQRESNSS.E
  9.9    0.19        -.EQTMAGSSIPQ.S
  9.8    0.09        L.ENGKLAPPPPK.R
  9.1   -0.76        K.EDNLSLEVND.N
  8.3    0.17        N.NEPSQKSETK.K
Top scoring peptide matches to query 33
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 45.7    0.07    6  19516.2 K.LGLTLPLTGNR.D
 28.4    0.09               K.GILTLPEEIIG.I
 14.4    0.01               R.RDLLSVLLLL.A
 13.5    0.09               R.ISSPIPSIQVI.Y
 13.0    0.14               E.GEPTLQPREK.V
 12.8    0.14               T.NNDAKILTHK.L
 12.8    0.14               T.NNDAKILTHK.L
 11.7    0.15               A.LIGVNTVMYK.L
 11.0    0.04               T.LLTDITLPIR.A
 10.6    0.14               K.THKININSIN.F
Top scoring peptide matches to query 34
Score greater than 19 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.1    0.12        K.SIGLGGNPNLIV.D
  8.1    0.12        K.SIGLGGNPNLIV.D
  6.2    0.12        R.SVALSLVEHTV.G
  6.1    0.09        V.SAKVVTWHVK.T
  2.2    0.20        K.KELEAVSYSQ.-
  2.1    0.10        G.QNTLIVRGPR.N
  1.6    0.14        V.AQQGLGPNIQK.D
  1.4    0.10        G.QNTLIVRGPR.N
  1.2    0.11        K.DGERLVGIPAK.R
  0.5    0.24        K.AGISGVCNTEF.M
Top scoring peptide matches to query 35
Score greater than 41 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 57.3    0.07    7  TRBOTR  TLNNDIMLIK
 25.8    0.10               T.TLDDIINELK.L
 24.7    0.13               R.TLNQNVLVESG.H
 22.5    0.06               L.ITLTQLIENK.Q
 22.5    0.18   17  12218.2 H.VNNNNNNDKK.T
 22.4    0.13               R.TLNQNVLVESG.H
 21.5    0.08               I.TNIQTLLDTR.D
 20.3    0.04               A.LTNTFPQIIK.C
 19.9    0.05               E.TNKITNELLK.L
 19.4    0.11               I.SQLNNLNNKK.S
Top scoring peptide matches to query 36
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.5    0.04        K.ISVVPISKFNT.V
 11.5    0.17        R.ANNVFNQVNGE.V
 11.1    0.12        K.KGNVTTNEGVVS.I
  9.9    0.09        A.WIVNFEELR.K
  9.8    0.02        Y.VEGLPAINKHK.V
  7.5    0.06        N.VAPLNTPLSHR.L
  7.2    0.15        S.ETFNFAPHSR.E
  7.2    0.09        K.VAQVTQVKHHG.K
  7.2    0.03        D.VSLVDYIQIR.N
  6.9    0.11        L.VTVVNSLLNDM.-
Top scoring peptide matches to query 37
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.5    0.32        R.NSTHNFNNMN.R
  6.3    0.17        K.QSLVYFPPMN.R
  4.9    0.23        R.KHENEEQQPA.E
  4.9    0.23        R.KHENEEQQPA.E
  4.7    0.20        K.NKINYNNTIN.N
  4.2    0.17        K.KAGYNTDDTLL.V
  4.1    0.15        K.KHEITPNPSTS.S
  4.0    0.18        L.QHEDQGLIDR.N
  4.0   -0.73        K.QMDFPVEDSQ.D
  3.8   -0.69        D.EEMDDEGDTR.K
Top scoring peptide matches to query 38
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.4    0.04        P.EAIQDIILGLK.Q
 12.4    0.29        R.LSICQADMEE.E
 11.1    0.04        F.ISIKGPEILNK.Y
 11.1    0.04        F.ISIKGPELLNK.Y
 11.1    0.01        T.LSKIITPLAQK.F
 10.5    0.04        P.VTVAAVSELPVK.T
 10.4    0.13        K.LSLKQCSYLT.D
  9.8    0.11        R.SIIKDLVNYF.K
  9.8    0.04        R.SILKNSQVPII.V
  9.8    0.04        R.SILKNSQVPII.V
Top scoring peptide matches to query 39
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 30.8    0.08    3  mALS1.5eoc QTSVDLTADGVK
 30.8    0.08                  T.QTSVDLTANGVK.Y
 25.0    0.18                  K.KTGGDASENGSGPG.T
 21.0    0.13                  R.QTPAHNPVASPN.R
 18.3    0.02                  I.KTWLLSTWAK.A
 14.0    0.12                  K.KTVDTVNSSDPA.V
  9.5    0.16                  R.KTCSILMENH.D
  8.5    0.12                  V.NNNAILNKNSK.S
  8.5    0.12                  V.NNNAILNKNSK.S
  8.3    0.14                  K.KTSNNDTPMPL.L
Top scoring peptide matches to query 40
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.6    0.06        K.DILELNNRFT.P
  4.5    0.13        K.FKFNFDSTQT.E
  4.4    0.15        -.QFFNSMAIYD.S
  3.9    0.06        K.DILELNNRFT.P
  3.6    0.10        Q.QKSDSNDSLNK.A
  3.0    0.06        K.QVDENIKNIY.Q
  3.0    0.25        N.NNNNNDDDNGK.N
  3.0    0.25        N.NNNNNDDDNGK.N
  3.0    0.25        N.NNNNNDDDNGK.N
  3.0    0.25        N.NNNNNNNNNGK.G
Top scoring peptide matches to query 41
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 44.3    0.09   12  mPga24 K.VITVVACDEHK.C
  6.7    0.15              T.LAEVEGSFCMK.L
  5.5    0.26              K.NPQQQQQQHQ.Q
  5.2    0.07              K.VLTILSNHGDTT.K
  4.8   -0.05              K.KIAKPKPPPTPP.T
  3.8   -0.00              R.IVLSQVNEIQK.H
  3.8    0.03              R.VIFAKLSASFTS.T
  3.4    0.11              R.SNQNIVVTKHE.A
  3.3    0.11              L.PDTAPEELDRK.T
  3.1    0.05              R.TPITSTSSALVPP.S
Top scoring peptide matches to query 42
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.8   -0.08        L.QTKFVHLSSNK.V
  2.4    0.02        D.QVNDNIDNGGIK.D
  2.2   -0.02        K.ISGGGIGSGVGNGQK.N
  1.4   -0.06        T.QTINARDQTIK.S
Top scoring peptide matches to query 43
Score greater than 20 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3   -0.00        S.QSLPDLSKAEGR.D
  6.8    0.09        Q.PVINEEEEENV.-
  6.5   -0.06        Q.DIIDKINQLTK.F
  4.4    0.06        Q.VQGQEQAQAQGR.S
  2.6   -0.06        K.RLSIAEVTLVQA.S
  2.5   -0.02        T.INTVKWTPEGR.R
  2.5    0.01        K.SKLANETVPENV.K
  2.1   -0.05        S.VLPMLKNAGDVK.Q
  1.6   -0.02        K.TNISLTPNPITK.E
Top scoring peptide matches to query 44
Score greater than 27 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.5    0.11        R.KDQVLQHLPPK.I
 13.6    0.11        R.RSPLLGGNPTHR.K
 11.1    0.16        I.SRPEGPPQAHTK.S
 10.2    0.23        R.EAQDKYDIPPQ.L
  9.9    0.13        I.KDPQGFFGPLAK.E
  9.8    0.13        E.LFQALDYIHGK.G
  8.8    0.19        V.QDPNEIMSILK.E
  8.8    0.09        L.KIVQIIYSNPK.S
  8.6    0.27        E.KDNHTDHDGHK.D
  7.7    0.18        E.FPDEYPSKPPK.V
Top scoring peptide matches to query 45
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.9    0.10        K.KDFIVENDEAE.S
 15.7    0.08        S.DMQLESNKSNK.G
 11.5   -0.02        R.LYNIELTSKQT.S
 11.1    0.08        P.QFDVTSQQGGNK.L
 10.4    0.05        R.TSMSPSISKASVN.K
  9.6    0.07        K.FLNKIDENVDT.L
  9.6    0.07        K.DQMLMPLLQGF.L
  9.6    0.07        R.QFDEIVEETIS.H
  9.2    0.04        L.KHHHHQLENK.I
  8.7    0.08        P.QFDVTSQQGGNK.L
Top scoring peptide matches to query 46
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.8    0.12        R.QGTNHEEIEML.L
  8.8    0.05        K.QGNSKNEVQAEI.I
  7.0   -0.05        K.STIVGWNSRIGK.W
  5.3    0.03        K.ESLDNIKDAEAL.F
  4.7    0.01        T.EGNLGKTEGNLGK.F
  4.3    0.04        T.WTNPKATNEEK.V
  3.2    0.13        DANTTSDDTYSK
  2.8    0.06        K.QGITSNPTNLSSP.L
  2.8   -0.06        K.MGLIQLMQQKK.T
  2.8    0.07        A.VDSTNEGPAWNK.F
Top scoring peptide matches to query 47
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 44.9    0.10    1  mALS3.5eoc L.TWSNAATYNYK.G
 13.3    0.11                  K.QGTSIAYDRYSG.V
 13.1   -0.04                  L.IFGGNAANVSKLK.N
 12.1    0.08                  E.TWSQGEVPETGK.T
 11.1    0.02                  R.SEASIAEAKVNSL.S
 10.4    0.14                  P.ADDVNNTDPNLK.R
  9.6    0.01                  N.TQSQNKIETLR.L
  9.2    0.02                  S.VTSNNSRNASIR.K
  8.4    0.02                  M.VCGQITRESIR.N
  8.2   -0.02                  N.VMGFINPGKSLR.K
Top scoring peptide matches to query 48
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.1    0.11    2  mCHT2 L.YWGQNGAGGQER.L
  6.4    0.09             P.ECFTTNYIFK.F
  4.6    0.06             Q.QQQHTAPAPNTK.S
  4.6    0.06             Q.QQQHTAPAPNTK.S
  4.6    0.06             Q.QQQHTAPAPNTK.S
  4.4    0.16             -.IMSMNFFNSSE.P
  4.2    0.08             K.QMINWNQFLQ.E
  4.1    0.05             R.LEAVLVANSENY.D
  4.0    0.04             E.LTGDNETEGFIK.S
  3.7    0.11    2  mCHT2 L.YWGQNGAGGQER.L
Top scoring peptide matches to query 49
Score greater than 23 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.9    0.12              A.QNALIEVQNKAK.Q
  9.6    0.09    5  8527.1 K.KTDDSAPITIVAK.F
  8.4    0.12              A.QNALIEVQNKAK.Q
  7.4    0.23              S.NSQSSSFTSSPTK.I
  6.5    0.24              Y.TQGFMLMNQAAK.D
  5.1    0.20              P.DGNGPNLVVDQTK.A
  4.5    0.16              Q.QSTNGTNLLPSPK.F
  4.1    0.28              F.TENCSQGYRNK.H
  3.8    0.15              K.QQIIGLDATRNQ.V
  3.4    0.37              K.NNNNSTDTMNSQ.Q
Top scoring peptide matches to query 50
Score greater than 42 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
103.9    0.10    5  8527.1 K.KTDDSAPITIVAK.F
 23.4    0.03              H.KALLEVSTSIGLK.T
 20.2    0.14              L.QNSVTPINNKIK.N
 18.8    0.23              L.DNNNASAALDQPK.R
 18.6    0.22              T.KTSDDHYGPNPK.V
 18.2    0.17              V.QTNDPAEIQTIK.L
 17.1    0.10              L.QSQVDELLKIGK.Q
 15.9   -0.75              L.DNNNASAALDQPK.R
 15.8    0.17              K.KQLTEDAIDPTQ.Q
 15.1    0.17              K.TQSIVPNQINKN.V
Top scoring peptide matches to query 51
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.0    0.03        K.SITFQNRNYLI.T
 11.9    0.22        K.QDGVEVNFESDE.T
  8.7    0.10        Q.LSFPEGFEMQGK.T
  8.5    0.08        R.YGTELAQMQSLI.S
  7.9   -0.02        K.FDISTILFTILS.K
  7.5    0.11        K.VYQTQFDSREP.T
  7.1    0.00        -.MSQYIGKTISLI.S
  6.8    0.23        K.NQSSSNNGTGSGGGSG.G
  6.6   -0.00        K.IVHPSTGSAFQLL.P
  6.6    0.03        K.SITFQNRNYLI.T
Top scoring peptide matches to query 52
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 43.7    0.11    3  mALS1.5eoc L.AYTNDYTCAGSR.S
 11.8    0.09                  K.MSTIAQHRDDTS.S
  7.5    0.01                  K.SMTIASRPQSRQ.P
  2.7    0.05                  R.EQLDDVNTKTTD.L
  2.0    0.02                  R.SFTKQQHGIGSTS.S
  2.0    0.02                  R.SFTKQQHGIGSTS.S
  1.9    0.07                  K.TFSTKQNSNYST.M
  1.9    0.07                  K.TFSTKQNSNYST.M
  1.9    0.07                  K.TFSTKQNSNYST.M
  0.1    0.01                  K.SMTIASRPQSRQ.P
Top scoring peptide matches to query 53
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 61.9    0.11    1  mALS3.5eoc N.EYTCAGGYWQR.A
 10.9    0.06                  D.QYGNSLIWNHR.-
 10.0    0.09                  K.GGFFTNGGYHGIY.R
  9.4    0.06                  I.DHVASDNYANKR.E
  6.9    0.14                  R.SAFNSMAEYDAAN.N
  4.0    0.12                  T.SNTSFSMISDER.Y
  3.4    0.05                  F.VFFCYPSNLSR.K
  2.3    0.08                  R.LLHQICAFNNC.L
  1.8    0.13                  S.SPYGGYGNSSMNR.Y
  1.6    0.15                  K.MKADYNDQEML.I
Top scoring peptide matches to query 54
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 60.8    0.11    1  mALS3.5eoc K.TCSSNGIFITYK.N
 11.7    0.07                  I.NANMSAITNLVDK.L
 10.3    0.13                  C.SSSSSFFPKDSSK.T
  9.1    0.13                  K.QKPKNNQNSNSK.T
  9.1    0.13                  K.QKPKNNQNSNSK.T
  9.1    0.13                  K.QKPKNNQNSNSK.T
  8.8    0.22                  N.NFNSSFNNNSSR.N
  7.4    0.13                  K.TPSSQSLPRSDSQ.S
  6.4    0.13                  S.NRQTLPNESSDK.Y
  6.4    0.13                  S.NRQTLPNESSDK.Y
Top scoring peptide matches to query 55
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.8    0.20        G.TSNNNPNTISSNK.F
 12.8    0.20        G.TSNNNPNTISSNK.F
 12.8    0.20        G.TSNNNPNTISSNK.F
 12.2    0.14        S.PQDSIISSKSSNK.S
 11.9    0.25        R.SSSSSSSSSSSSNSK.D
 10.5    0.25        S.SSSSSSSSSSGSSGSK.S
  8.7    0.14        D.SGQRPSTRSSSNK.K
  8.6    0.25        S.TENPQNEDISSR.G
  8.1    0.15        Q.IGQQLPFDGSSSR.T
  8.1    0.15        Q.IGQQLPFDGSSSR.T
Top scoring peptide matches to query 56
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.7    0.03        S.ALGMSLIGIDALNK.L
 14.2    0.00        A.VSISATTTPVTLSR.S
 13.7    0.09        I.SGETNTAVPVDITK.Y
 13.3    0.08        K.QSPVSSTGVDVSIR.D
 12.6    0.10        K.IASTWEGIQAARE.L
 11.1    0.09        E.LANEVKASEDLNK.E
 10.9    0.07        V.PPSIAQFSQTLDK.N
 10.9    0.07        V.PPSIAQFSQTLDK.N
 10.1    0.14        G.DDDGMPNLSILDK.V
  9.8    0.10        Q.EINRNNTDNLTK.V
Top scoring peptide matches to query 57
Score greater than 20 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3    0.11        K.DIPNRHLALEYL.V
  6.8    0.23        R.QSQSQSNSLITTC.S
  5.8    0.28        R.MKGLDNDWVSEC.V
  5.8    0.05        K.AIEVAIIRLGQEAA.S
  5.0    0.03        I.VLLGQAMQVPLIR.L
  4.9    0.23        R.QSQSQSNSLITTC.S
  3.1    0.08        N.LKNLTLYGGEFAK.S
  2.2   -0.76        R.QSQSQSNSLITTC.S
  2.2   -0.79        R.SQSFFHINFSNQ.L
  1.2    0.03        E.LLVGKPPFEAINR.N
Top scoring peptide matches to query 58
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 21.7    0.14    1  mALS3.5eoc K.NVPAGYRPFVDAY.I
  2.7   -0.67                  K.TIDMSYSNNNEY.L
  2.4   -0.68                  K.NVDDPHNYSNEY.Y
  1.2   -0.73                  K.DVYALGENESGQQG.N
  1.1    0.17                  Y.YNSTDQLTEIQR.I
  0.5   -0.78                  I.ITNHTSGSMDSYR.Y
  0.4    0.00                  K.LVGVPCAVATKQIL.S
  0.4    0.25                  R.NAMDNASKNAGDMI.N
Top scoring peptide matches to query 59
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8    0.09        K.KLQGDSSITTSHTP.G
  5.0   -0.08        D.KLILLTGLSNSIAK.L
  5.0    0.07        L.VAQELQDAGVEAIK.L
  4.9    0.10        M.PLDNTIQGSTIGGPT.A
  4.8    0.10        T.GGVSGNGSSNIPNRR.R
  4.7    0.10        D.LQYEFSEMLRR.M
  2.1    0.10        N.AASTTPEPKQEPSK.S
  2.0    0.23        S.NTNSNGNFVENMK.A
  1.8    0.01        W.GLAAIVETADSLRR.D
  1.0    0.17        Q.NTNIHPNNANMSK.R
Top scoring peptide matches to query 60
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6    0.13        R.KLFDTTTNTLLNE.K
  4.6    0.22        -.MTNEVQSVNNFPI.S
  4.6    0.09        K.KYNTVANPLPPSNP.V
  4.2   -0.00        V.HSRLLSLPNPHLK.F
  4.1    0.14        V.ESFINDTTVFNPK.R
  2.7    0.12        R.QQHESNVDIILTL.A
  2.5    0.24        V.QDDCSVQIMATNK.L
  2.5    0.20        K.STTNTSNTNNNTIK.N
  2.1    0.02        K.DLRPDLPVKNFVV.K
  2.1    0.20        K.STTNTSNTNNNTIK.N
Top scoring peptide matches to query 61
Score greater than 28 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 47.5    0.12   11  mPhr1 Y.IVADLSEPTVSINR.N
 12.5    0.27             K.VLNDLQSNDINHQ.S
 12.1    0.27             K.IVDAINDMGFDCK.L
 12.1    0.11             L.IVVSLGSGKAEYYK.Y
 11.9    0.08             F.ILVNTFLLSINHK.I
 11.3    0.25             T.PNSLNEGNSISSHR.E
 11.3    0.25             T.PNSLNEGNSISSHR.E
  9.9    0.26             K.IQRIQSWNDSYT.L
  9.2    0.19             R.SDDFPNILVLVSHG.I
  8.0   -0.71             K.VLNDLQSNDINHQ.S
Top scoring peptide matches to query 62
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 49.8    0.12    4  mRBT5 C.VMPQFAGAVGNCVAK.N
 44.4    0.12    4  mRBT5 C.VMPQFAGAVGNCVAK.N
 23.3    0.12             C.VMPQFGGAIGDCVAK.N
 13.8    0.01             V.FSVDPEKVLFALGK.T
 11.6    0.09             L.ITMSELKNGTTEPK.K
  9.5    0.14             L.SGSMSPQQRDNTIK.H
  7.9    0.16             Q.QNESSQLNGGGSNKK.R
  7.9    0.16             Q.QNESSQLNGGGSNKK.R
  6.3    0.03             P.ITGTTSNSSQLSILK.T
  5.3   -0.80             L.TQDEQNELDELSK.S
Top scoring peptide matches to query 63
Score greater than 20 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.1    0.30        R.KIQPANNNNNSNNN.N
  7.1    0.13        K.KLGANYAPCVKPQL.E
  7.1    0.30        K.DNVSSKDNNQHSVN.D
  7.1    0.30        K.DNVSSKDNNQHSVN.D
  7.0    0.12        L.TTKVGGLGVNLTGADR.V
  6.1   -0.70        R.KTTNHDDYISHND.S
  6.1    0.19        K.QIKSLNQTENQQQ.Q
  5.7    0.08        N.QSNILKQYQPIVK.Q
  5.7    0.11        E.KLLSAADLALEQCK.F
  5.4    0.30        R.KIQPANNNNNSNNN.N
Top scoring peptide matches to query 64
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.6    0.10        R.LYGVDCSQVEAVLK.A
Top scoring peptide matches to query 65
Score greater than 30 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.0    0.15        R.QADGAITPPPDLNTGI.A
 16.4    0.42        K.NDDNNNNNNGNDLQ.E
 16.2    0.18        K.QSLLDMENLFQLQ.N
 15.1    0.17        E.AQNQEYNMLLDIK.T
 13.9    0.17        E.AQNQEYNMLLDIK.T
 13.9    0.20        E.AAGEIQDYIDQDLK.K
 13.3    0.15        V.QALEADEKYDASLK.S
 12.3    0.21        R.AGDALWAQSGSFELQ.Q
 11.2    0.10        L.QSDGSISRQVVYLK.T
 11.0    0.19        L.GDSNLSSSTDQLARK.S
Top scoring peptide matches to query 66
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.9    0.08        K.FPTSAVTYYSTKAGT.P
  3.8    0.12        K.SLSSEQFPVANQQR.R
  2.7    0.10        R.SVEKSNPFANPITST.T
  1.5    0.17        L.ENQNKSEQETNLR.A
  0.9    0.05        E.DSVYLAKLAEQAER.Y
  0.9    0.15        S.SQSTQQNVASGAGSGGR.G
  0.9    0.15        S.SQSTQQNVASGAGSGGR.G
  0.9    0.15        S.SQSTQQNVASGAGSGGR.G
  0.9    0.13        K.ITSSLACDLPTNEAT.V
  0.8    0.14        N.FNTGGRQQQNQGVR.T
Top scoring peptide matches to query 67
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.9    0.14        K.LAESNDELNAVSFAN.L
  5.9    0.05        K.LAIDVLAGSVTKTMC.F
  4.6    0.06        M.INPQHNHAPDPINK.K
  2.4   -0.08        K.LTVVNKAVVEAELIP.G
  1.6   -0.09        R.KFFNISVVIVTLSK.M
  0.6   -0.03        R.PLNRLIQNEILNR.L
  0.6   -0.03        R.PLNRLIQNEILNR.L
  0.5    0.11        G.NPLDPNMQYDIFK.W
  0.5   -0.70        K.QGNFQHENVPDCM.E
  0.5    0.07        R.GSYQQINLSAREII.S
Top scoring peptide matches to query 68
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.7    0.17        R.NNGQAPPPQPQNGARG.F
  2.7    0.26        R.KFNVDCNSASSSSSN.P
  2.0    0.18        R.KLEPNMVVTNEPGC.Y
  1.8    0.04        -.QQFPLLIITMLRN.K
  0.2    0.13        R.NNEKPFGGIQIVACG.D
  0.1    0.29        K.KENNNNEVNHEMN.N
  0.0    0.31        K.NNWGQPGDELDDNE.V
Top scoring peptide matches to query 69
Score greater than 23 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3    0.02               K.KLEEVIIPDILPNI.S
  9.4    0.11               R.YIMPNQLLVSLANL.E
  8.5    0.21   17  12218.2 K.NDPIIVNGSTTTTNGT.N
  8.5    0.28               V.DEEDYQHANELIK.Q
  7.6    0.29               K.QQQHEQLGNGNSYT.R
  7.6    0.29               K.QQQHEQLGNGNSYT.R
  7.6    0.29               K.QQQHEQLGNGNSYT.R
  6.3   -0.76               K.MCMPLIAQENGVVQ.L
  5.6   -0.08               -.KLLLLSLLLIHAMK.K
  5.5   -0.76               K.MCMPLIAQENGVVQ.L
Top scoring peptide matches to query 70
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 34.6    0.12        K.CSGLNDLSCICTTK.N
 12.1    0.06        K.NNSLTDLSLLNFKM.E
  7.3   -0.01        K.GGQYKLLIMTFLDN.S
  6.4   -0.03        K.VRQGSLGGNIDSLAQL.N
  5.9   -0.02        Q.GGDVVDIVLNNLDTGK.H
  5.1    0.01        K.TFSCPYLLIMVER.S
  5.0    0.02        L.SLFGQNLCKDFATK.Y
  4.9   -0.04        S.FIMSATAPFKTLSAK.A
  4.8    0.14        R.SCNFFSSFCFLVN.N
  4.4    0.13        D.TEGDENLGFMNMIR.E
Top scoring peptide matches to query 71
Score greater than 25 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 51.0    0.11    9  mALS4.5f K.FITDQTSIDLVADGR.T
  9.5    0.25                R.SHHNGSNLPQDTNQV.A
  7.7   -0.68                S.TAEQRDNNNNNNNK.L
  7.4   -0.78                K.TAQSLWFPNENTEN.V
  5.7    0.13                K.LNPWMISSTFKPNV.N
  5.5   -0.76                V.GNGNNGRHHNQVTNK.N
  5.5   -0.76                V.GNGNNGRHHNQVTNK.N
  5.5   -0.68                S.TAEQRDNNNNNNNK.L
  5.3    0.25                K.QLNDENSDEKNTLQ.G
  5.3    0.25                K.QLNDENSDEKNTLQ.G
Top scoring peptide matches to query 72
Score greater than 20 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.0    0.34        K.YFYYGNHSDELSC.W
  7.1    0.23        QSQSQSNSLITTCSI
  6.2    0.23        QSQSQSNSLITTCSI
  6.2    0.23        QSQSQSNSLITTCSI
  6.1    0.23        QSQSQSNSLITTCSI
  5.5    0.28        K.TAQDEKEGTPISSGMS.K
  5.3    0.15        G.SSIFPVESNNRIYK.F
  5.1    0.32        I.SPPPPPASNNDDDNSK.R
  5.1    0.03        R.GPISQLIILLLNSSVS.K
  4.2    0.03        K.KLQINLVVEDALVSL.D
Top scoring peptide matches to query 73
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.2    0.13        K.YENGAVYLTDLEKF.T
  6.1   -0.00        K.VFYSGLIPSLFGLLH.V
  5.2    0.24        K.YCVLDEADTLFDDS.F
  4.0    0.12        M.ASQLEIIDLTNETTD.L
  3.4    0.15        R.AAYFDGDNASGKPLVH.L
  2.8    0.10        K.LEIHNPDMSLRSIH.T
  1.2    0.13        D.EDEEALKALQAEMGL.-
  1.1   -0.78        R.RIILGNSSNNNNNNN.N
  1.1    0.06        K.TIDFNYKSLVYVLS.L
  0.6    0.10        K.VFFASCAPPIRFNH.I
Top scoring peptide matches to query 74
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.0    0.07        K.SIVKNTNYLPSNVIN.K
 15.2    0.09        K.SEKTVQEDVLESSVK.K
 14.7    0.05        R.YQPEIKMLNLSNVK.Q
 12.9    0.18        A.VVQSTNEENNVNNSK.S
 12.9    0.06        M.SSAPATNYKVADISLAA.F
 12.8    0.16        D.LDAWTDDQIENMVK.W
 12.4    0.09        D.NSRSLDMDSIIAEVK.A
 11.7    0.19        V.INDSNNNNGDKMVNK.L
 11.4   -0.06        S.QVYGMLGLLKISIVK.R
 11.2    0.06        L.YIFGGHSRMMRPVK.Y
Top scoring peptide matches to query 75
Score greater than 20 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3   -0.72        E.QEQEEQQQSDNSTK.L
  8.3   -0.72        E.QEQEEQQQSDNSTK.L
  8.3    0.21        K.KNTIGEGEEDHEALH.Q
  8.3   -0.71        G.QQGNNNSSAWDNTDK.L
  6.9    0.22        K.MHLNFQENGTMKLD.S
  6.1   -0.71        G.QQGNNNSSAWDNTDK.L
  6.1   -0.71        G.QQGNNNSSAWDNTDK.L
  6.1   -0.71        G.QQGNNNSSAWDNTDK.L
  6.1   -0.71        G.QQGNNNSSAWDNTDK.L
  6.1   -0.71        G.QQGNNNSSAWDNTDK.L
Top scoring peptide matches to query 76
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
126.1    0.12    3  mALS1.5eoc K.YTTSQTSVDLTADGVK.Y
 37.2    0.11                  D.HDKTVTSVDISPDGSK.I
 12.7    0.14                  K.YTQDTNLMEGLKEK.L
 10.0   -0.04                  K.IALPAGITIALAQSALY.D
  8.4    0.15                  E.TYTYSSYNSKLETK.S
  8.1    0.13                  L.KPGLGQYYCIQCAK.Y
  7.6   -0.01                  M.VSKLLINVNLVLTEE.F
  7.5    0.08                  Y.SMLQLLMAVRYTDK.G
  7.4   -0.08                  R.LLLLQQQQILKTFV.S
  7.4   -0.08                  R.LLLLQQQQILKTFV.S
Top scoring peptide matches to query 77
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.7    0.09        D.SMQVYQKLDQITNK.H
 12.7    0.09        D.SMQVYQKLDQITNK.H
 11.8    0.08        K.AQMEQLNGVLLHLES.E
  9.4    0.07        C.IFMSGGQSRNGLLMR.L
  5.5    0.02        R.SSLSTGPSLAVLTHQLS.L
  5.4    0.06        R.SQYPGTLIITEATFAS.E
  4.8    0.20        R.GEGLVSSSEDEESSLSS.S
  4.2    0.17        R.SNFFLYSASSSSISDS.S
  4.2    0.18        T.TNMMTTQNLSSPESR.N
  4.0    0.08        R.GAPFTFNAQAFVNLIS.K
Top scoring peptide matches to query 78
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 55.1    0.11    8  mCrh11 F.GGDPYQWQSNYFIK.G
 12.0    0.08              I.NNKLNSFLQMFSNK.S
 12.0    0.08              I.NNKLNSFLQMFSNK.S
 11.6    0.17              E.DDEEEGEKSVQPPNK.K
  9.0    0.07              M.DNALINLNSEQNTQK.S
  9.0    0.07              M.DNALINLNSEQNTQK.S
  8.2    0.19              A.YDQNPMTSYPPMDK.S
  7.4    0.15              Y.DNFTQQFSDEETLK.Q
  7.4    0.15              Y.DNFTQQFSDEETLK.Q
  7.3    0.14              I.YYYKYSHQFSMGK.T
Top scoring peptide matches to query 79
Score greater than 38 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 92.3    0.12    5  8527.1 K.DGTLSFTGDDKVYASK.N
 19.6    0.09              K.NSPSSTPNSLNIGKSAK.L
 14.9    0.16              S.QSTNTKGSQTNSYASK.K
 14.5    0.11              K.DINWWTGIQDSIIAA.R
 12.5    0.09              K.NSPSSTPNSLNIGKSAK.L
 12.4    0.03              R.LCIWHGLNHIIISQ.N
 12.2    0.08              T.WAQSNKDWVNSLVR.D
 12.0    0.01              D.SSVLRLVSASDDLSVR.I
 10.8    0.15              H.NELDNGLDGHYSIVR.K
 10.4    0.23              R.QQQQQHNRNAMSSQ.L
Top scoring peptide matches to query 80
Score greater than 34 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 96.5    0.18    1  mALS3.5eoc F.STLTCTVSNTLTPSIK.A
 15.9    0.34                  R.SNNSNQFGNLTHYEP.N
 14.3   -0.73                  K.QNSISNIDSSMLLSPT.I
 13.4    0.19                  Q.SITNFIDMRTATPQK.G
 13.3    0.23                  Y.DQQMEMNSLTLSVVK.V
 13.3    0.23                  Y.DQQMEMNSLTLSVVK.V
 12.8   -0.65                  R.SNNSNQFGNLTHYEP.N
 12.8   -0.65                  R.SNNSNQFGNLTHYEP.N
 11.4    0.20                  C.KSSMILGNLWDVTDK.D
 11.3   -0.65                  R.SKSTNNMSNHNTSNVS.S
Top scoring peptide matches to query 81
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 73.5    0.13    1  mALS3.5eoc S.YANEYTCAGGYWQR.A
  9.4    0.06                  R.KQVGNIVENMIMSADG.L
  8.2    0.04                  S.LFHRSHHNGSNFQR.D
  7.9    0.01                  D.PNNNISTLDKSNHQR.N
  7.9    0.01                  D.PNNNISTLDKSNHQR.N
  7.9    0.01                  D.PNNNISTLDKSNHQR.N
  6.3    0.11                  R.YANPSDPLNTEASNLM.T
  5.1    0.14                  K.KNQEDQVEHHQEQS.N
  5.1    0.14                  K.KNQEDQVEHHQEQS.N
  5.1    0.06                  R.KQVGNIVENMIMSADG.L
Top scoring peptide matches to query 82
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
101.0    0.13    1  mALS3.5eoc Y.GDVQIDCSNIHVGITK.G
 17.3    0.09                  A.NKMNNTPVLVNLQPR.D
 16.9    0.06                  Y.GDNLLDLNLAYRIHK.L
 15.5    0.06   10  10894.2    S.INDGLDLINAIVEDLK.N
 13.4    0.15                  N.TTSKLNDPSFAMTPTK.Y
 12.8    0.15                  S.ALARNNEIDEDLPQR.Q
 12.8    0.09                  K.EAAKLPNDLTLDDVLQ.-
 11.3    0.11                  -.MSNYHLIILVHGVWG.N
 11.3    0.09                  A.NKMNNTPVLVNLQPR.D
 11.2    0.02                  A.SLAGALLLLTYIGCYK.V
Top scoring peptide matches to query 83
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 84
Score greater than 22 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.0    0.31        N.NNNNNNNNHKPNINK.L
  8.6    0.18        K.KGELLQESGHKPDGGMA.W
  8.3   -0.68        N.NNNNNNNNHKPNINK.L
  7.4    0.21        R.QQIPMNGLDPQQQQQ.M
  6.1    0.21        R.QQIPMNGLDPQQQQQ.M
  5.5    0.20        Y.NNIDNTIMKALFNDK.T
  4.8   -0.78        Y.NNIDNTIMKALFNDK.T
  3.7    0.24        K.VGWFVQGETRSQQCS.I
  3.7    0.24        K.VGWFVQGETRSQQCS.I
  3.6    0.13        R.ANAFRPPGSFIPGDPNL.P
Top scoring peptide matches to query 85
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 51.7    0.11    3  mALS1.5eoc K.YQNVPAGYRPFIDAY.I
 11.5    0.24                  K.YQNSQGWFSATPGGGES.F
 11.1    0.14                  R.FGSNPFPTASKDTLQY.L
  8.9    0.24                  R.YKSSDIMNQSPNELE.S
  7.2    0.03                  S.QGGYVFLYELVKQTK.N
  6.8    0.14                  K.YKNYSVINYLAFNY.A
  5.1    0.17                  K.KYFNAVNGMLDEQID.F
  4.8    0.16                  K.QYPNVMIDKEPFNY.E
  4.8    0.06                  K.CLLQILQSTLVPHSY.H
  3.5    0.24                  K.YQNSQGWFSATPGGGES.F
Top scoring peptide matches to query 86
Score greater than 22 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.5    0.12        V.SIGNELVNAGSATPSQIK.A
  8.4    0.16        K.QQQQQQSKPIEISKN.N
  7.9    0.30        K.YQYQGEEQNQQELQ.S
  6.1    0.24        K.QDLSSNFFLKNQDLN.E
  5.1    0.22        N.QIFSSFSLCDPENIK.Q
  4.7    0.35        R.AQGHTMQTSDESYAIE.N
  4.5   -0.79        K.EDLEQVQVQAEANSIN.S
  4.3    0.13        E.TFFQQLFNLQNRTK.I
  3.9    0.06        V.VFINKLNSQVVNWPK.T
  3.8    0.16        I.LEILNDDGNSLEAGAVR.D
Top scoring peptide matches to query 87
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
101.4    0.13    1  mALS3.5eoc L.SYANEYTCAGGYWQR.A
 13.2    0.05                  H.SLFHRSHHNGSNFQR.D
 11.8    0.03                  R.IQPPQYEMEEYILR.V
 11.8    0.03                  R.IQPPQYEMEEYLLR.I
  9.0    0.05                  H.SLFHRSHHNGSNFQR.D
  8.8    0.03                  R.IQPPQYEMEEYILR.V
  8.8    0.03                  R.IQPPQYEMEEYLLR.I
  8.5    0.02                  W.ASYNGATYYIDVFGKR.L
  8.1   -0.02                  S.SSESSSPLIKSSISSSSR.S
  8.1   -0.11                  N.NPVFLIKKPHSQDFR.L
Top scoring peptide matches to query 88
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.8    0.33        R.EHGMGAIMNGIAAFGANY.K
 13.6    0.11        K.DKINKPDLTEIIPSMK.S
 10.9    0.15        A.DPTITALIKEGDDNLAR.I
 10.2    0.21        L.ELINQLTIMYNETMK.L
 10.2    0.13        E.IEVEQLAQELGINQKK.L
 10.2    0.13        E.IEVEQLAQELGINQKK.L
 10.2    0.13        E.IEVEQLAQELGINQKK.L
  8.8    0.37        -.QSTGPKMPFQNDDCNS.E
  8.1    0.13        K.VTGNVKLNTLAPSIINGQ.L
  8.0    0.19        N.DLLQQIELWENFHR.G
Top scoring peptide matches to query 89
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 62.1    0.12    4  mRBT5 K.QSTSSTPCPYWDTGCL.C
 10.2    0.18             K.NSTTSTSTSNANGNGNGNGT.E
 10.2    0.18             K.NSTTSTSTSNANGNGNGNGT.E
 10.2    0.18             K.NSTTSTSTSNANGNGNGNGT.E
 10.2    0.18             K.NSTTSTSTSNANGNGNGNGT.E
  7.7    0.17             M.SSSSTNNTNNNNTSALNL.Q
  3.3    0.02             K.MLLSQCNLGSLLYMQA.E
  3.3   -0.14             T.VLATPTPALMMLLISEK.R
  1.9   -0.05             K.KHALSLMWAALMAACVA.A
  1.4    0.07             R.KAIHNQDDSEVSGLEQS.I
Top scoring peptide matches to query 90
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.4    0.09        K.NGSLHNVSQKSTPNSTTS.S
 10.4    0.09        R.SINSYNLSDFVNRMNS.N
 10.4    0.09        R.SINSYNLSDFVNRMNS.N
  9.8   -0.12        V.LINQPFSNDLLAYIIK.K
  8.3   -0.02        I.LNPGPVQSNYGSEYIPK.T
  6.0    0.14        K.FYIGGPGSTGNGNTGDSSSS.S
  4.4    0.07        F.YNDNQGNFKYQNLIK.V
  4.1    0.05        L.EGTNNEEDEETKNLIK.L
  3.8   -0.03        K.NQAHIYDNTREFLLK.G
  3.8   -0.03        K.NQAHIYDNTREFLLK.G
Top scoring peptide matches to query 91
Score greater than 13 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.0    0.06        E.ASEVFTNQPNAFVRGVR.S
  2.0   -0.71        R.RAPYPNNSDNESDDDSP.P
  0.8    0.17        M.SGNSRNTGISSLNNNRPT.A
  0.8    0.17        M.SGNSRNTGISSLNNNRPT.A
Top scoring peptide matches to query 92
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.0    0.02        T.DGITHSLANEVIMEGGKK.L
  5.4   -0.03        K.RVIVGAGAGAGAEAAFGIGAGGA.S
  3.7    0.23        I.NENNHLHNFQNDQDR.Y
  3.1    0.02        -.MPLYKEDNFLIIYPGS.K
  2.9    0.31        D.EDSNSNSGSSNYNDYSR.C
  2.9    0.10        S.RENSEPAHNTIVNNSSK.L
  2.9    0.10        S.RENSEPAHNTIVNNSSK.L
  2.8   -0.70        R.SSQMSSSPNNNPEADGGAM.F
  2.5    0.03        K.MPYINYPKIDISQSTI.S
  2.4    0.05        H.IYGINSVTIQPEFSNSK.K
Top scoring peptide matches to query 93
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
114.7    0.12    2  mCHT2 S.AAPQCPYPDASLGDLLSK.V
 23.4    0.13             S.AAGQVTVEMDAAPGVDLNK.I
 12.5    0.17             A.AANQSDRLNDGLNDGALR.S
 12.3    0.16             K.AAFQLDQELMSTGEFSI.D
  8.8    0.03             R.AANVATELTAAAPYELGKL.Y
  7.8    0.06             K.AANASVSTGEVSNVGNKIGK.I
  7.4    0.17             A.AANQSDRLNDGLNDGALR.S
  7.1    0.17             A.AANQSDRLNDGLNDGALR.S
  5.8    0.08             D.APYPVYDAPSPPPVFASK.E
  5.4    0.01             L.FLPLGPMEVSKIEAISR.T
Top scoring peptide matches to query 94
Score greater than 13 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.1    0.34        K.ENTKANFFEANMYLAE.D
  0.7    0.33        E.QEYEEYLDNLGKYNK.Y
  0.4    0.25        E.QEIATYRNLLEDQDAK.M
  0.3    0.25        E.QEIATYRNLLEDQDAK.M
Top scoring peptide matches to query 95
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.4    0.05               T.SVNTPTVNSIRSNNSSPR.L
  5.1    0.12    6  19516.2 K.NAVTYDGPVPNNEIPAVC.L
  3.2    0.06               T.TNNNNNNKQGVIVQTIR.N
  3.0    0.14               K.KAMNSNFNFLSDIQNLA.N
  1.1    0.05               R.DLGCGNGLLVHILISEGY.K
  0.9    0.05               K.MINIDTIVIENPLANIE.L
  0.6    0.09               K.EAHKASFEIDLPGAEMGK.V
  0.4    0.14               K.KAMNSNFNFLSDIQNLA.N
Top scoring peptide matches to query 96
Score greater than 16 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8    0.07        K.VNPVKLPMSTLETLNLY.Q
  2.9    0.19        P.QAITTVQQQQGQQQSQK.V
  2.6   -0.80        P.QAITTVQQQQGQQQSQK.V
  2.5    0.27        R.NSSYGGGSSVSSLQQFLPN.N
  2.3    0.17        F.QAIEGETPEQTMERVSK.D
  2.0    0.17        R.HHLKNNNNPNAFDLNLG.G
  2.0    0.17        R.HHLKNNNNPNAFDLNLG.G
  2.0    0.17        R.HHLKNNNNPNAFDLNLG.G
  2.0    0.17        R.HHLKNNNNPNAFDLNLG.G
  1.8   -0.74        R.AELQVFVNNYESSNFGN.Q
Top scoring peptide matches to query 97
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 92.9    0.13    2  mCHT2 SNQVALYWGQNGAGGQER
 78.2    0.13    2  mCHT2 SNQVALYWGQNGAGGQER
 45.1    0.13    2  mCHT2 SNQVALYWGQNGAGGQER
 10.6    0.13    2  mCHT2 SNQVALYWGQNGAGGQER
  6.8    0.07             L.TDIPWTNLGPGQRPPQR.R
  5.8    0.16             I.PMGITNENVANEFNIPR.E
  5.7    0.13    2  mCHT2 SNQVALYWGQNGAGGQER
  5.0    0.36             K.NEDADDNEGNEQSANSHS.G
  5.0    0.36             K.NEDADDNEGNEQSANSHS.G
  3.7    0.10             Y.TICTGQNPTGSSLSAERR.K
Top scoring peptide matches to query 98
Score greater than 23 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.4    0.23        T.SMKTESNITAAAWNENR.V
  9.6    0.11        S.SSNLPPVKLTSPGSNQANK.I
  9.6    0.11        S.SSNLPPVKLTSPGSNQANK.I
  9.6    0.11        S.SSNLPPVKLTSPGSNQANK.I
  8.8    0.23        T.SMKTESNITAAAWNENR.V
  3.6    0.17        K.NPSNESLFVSICRFDR.V
  1.1    0.06        K.LLLLINEQFLMKSFNT.N
  1.1    0.04        F.LIIQIFFQQETTFRR.S
  0.7    0.03        H.RLSIIPQDSQLLEGTIR.Q
  0.6    0.24        S.QACLETYKMNSGGPGGDR.F
Top scoring peptide matches to query 99
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 100
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8   -0.04        H.LPELNQPLIPQLRSAASK.C
  7.0   -0.01        R.GNLNIQGGIRCLLNLHLA.Q
  6.1    0.08        K.LIILRHGESQWNHENK.F
  5.2    0.16        K.EACYGGIRYVESLASSSQ.Y
  4.4    0.12        R.SNHLVQNLCVYADQSKV.K
  4.0    0.08        K.YTITTTTTQPNKSSLYSA.I
  3.8   -0.05        K.KIIYIYIYIPPFSSFL.F
  2.1    0.01        I.ILLIDNARMAVDDFNLK.Y
  1.3    0.02        M.YQFILYELSINQIGFK.K
  1.1    0.06        K.YAISFINGLINAVFTFQG.T
Top scoring peptide matches to query 101
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.9    0.06        R.EFIDPSKVNNCVGCNFI.S
  6.2    0.09        D.YDGLADMLSNANQDDKDK.S
  5.8    0.11        K.QEDGEFNGGILADEMGMGK.T
  5.4    0.06        R.EFIDPSKVNNCVGCNFI.S
  5.4    0.06        R.EFIDPSKVNNCVGCNFI.S
  4.6    0.01        L.DGDIADHTPMGSLSGGQLVK.V
  4.6   -0.05        K.NQQTKYGFQEVVTPLIF.K
  4.6   -0.05        K.NQQTKYGFQEVVTPLIF.K
  4.6   -0.05        K.NQQTKYGFQEVVTPLIF.K
  4.2    0.04        I.YNETIRDLLNPMTQCK.N
Top scoring peptide matches to query 102
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 74.2    0.13    4  mRBT5 K.QSTSSTPCPYWDTGCLC.V
  8.4   -0.03             R.NFELETNFIDADNAHLR.P
  8.4   -0.03             R.NFELETNFIDADNAHLR.P
  5.2    0.04             K.SYNTSMSASPLNRSGSSLC.T
  2.1   -0.06             -.MEFFSSSLILQAMRAIC.L
  1.6    0.06             R.QSFVSDSPNSSKVMNTLC.C
  0.2   -0.12             Y.MESNLRTIQILETIANR.I
Top scoring peptide matches to query 103
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
140.4    0.14    1  mALS3.5eoc Y.TLSYANEYTCAGGYWQR.A
 12.9    0.02                  M.ITQSQGYYNTPPPTSTKR.N
 12.9    0.02                  M.ITQSQGYYNTPPPTSTKR.N
 11.7    0.22                  L.NTMAESSPYGGYGNSSMNR.Y
 11.0   -0.06                  K.DFPRGTHIHVNNPIPLGR.G
 10.9   -0.06                  N.DYPARILIQNLQNINPR.D
 10.9   -0.06                  N.DYPARILIQNLQNINPR.D
 10.9   -0.06                  N.DYPARILIQNLQNINPR.D
 10.9   -0.06                  N.DYPARILIQNLQNINPR.D
 10.9   -0.06                  N.DYPARILIQNLQNINPR.D
Top scoring peptide matches to query 104
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.7    0.15        K.DTSSIGSNTTSTTNKSSAISS.P
  5.5    0.13        G.SFLMSFSQTNWQINLGR.L
  5.5    0.13        G.SFLMSFSQTNWQINLGR.L
  5.5    0.13        G.SFLMSFSQTNWQINLGR.L
  5.4    0.20        K.NLFGNLSMNTIEDANSTTS.M
  5.4    0.20        K.NLFGNLSMNTIEDANSTTS.M
  5.4    0.35        R.HNNNNNCNNINHYSQPS.Y
  5.4    0.17        K.ENIDPEPTKNVFENPSES.L
  5.3    0.07        S.SYQFGKLVELPESGSSYR.F
  5.3    0.19        R.SYPQFAEQQNGIYKQQD.A
Top scoring peptide matches to query 105
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.6   -0.01        N.YCVPIIFLFFFCFLGK.L
 12.8    0.06        H.GSTFNNSIELNTQASTSGLK.F
  9.6    0.06        H.GSTFNNSIELNTQASTSGLK.F
  9.6    0.06        H.GSTFNNSIELNTQASTSGLK.F
  8.8    0.06        L.YTEQLENNISMVQALVAK.K
  8.1    0.06        H.GSTFNNSIELNTQASTSGLK.F
  8.1    0.06        H.GSTFNNSIELNTQASTSGLK.F
  8.0    0.06        M.QNTSLKFNEFNLDQQLK.Y
  7.4   -0.07        Q.ALIQQIDYYFSLENLIK.D
  7.2   -0.08        N.KPVILIVNGTTLTSGANNEK.R
Top scoring peptide matches to query 106
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.8    0.18        K.NDIIVPSAGTDEEFDNSQAS.M
  5.8   -0.03        -.TYYKLAKPSNLSLAPPIMS.E
  5.7    0.02        R.LAQDFNIAIVIVNQVSDYS.F
  5.6    0.18        R.SASLQSLHSQSHQYPQGHN.N
  5.6    0.14        K.NGDDLPQEAFACQLISMIS.N
  5.6    0.03        K.SFLPMGDIVGTLLHELTHN.L
  5.6    0.15        R.QPMMYPPPQQQPLHSQNS.L
  5.6    0.15        R.QPMMYPPPQQQPLHSQNS.L
  5.6    0.15        R.QPMMYPPPQQQPLHSQNS.L
  5.6    0.15        R.QPMMYPPPQQQPLHSQNS.L
Top scoring peptide matches to query 107
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.2   -0.02        R.QPSNSINTNVNKVPSINSPY.V
  4.2   -0.02        R.QPSNSINTNVNKVPSINSPY.V
  3.1    0.00        K.IENIDGAWIANIGVDSNNPY.D
  2.8    0.13        -.SEGEDIDEYGFPKDSLDME.I
  2.7    0.00        K.IENIDGAWIANIGVDSNNPY.D
  2.4    0.10        K.FAPNYDIENPSDNTSTEFI.E
  1.9    0.15        R.NTSSSGDYNHQSRSIQNDY.G
  1.9    0.15        R.NTSSSGDYNHQSRSIQNDY.G
  1.9    0.15        R.NTSSSGDYNHQSRSIQNDY.G
  1.2    0.06        E.GSSSNLVDSSDAQNHLSVDDK.S
Top scoring peptide matches to query 108
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.10        R.QSTEALTQNRLMIVESEEI.V
  5.3    0.10        R.QSTEALTQNRLMIVESEEI.V
Top scoring peptide matches to query 109
Score greater than 17 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4   -0.77        K.VFVCMSGESRVMMDNFCM.V
  3.8   -0.03        R.NIPSRGFSGTVYFWGILGLM.S
  1.4    0.19        K.NLPTVDYNKIMESTDNNNE.N
  1.4   -0.80        K.NLPTVDYNKIMESTDNNNE.N
  1.2    0.22        H.HQQQQQPEQDSNLDQTER.E
  1.1    0.17        R.NGFETVTRNNLTDDENWST.C
  0.8    0.13        K.AGLHFAVAAGNENQDACNTSPA.S
  0.7    0.00        I.FKPEFDSDIKPIQSMLYR.A
  0.7    0.24        D.FVNRMNSNNNNDNNANVEK.N
  0.7    0.24        D.FVNRMNSNNNNDNNANVEK.N
Top scoring peptide matches to query 110
Score greater than 19 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.2    0.15        S.TTPSATGTPKPSATQVQLSQDR.A
  8.2    0.15        S.TTPSATGTPKPSATQVQLSQDR.A
  8.2    0.15        S.TTPSATGTPKPSATQVQLSQDR.A
  5.7    0.14        R.IVSAPPGTYTGKELPDIPSSMP.T
  5.2   -0.74        G.NVSNSSSSSSISMSPSGSATNKR.S
  4.9    0.28        S.PNSHHTMTDYYEPTFLFR.Q
  4.7   -0.71        K.VNSLNNTNGGSNGTNHSQGGKVD.D
  4.7    0.17        R.VLSHIIANSSEFSQTYSNLY.S
  4.3    0.25        S.PSDEQQQQQQQESQTQNLK.H
  4.3    0.25        S.PSDEQQQQQQQESQTQNLK.H
Top scoring peptide matches to query 111
Score greater than 26 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.3   -0.08        S.HTLANVPYVPVGTVQCQFKR.E
 12.7    0.22        R.NNNNIMNNENNPLSTSLSQTS.T
  9.4    0.26        R.NSTNSGNINVNNINNSNNNSNS.A
  9.4    0.26        R.NSTNSGNINVNNINNSNNNSNS.A
  9.4    0.26        R.NSTNSGNINVNNINNSNNNSNS.A
  9.4    0.26        R.NSTNSGNINVNNINNSNNNSNS.A
  9.4    0.26        R.NSTNSGNINVNNINNSNNNSNS.A
  9.4    0.26        R.NSTNSGNINVNNINNSNNNSNS.A
  9.4    0.26        R.NSTNSGNINVNNINNSNNNSNS.A
  9.4    0.30        K.SDDYNINGTSYISNNNNNNSS.S
Top scoring peptide matches to query 112
Score greater than 14 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8    0.16        R.GSVYCHPWPENSGWREQGSGS.R
  1.5   -0.64        K.YFSDNNNNDNNNNNDEPPPY.I
  1.3    0.09        K.SLLNNTISENNNNFHHFSKGS.G
  1.3    0.09        K.SLLNNTISENNNNFHHFSKGS.G
  1.3   -0.74        K.YTYMGEEQEGNNTNSFDQFS.S
  1.3   -0.74        K.YTYMGEEQEGNNTNSFDQFS.S
  1.2    0.12        R.ANGLMTERANSISNMSGAGSTYSG.S
  1.0   -0.64        K.YFSDNNNNDNNNNNDEPPPY.I
  1.0   -0.77        R.YGNDHNQPRNQSSSNSGNNGPM.-
  0.9   -0.04        Q.SGSPHINDHIMELLILISACR.G
Top scoring peptide matches to query 113
Score greater than 17 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.13        I.EKNIVHMTSDESSTNSNNSGNK.N
  4.6    0.05        A.AYNEPGELMMRILNPQDIEK.S
  4.5   -0.03        R.GKYSEVFQGVNVLNDEPCVIK.V
  3.4   -0.09        E.SQPVSSQPFDISVFIEIVAFGK.A
  3.2    0.15        R.VYGDGGVYGERFDDPASAYNNGA.T
  3.2    0.15        R.VYGDGGVYGERFDDPASAYNNGA.T
  3.1   -0.08        V.EYMINKIDQLSISEAIEIIR.D
  2.5    0.00        N.NNSNSNSMAILINLIFCNIPK.S
  2.5    0.00        N.NNSNSNSMAILINLIFCNIPK.S
  2.5    0.00        N.NNSNSNSMAILINLIFCNIPK.S
Top scoring peptide matches to query 114
Score greater than 13 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2    0.09        M.KIMMIPTHHQTYNINTHQPP.Q
  1.2    0.09        M.KIMMIPTHHQTYNINTHQPP.Q
  0.8    0.20        D.SPASGLISCSDSSSLESESSATSR.S
Top scoring peptide matches to query 115
Score greater than 23 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.9   -0.28        -.IPGIPLPPAMKTTFLQLRPAPLGS.P
 12.9   -0.00        K.LLFCSSSFSFNFYHPSYLINS.L
 12.9    0.04        R.SDYMIHQDTNEIKQIEFNTVS.V
 12.9    0.08        S.SMELEIDGALVEGSLNCCCLTGS.-
 12.9   -0.13        K.STSALTFEITNATIQGKAYVVETS.L
 12.9   -0.13        K.STSALTFEITNATIQGKAYVVETS.L
  9.9   -0.21        M.IVSAIIKLAYQYDQLLTSYLQS.N
  9.9   -0.08        K.NFCVTPLFFFCCPSGRPLLLS.P
  9.9    0.05        E.QSWLLQGNKGDEFAMLQCGCSS.-
  9.9    0.01        R.YENVDSGTYTMIAGIAFQVFSMS.V
Top scoring peptide matches to query 116
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0    0.08        R.YFTQGRGNGPSNLNSSTSAQFSTD.P
  2.5    0.08        K.LIQNNNNNNNNNQQQQQQHLI.M
  2.3    0.05        R.RDLPTGGNNNNNDMTPSAMLYIN.D
  2.2   -0.12        K.NIEPTAPSDKIPSIMPIQPFVLE.E
  2.1    0.08        K.LIQNNNNNNNNNQQQQQQHLI.M
  1.9    0.09        K.QLLQGVLNEDSWCSDSGDEGLSQ.V
  1.5    0.04        K.NVGYDFDLRVMQFFTEGLCPN.Y
  0.3   -0.11        I.PHGGFGLGFERLISYLAGYDNVR.D
  0.3    0.02        E.EVAALVIDNGSGMCKAGFAGDDAPR.A
  0.1    0.08        K.LIQNNNNNNNNNQQQQQQHLI.M
Top scoring peptide matches to query 117
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 118
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.6    0.31        I.NYNFYNNNNNNNSIGVGITFNSQK.F
  2.5    0.17        V.AGMASPIASPQNVIALESMNPNPGWGK.W
  2.5    0.17        V.AGMASPIASPQNVIALESMNPNPGWGK.W
  2.1    0.20        N.ANTNINTNSVNKSIGINTNNIEEFK.F
  1.7    0.20        N.ANTNINTNSVNKSIGINTNNIEEFK.F
  1.6   -0.68        I.NYNFYNNNNNNNSIGVGITFNSQK.F
  1.6    0.09        E.TIINYATRVMQDNFDVQLLLVER.N
  1.4    0.11        S.KFAQLTDEQTLTGISSNGLFTIDPR.L
  1.4    0.17        V.AGMASPIASPQNVIALESMNPNPGWGK.W
  1.4    0.17        V.AGMASPIASPQNVIALESMNPNPGWGK.W
Top scoring peptide matches to query 119
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.5    0.01        -.SFNYYVQIMTVESTNSFVVPAGTKQIEIAPLGS.T
  2.1    0.42        K.YNSINNNNDNDSIDKPNSNSNDSNNCSNSGINS.N
  1.7    0.20        N.SEFDSLNSMIYQFAQDNHIDVSESQITDDIK.N
  1.6    0.20        N.SEFDSLNSMIYQFAQDNHIDVSESQITDDIK.N
  1.6    0.17        R.QQQQQQQHQQPQSQQMSQISQLSQQIPPQGS.S
  1.5    0.13        E.SESFTKFSYQAIEQYMDNYLSMNQIPTINK.D
  1.5    0.13        E.SESFTKFSYQAIEQYMDNYLSMNQIPTINK.D
  1.5    0.42        K.YNSINNNNDNDSIDKPNSNSNDSNNCSNSGINS.N
  1.5    0.02        I.SSSQFGSILPFNFGTSSHTDVSNFASIISNALFK.Y
  1.5    0.06        I.SMCYTQSELLANNIILIELLQYYHDLSSMK.H
Top scoring peptide matches to query 120
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1    0.22        R.GQGSGSRSSLGQSQSQSQSQGQSQGQSQGQGQSQSQSQSQS.Q
  4.0   -0.04        K.YIEGNYDGAILTGKSQGSVMFGLILTICNFGLTVMDSS.F
  4.0   -0.14        R.QDDEFSSSALQQTVAKVIPALASNGLSPVNNEIEFLLAS.F
  4.0   -0.14        R.QDDEFSSSALQQTVAKVIPALASNGLSPVNNEIEFLLAS.F
  4.0   -0.14        R.QDDEFSSSALQQTVAKVIPALASNGLSPVNNEIEFLLAS.F
  4.0   -0.14        R.QDDEFSSSALQQTVAKVIPALASNGLSPVNNEIEFLLAS.F
  2.1    0.76        P.SLLYNSNNGLIEDLRTFFLISISQTYNSPIQVTTIK.Y
  2.1    0.76        P.SLLYNSNNGLIEDLRTFFLISISQTYNSPIQVTTIK.Y
  2.1   -0.23        P.SLLYNSNNGLIEDLRTFFLISISQTYNSPIQVTTIK.Y
  2.1   -0.23        P.SLLYNSNNGLIEDLRTFFLISISQTYNSPIQVTTIK.Y
Top scoring peptide matches to query 121
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 122
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5    0.03        R.NDYSQSSSMLLNDQPQQTIQEGSISTTSSAIIVGIPHPES.N
  1.5    0.76        E.SILDELQNDNDKVNLFNNLYSIQSSIIWIIVNLTWK.Y
  1.5    0.11        K.MIDQLSIAVNSTNSQQQQQQQGQQAQQQQQQQQQTQS.V
  1.3    0.36        K.SNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNTIKTNS.H
  1.2    0.11        K.MIDQLSIAVNSTNSQQQQQQQGQQAQQQQQQQQQTQS.V
  1.1   -0.16        K.LINETNAIMLDNNLYFFDLLNALIMNTVSTLTANLSFS.L
  1.0    0.00        K.DQTLQEILSLHTPNLSSSSSSMSHPYIQGIDVTSLMNQS.I
  0.9    0.15        M.SESDQLNSTNNTGNTFISLDQASTIMADQTQGGNPQQVMS.L
  0.9    0.06        K.QHTLTSLTNIKDHSSLLNSSNSNTNSNTNGTIASNGGNGTTS.D
  0.5   -0.16        K.LINETNAIMLDNNLYFFDLLNALIMNTVSTLTANLSFS.L
Top scoring peptide matches to query 123
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.5    0.24        S.NPNFMQQAMNMLGGAGGGAGGAGGLAGMMNNPAMMQQAQQMMR.S
  6.5   -0.74        S.NPNFMQQAMNMLGGAGGGAGGAGGLAGMMNNPAMMQQAQQMMR.S
  4.7    0.24        K.SAMAAQGGQPGQPGNPMANNPQMQRMMQQAQSNPNFMQQAM.N
  4.7    0.24        K.SAMAAQGGQPGQPGNPMANNPQMQRMMQQAQSNPNFMQQAM.N
  4.7    0.24        K.SAMAAQGGQPGQPGNPMANNPQMQRMMQQAQSNPNFMQQAM.N
  4.7    0.24        K.SAMAAQGGQPGQPGNPMANNPQMQRMMQQAQSNPNFMQQAM.N
  4.7    0.24        K.SAMAAQGGQPGQPGNPMANNPQMQRMMQQAQSNPNFMQQAM.N
  4.1   -0.23        R.ENLDFFQHLFRNWYFITIALIIGGFQILIMFVGGAAFS.I
  3.9   -0.20        R.NSILVQLLNIRALINHDQLIIFDNSSSFQNSHVSSYTHS.Q
  3.9   -0.20        R.NSILVQLLNIRALINHDQLIIFDNSSSFQNSHVSSYTHS.Q
Top scoring peptide matches to query 124
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.9    0.13        V.ANYEIINNNKANQNQMNDINEHTDLCHHQWYSFSIGK.Q
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S
  8.9    0.28        K.QGSRYGIDPWTNNSSDNENNANNNANNNNNNNENEQNIPS.S