Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0307_q3.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 22 Mar 2007 at 13:27:30 GMT
Significant hits: mALS3.5eoc  |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mALS1.5eoc  |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  TRBOTR      trypsin (EC3.4.21.4 ) precursor-bovine
                  mCHT2       583 aa - chitinase 2 precursor Candida albicans
                  mRBT5       |predicted| C. albicans fungus|CA2558| 241 aa
                  8527.1      |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
                  12297.1     CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
                  12997.2     |Als10| CONTIG=Contig10147 POSCDS1=2941 POSCDS2=7701
                  2663.2      |Als6| CONTIG=Contig2514 POSCDS1=42108 POSCDS2=46208
                  mALS4.5f    |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
                  mSSR1       |Candida albicans 212 aa - Secretory Stress Response
                  9099.2      CONTIG=Contig10161 POSCDS1=58201 POSCDS2=59367
                  25992.1     CONTIG=Contig20110 POSCDS1=14783 POSCDS2=14974
                  10840.2     CONTIG=Contig10132 POSCDS1=26166 POSCDS2=27185
                  11835.3     CONTIG=Contig20204 POSCDS1=19727 POSCDS2=21805
                  10894.2     CONTIG=Contig20161 POSCDS1=8470 POSCDS2=9315
                  19516.2     |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 43 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mALS3.5eoc                        Mass: 94266    Score: 789    Queries matched: 12
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   352.70   703.38   703.40   -0.02 0  32  0.74 1  R.APFTLR.W
 9   448.22   894.42   894.41   0.01 0  2  5.7e+002 4  L.NMPCVFK.F
22   564.81   1127.61   1127.58   0.04 0  70  9.8e-005 1  D.CSNIHVGITK.G
41   711.90   1421.79   1421.71   0.08 0  65  0.00033 1  L.TCTVSNTLTPSIK.A + Deamidation (NQ)
44   734.90   1467.79   1467.71   0.07 0  18  17 1  K.NVPAGYRPFVDAY.I
55   834.96   1667.90   1667.83   0.07 0  29  1.5 1  K.NVPAGYRPFVDAYIS.A
59   862.53   1723.05   1722.87   0.18 0  83  8.8e-006 1  F.STLTCTVSNTLTPSIK.A + Deamidation (NQ)
60   878.47   1754.93   1754.86   0.07 0  115  3.4e-009 1  Y.GDVQIDCSNIHVGITK.G
66   913.42   1824.83   1824.75   0.08 0  93  4.7e-007 1  L.SYANEYTCAGGYWQR.A
68   921.00   1839.98   1839.92   0.07 0  14  46 1  K.NVPAGYRPFVDAYISAT.D
84   1020.49   2038.96   2038.88   0.08 0  131  7.8e-011 1  Y.TLSYANEYTCAGGYWQR.A
89   1047.51   2093.00   2092.94   0.07 0  148  1.6e-012 1  K.GLNDWNYPVSSESFSYTK.T

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 785    Queries matched: 12
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 785    Queries matched: 12
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928

2.    mALS1.5eoc                        Mass: 69052    Score: 471    Queries matched: 8
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 9   448.22   894.42   894.41   0.01 0  2  5.7e+002 4  L.NMPCVFK.Y
21   561.80   1121.59   1121.54   0.05 0  18  19 1  K.TCTSNGIQIK.Y + Deamidation (NQ)
31   617.35   1232.68   1232.62   0.05 0  109  1.3e-008 1  S.QTSVDLTADGVK.Y
34   656.35   1310.69   1310.64   0.05 0  35  0.34 1  K.YQNVPAGYRPF.I
56   843.45   1684.89   1684.82   0.07 0  68  0.00019 1  K.YTTSQTSVDLTADGVK.Y
63   887.47   1772.93   1772.85   0.07 0  41  0.088 1  K.YQNVPAGYRPFIDAY.I
 89   1047.51   2093.00   2092.94   0.07 0  148  1.6e-012 1  K.GLNDWNYPVSSESFSYTK.T
97   765.06   2292.16   2292.07   0.10 0  60  0.001 1  M.GFSSSNGDVAIDCSNIHIGITK.G + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      13002.2                           Mass: 133694   Score: 467    Queries matched: 8
 |Als1| CONTIG=Contig10233 POSCDS1=72223 POSCDS2=76005
      21498.1                           Mass: 133402   Score: 467    Queries matched: 8
 |Als1| CONTIG=Contig20233 POSCDS1=71475 POSCDS2=75257
3.    TRBOTR                            Mass: 24662    Score: 305    Queries matched: 8
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
20   559.29   1116.56   1116.52   0.04 0  29  1.3 1  K.SIVHPSYNSN.T
25   587.85   1173.68   1173.64   0.04 0  93  5.2e-007 1  N.TLNNDIMLIK.L
36   666.36   1330.71   1330.65   0.06 0  30  1.1 1  K.SIVHPSYNSNTL.N
45   745.91   1489.80   1489.73   0.07 0  52  0.0065 1  K.LQGIVSWGSGCAQK.N
79   974.56   1947.11   1946.92   0.19 0  57  0.0027 1  R.LGEDNINVVEGNEQFISA.S
91   1082.06   2162.11   2162.05   0.06 0  13  50 1  R.LGEDNINVVEGNEQFISASK.S
 95   1137.11   2272.21   2272.15   0.06 0  (11) 96 2  K.SIVHPSYNSNTLNNDIMLIK.L
96   758.76   2273.25   2273.14   0.11 0  38  0.18 1  K.SIVHPSYNSNTLNNDIMLIK.L + Deamidation (NQ)

4.    mCHT2                             Mass: 59565    Score: 303    Queries matched: 5
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   495.29   988.57   988.54   0.03 0  42  0.067 1  K.LSSAIEEIK.C
18   545.82   1089.62   1089.58   0.04 0  20  9.8 1  T.GYPELATALR.G
58   860.91   1719.81   1719.72   0.09 0  86  2.5e-006 1  Y.CSINGQFNYDTWSK.F + Deamidation (NQ)
74   952.00   1901.98   1901.92   0.07 0  108  1.7e-008 1  S.AAPQCPYPDASLGDLLSK.V
76   968.49   1934.96   1934.89   0.07 0  51  0.0079 1  -.SNQVALYWGQNGAGGQER.L + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 302    Queries matched: 5
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
      19719.2                           Mass: 51350    Score: 302    Queries matched: 5
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
5.    mRBT5                             Mass: 22745    Score: 293    Queries matched: 5
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   547.30   1092.58   1092.54   0.04 0  45  0.032 1  Q.FAGAVGNCVAK.N
32   618.83   1235.64   1235.59   0.06 0  37  0.21 1  R.IYDQLPECAK.E
48   774.92   1547.83   1547.76   0.07 0  75  3.8e-005 1  C.VMPQFAGAVGNCVAK.N
70   930.42   1858.82   1858.75   0.07 0  69  0.00012 1  K.QSTSSTPCPYWDTGCL.C
83   1010.44   2018.86   2018.78   0.08 0  70  0.00012 1  K.QSTSSTPCPYWDTGCLC.V

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 293    Queries matched: 5
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 293    Queries matched: 5
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
6.    8527.1                            Mass: 21461    Score: 277    Queries matched: 5
 |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   453.26   904.51   904.50   0.01 0  17  23 4  K.QIFQELK.T
35   659.35   1316.69   1316.62   0.07 1  13  56 1  L.SFTGDDKVYASK.N
37   679.91   1357.81   1357.75   0.06 1  109  1.5e-008 1  K.KTDDSAPITIVAK.F
38   695.40   1388.78   1388.73   0.05 0  62  0.00068 1  L.GATDNFIPVTINK.D
90   1062.08   2122.14   2122.06   0.08 0  80  1.1e-005 1  L.GGDVYELGATDNFIPVTINK.D

 
      Proteins matching the same set of peptides:
      mIPF8527|mPga29:                  Mass: 19928    Score: 277    Queries matched: 5
 189 aa - Candida albicans unknown function
      21875.1                           Mass: 22824    Score: 277    Queries matched: 5
 CONTIG=Contig20225 POSCDS1=30286 POSCDS2=30900
7.    12297.1                           Mass: 15525    Score: 160    Queries matched: 3
 CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 32   618.83   1235.64   1235.59   0.06 1  21  8.9 3  R.IYDQIPKCAQ.E + Deamidation (NQ)
 70   930.42   1858.82   1858.75   0.07 0  69  0.00012 1  K.QSTSSTPCPYWDTGCL.C
 83   1010.44   2018.86   2018.78   0.08 0  70  0.00012 1  K.QSTSSTPCPYWDTGCLC.V

 
      Proteins matching the same set of peptides:
      24214.1                           Mass: 16067    Score: 160    Queries matched: 3
 CONTIG=Contig20166 POSCDS1=63254 POSCDS2=63697
8.    12997.2                           Mass: 170199   Score: 108    Queries matched: 3
 |Als10| CONTIG=Contig10147 POSCDS1=2941 POSCDS2=7701
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 9   448.22   894.42   894.41   0.01 0  2  5.7e+002 4  L.NMPCVFK.F
 31   617.35   1232.68   1232.62   0.05 0  109  1.3e-008 1  D.QTSVDLTADGVK.Y
 95   1137.11   2272.21   2273.00   -0.79 0  6  2.8e+002 10  R.EPPNPTVTTTEYWSQSYTTA.T + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      24952.1                           Mass: 171388   Score: 108    Queries matched: 3
 CONTIG=Contig20147 POSCDS1=2941 POSCDS2=7707
9.    2663.2                            Mass: 143308   Score: 106    Queries matched: 1
 |Als6| CONTIG=Contig2514 POSCDS1=42108 POSCDS2=46208
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 31   617.35   1232.68   1232.62   0.05 0  109  1.3e-008 1  T.QTSVDLTANGVK.Y + Deamidation (NQ)

10.   mALS4.5f                          Mass: 167909   Score: 106    Queries matched: 1
 |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
54   825.96   1649.90   1649.83   0.07 0  106  2.9e-008 1  K.FITDQTSIDLVADGR.T

 
      Proteins matching the same set of peptides:
      13010.2                           Mass: 169769   Score: 104    Queries matched: 1
 |Als4.5'| CONTIG=Contig2201 POSCDS1=7312 POSCDS2=12093
11.   mSSR1                             Mass: 20690    Score: 81     Queries matched: 1
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
52   814.90   1627.79   1627.70   0.09 0  81  7.8e-006 1  K.CSGLNDLSCICTTK.N

 
      Proteins matching the same set of peptides:
      3054.1                            Mass: 22993    Score: 81     Queries matched: 1
 |Ssr1| CONTIG=Contig10262 POSCDS1=71490 POSCDS2=72194
12.   9099.2                            Mass: 43307    Score: 47     Queries matched: 1
 CONTIG=Contig10161 POSCDS1=58201 POSCDS2=59367
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   514.33   1026.65   1026.60   0.06 0  47  0.024 1  L.PSIDIELLK.Q

 
      Proteins matching the same set of peptides:
      24490.1                           Mass: 47507    Score: 47     Queries matched: 1
 CONTIG=Contig20161 POSCDS1=58261 POSCDS2=59427
13.   25992.1                           Mass: 6941     Score: 47     Queries matched: 1
 CONTIG=Contig20110 POSCDS1=14783 POSCDS2=14974
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   514.33   1026.65   1026.63   0.02 0  47  0.024 1  R.VILSLELIQ.S

14.   10840.2                           Mass: 37010    Score: 45     Queries matched: 1
 CONTIG=Contig10132 POSCDS1=26166 POSCDS2=27185
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   514.33   1026.65   1026.63   0.02 0  47  0.024 1  A.TIPTLQLLK.N + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      25488.1                           Mass: 37010    Score: 45     Queries matched: 1
 CONTIG=Contig20132 POSCDS1=26725 POSCDS2=27744
15.   11835.3                           Mass: 81802    Score: 45     Queries matched: 1
 CONTIG=Contig20204 POSCDS1=19727 POSCDS2=21805
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   514.33   1026.65   1026.67   -0.01 0  47  0.024 1  F.IVTVLELIK.R

 
      Proteins matching the same set of peptides:
      28414.1                           Mass: 81914    Score: 45     Queries matched: 1
 CONTIG=Contig10204 POSCDS1=19721 POSCDS2=21799
16.   10894.2                           Mass: 32947    Score: 45     Queries matched: 2
 CONTIG=Contig20161 POSCDS1=8470 POSCDS2=9315
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   514.33   1026.65   1026.58   0.07 0  35  0.36 8  N.NIQGLNQLK.T
 60   878.47   1754.93   1754.93   0.00 0  10  1.1e+002 9  S.INDGLDLINAIVEDLK.N + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      10895.3                           Mass: 37579    Score: 45     Queries matched: 2
 CONTIG=Contig10161 POSCDS1=8479 POSCDS2=9324
17.   19516.2                           Mass: 94340    Score: 44     Queries matched: 1
 |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   521.79   1041.56   1041.52   0.03 0  46  0.021 1  R.HQDFVPATK.I

 
      Proteins matching the same set of peptides:
      mIPF19516                         Mass: 90303    Score: 44     Queries matched: 1
 |mHYR1| validated by us| C. albicans fungus|CA1576| 900 aa
      19734.1                           Mass: 94169    Score: 44     Queries matched: 1
 |Hyr1| CONTIG=Contig20216 POSCDS1=152490 POSCDS2=155303
      m19734.1                          Mass: 91992    Score: 44     Queries matched: 1
 |mHyr1| validated by us| C. albicans fungus 917 aa
18.   1801.1                            Score: 43     Queries matched: 1
 CONTIG=Contig10216 POSCDS1=204501 POSCDS2=206183
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   514.33   1026.65   1026.64   0.01 1  47  0.024 1  G.VNKAIQLLK.D + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      22249.1                           Score: 43     Queries matched: 1
19.   921.1                             Score: 43     Queries matched: 1
 CONTIG=Contig2518 POSCDS1=69549 POSCDS2=73868
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   514.33   1026.65   1026.60   0.06 0  47  0.024 1  T.NSPLLELLK.F + Deamidation (NQ)

20.   6242.2                            Score: 42     Queries matched: 1
 CONTIG=Contig10119 POSCDS1=23813 POSCDS2=28810
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   514.33   1026.65   1026.64   0.01 1  47  0.024 1  E.NGKLLELLK.I

 
      Proteins matching the same set of peptides:
      25829.1                           Score: 42     Queries matched: 1
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   375.21   748.41   748.42   -0.01 1  30  1.1 1  FLGEKR
6   417.25   832.48   832.47   0.01 0  27  2.3 1  IPYINTI
7   436.27   870.52   870.55   -0.03 1  23  3.7 1  KQIEILK
64   890.97   1779.92   1779.83   0.08 0  22  6.5 1  SSDCSPVPALGSSFLEK
87   1027.00   2051.99   2052.05   -0.06 0  22  6.8 1  SLSALPFSYLFPNAILNPS + 2 Deamidation (NQ)
40   701.95   1401.89   1401.71   0.18 0  20  14 1  INEVENISESLR
5   406.24   810.46   810.35   0.11 0  20  7.9 1  YENGSNK
10   453.26   904.51   904.57   -0.06 1  19  14 1  KLISGFIK
57   846.42   1690.83   1690.87   -0.04 1  19  14 1  ELLNMKESNLEIIK + 2 Deamidation (NQ); Oxidation (M)
65   895.47   1788.93   1788.82   0.11 0  18  19 1  LNNIGMDNVLANDVGVD + Deamidation (NQ); Oxidation (M)
49   780.47   1558.92   1558.80   0.12 1  17  27 1  KLPMVNLNETEVR + Deamidation (NQ); Oxidation (M)
62   883.45   1764.88   1764.83   0.06 1  17  23 1  STEVLTNKEDNSNLAK + 3 Deamidation (NQ)
12   500.08   998.15   997.39   0.77 0  16  39 1  STNFALNDD + 2 Deamidation (NQ)
8   441.80   881.58   881.46   0.12 0  16  28 1  LQGPDQPK
43   728.41   1454.81   1454.81   0.00 1  16  31 1  LRSEVLLQQQLQ + Deamidation (NQ)
29   606.87   1211.73   1211.64   0.09 0  15  32 1  VVDKPTTANIGP + Deamidation (NQ)
13   500.33   998.64   999.42   -0.78 0  14  38 1  VSAMESQFT + Deamidation (NQ)
26   594.31   1186.60   1186.53   0.07 1  12  58 1  KAMNSNFNFL + 2 Deamidation (NQ)
98   1188.53   2375.05   2375.06   -0.01 1  12  60 1  QDEVFYNPIQQFNRDLSIM + 3 Deamidation (NQ); Oxidation (M)
14   501.79   1001.57   1001.54   0.03 0  12  61 1  ASIENVIEK
33   650.83   1299.64   1299.69   -0.05 0  12  59 1  TNISLTPNPITK + 2 Deamidation (NQ)
95   1137.11   2272.21   2272.99   -0.78 0  12  71 1  EQNVDANQIGNSDEDPTNSLL + Deamidation (NQ)
39   696.86   1391.70   1391.68   0.02 1  12  72 1  PQDSIISSKSSNK + 2 Deamidation (NQ)
23   574.85   1147.68   1147.59   0.09 0  11  86 1  VGSPLMNSSIK + Oxidation (M)
103   977.85   2930.54   2930.40   0.13 1  11  86 1  NTFSPCRIIQFNFSNVTIISPIDASS + 3 Deamidation (NQ)
9   448.22   894.42   894.53   -0.11 1  11  79 1  NKIPVPAR + Deamidation (NQ)
69   921.53   1841.05   1840.89   0.16 1  11  1.2e+002 1  VAVSSKYQTADNLVQSM + Deamidation (NQ)
94   1117.02   2232.03   2232.11   -0.08 1  10  94 1  TELMFSEMVKEITGDYVIK
51   797.92   1593.82   1593.72   0.10 0  10  1e+002 1  LAESNDELNAVSFAN + Deamidation (NQ)
15   505.77   1009.53   1009.44   0.10 1  10  94 1  QSNEKQMK + 2 Deamidation (NQ); Oxidation (M)
100   1266.54   2531.06   2530.38   0.68 1  10  1.2e+002 1  ALSGENTYAIIAISNTPSLIIRGR + Deamidation (NQ)
2   590.67   589.67   590.30   -0.64 0  9  2.9e+002 1  QGASTK
53   822.42   1642.83   1642.85   -0.03 1  9  1.4e+002 1  DVSTRINPLGNTLNK + 2 Deamidation (NQ)
24   577.87   1153.72   1153.58   0.14 1  8  1.8e+002 1  NKQSIISMFS
110   1476.96   4427.87   4427.20   0.67 0  8  1.4e+002 1  EHNPHIEALLDMETLNLILQEPQQLGLNDSHIEFLISF + Deamidation (NQ); Oxidation (M)
42   716.88   1431.75   1431.70   0.06 1  7  1.9e+002 1  IASTWEGIQAARE + Deamidation (NQ)
107   1368.94   4103.80   4103.89   -0.09 0  7  1.7e+002 1  TPNPLQTPLAMQSAQEYPFTVNNNNSNLNSPTTAPQVS + 3 Deamidation (NQ); Oxidation (M)
99   1189.05   2376.09   2376.22   -0.13 1  7  2.2e+002 1  EQHKVFEKPMYLPLLFVNSG + Deamidation (NQ)
92   1088.48   2174.96   2174.98   -0.03 1  6  2.4e+002 1  PQQSNDDGSTPLQKVTSQNK + 4 Deamidation (NQ)
82   1007.46   2012.90   2012.96   -0.06 1  6  2.8e+002 1  TEPNNNNTSKLTPIQAAAGA + 2 Deamidation (NQ)
75   636.72   1907.12   1906.96   0.16 1  6  4.2e+002 1  KTVLPLESTNNTDSFNK
78   648.01   1941.00   1940.74   0.26 1  6  2.9e+002 1  TSDMNNRNSSINNNNNN + 3 Deamidation (NQ); Oxidation (M)
77   647.69   1940.04   1939.87   0.17 0  5  3.4e+002 1  HAIIDYQYAQNGFENR + 2 Deamidation (NQ)
28   601.81   1201.61   1201.65   -0.04 1  5  3.6e+002 1  AVLYPDFKHI
71   931.93   1861.84   1862.04   -0.20 1  5  3.7e+002 1  TLLNILTPEGYGFRIR
73   950.45   1898.89   1898.94   -0.05 1  4  4e+002 1  DGITHSLANEVIMEGGKK + Deamidation (NQ)
30   615.29   1228.57   1228.65   -0.07 1  4  4e+002 1  APAPNEIAAKTF
86   1027.00   2051.98   2051.74   0.23 0  4  4.3e+002 1  NETNLNNLEQNNNNTSPD + 8 Deamidation (NQ)
27   595.12   1188.23   1187.48   0.75 1  3  1e+003 1  METKNNWYT + 2 Deamidation (NQ)
47   751.86   1501.70   1501.64   0.06 0  3  5.3e+002 1  ASSTTPSSSSQSSSTT
93   1108.03   2214.05   2213.94   0.11 1  3  4.9e+002 1  NSNGNSNGNGEIYMIECRGK + Deamidation (NQ)
85   683.02   2046.03   2045.83   0.20 1  3  5.4e+002 1  INNNNNNNNNDDDNGKNK + 2 Deamidation (NQ)
72   945.99   1889.96   1889.95   0.01 0  3  5.5e+002 1  FGILPGTHSILGDNFMR + Oxidation (M)
50   532.27   1593.79   1593.71   0.08 0  3  5.8e+002 1  GLIMNNVGGGGNNYNV + 2 Deamidation (NQ)
106   1203.63   3607.88   3607.74   0.14 1  2  5.6e+002 1  AGSGVIVPTTNPTPIVNVVGNGNSLVVNQKNNNNQA + 8 Deamidation (NQ)
88   1035.00   2067.99   2068.00   -0.01 0  2  5.8e+002 1  EMLIPHLNGGIESSQPMSK + Deamidation (NQ)
109   1422.95   4265.84   4265.93   -0.09 1  2  4.6e+002 1  SLDNEHDQFMDNLKPAVPSSSSSLSSSDLSQAEKELNQL + 3 Deamidation (NQ); Oxidation (M)
104   1023.82   3068.43   3068.38   0.05 0  2  5.5e+002 1  LPQSYHNGGIHSIDVNQDNTILVSGGTDN + 4 Deamidation (NQ)
1   385.74   384.73   385.20   -0.46 0  2  0.3 1  AAPGA
111   1489.65   4465.92   4465.87   0.06 0  2  4.9e+002 1  SYSNSLMPNYHYNNTTTNINTNVGSNTSPQLSNSNTPNPIS + 9 Deamidation (NQ)
80   989.02   1976.02   1975.88   0.15 0  2  7.5e+002 1  SLSSSSNSYSSSSMINPNK
105   1197.20   3588.59   3588.74   -0.15 1  1  6e+002 1  HYLTFNDETFVIEPPLNTGKQSAFNQLNHIV + 3 Deamidation (NQ)
81   995.51   1989.01   1988.88   0.12 1  1  7.6e+002 1  RVSHGPDPQCMFNDTTK
61   588.64   1762.89   1762.70   0.19 1  1  8.9e+002 1  AEQQKQQQQQQQQQ + 8 Deamidation (NQ)
101   1269.55   2537.09   2537.35   -0.26 0  0  1e+003 1  GVDLLISLVLLILYEFSNNCNK + Deamidation (NQ)
46   748.38   1494.75        
67   611.33   1830.97        
102   849.79   2546.35        
108   1403.95   4208.83        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 111

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 9 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8   -0.46        K.AAPGA.T
Top scoring peptide matches to query 2
Score greater than 20 indicates homology
Score greater than 46 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.1   -0.64        L.QGASTK.M
  7.3   -0.67        S.KGGTTK.S
  3.4   -0.62        N.QGVCK.E
  3.4   -0.58        K.QGVCQ.A
  2.6    0.37        K.GAGRVM.N
  2.6   -0.63        L.KGACR.S
  2.6    0.36        R.KGADVT.P
  2.6    0.40        K.KGANEA.T
  2.6   -0.62        R.KGCNI.L
  2.6    0.38        S.KGDDR.V
Top scoring peptide matches to query 3
Score greater than 42 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 32.1   -0.02    1  mALS3.5eoc APFTLR
 28.1    0.02                  R.APFDVR.G
 17.8    0.05                  R.APQTMR.Q
 17.1    0.07                  L.ADEDVR.K
 17.1    0.03                  L.ADQITR.R
 16.5    0.03                  E.QGETIR.K
 14.9   -0.02                  PAFLTR
 14.9    0.02                  D.PAFVNR.I
 14.0   -0.01                  E.APFIEK.V
 14.0    0.02                  L.APMIEK.G
Top scoring peptide matches to query 4
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 30.0   -0.01        N.FLGEKR.V
 19.7    0.04        G.QTSQKR.Y
 19.1   -0.01        A.FAVGLSR.S
 18.9    0.01        K.SSKIVSE.S
 18.9    0.07        E.SSQWLE.-
 18.6   -0.01        F.FALDKR.S
 17.6    0.02        I.MSVEKR.E
 16.3   -0.01        K.FGLKER.T
 16.3    0.04        L.FIGCPR.L
 16.3   -0.01        L.FIGGISR.I
Top scoring peptide matches to query 5
Score greater than 28 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.8    0.11        YENGSNK
 15.1    0.08        IHDPNSK
 14.4    0.04        L.DEGHIIK.N
 14.4    0.04        Y.DEGHLLK.N
 13.3   -0.06        Q.LVEPLIK.K
 12.7    0.09        H.EDKEYK.I
 12.7    0.12        QNQEYK
 12.7    0.16        QNQEYQ
 12.4    0.03        V.KMIEYK.S
 11.8    0.04        P.IHDQGLK.E
Top scoring peptide matches to query 6
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.7    0.01        C.IPYINTI.-
 14.5    0.05        V.IPYTPDK.N
 14.5   -0.02        N.LPYLVTK.G
 13.0   -0.02        I.LPSYLLK.Y
 13.0   -0.02        R.IFIVQTI.A
 12.9    0.01        R.IPPPPLEA.S
 12.9    0.00        S.LPGYAGKK.R
 12.9   -0.02        R.LPKYLTV.H
 12.9    0.04        V.LPQYNAK.C
 12.1   -0.03        L.IMISIIK.E
Top scoring peptide matches to query 7
Score greater than 33 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 23.5   -0.03        S.KQIEILK.V
 23.5   -0.03        S.KQIELLK.S
 23.5    0.01        K.KQIELLQ.L
 23.5   -0.03        L.KQLELIK.L
 23.5   -0.03        D.KQLELLK.I
 22.8   -0.03        I.QIKELLK.M
 22.8   -0.03        A.QLKEILK.G
 19.4   -0.00        S.ANANKLIK.R
 18.1    0.09        R.QQMSHLK.L
 17.9    0.04        -.QLQQLLQ.Q
Top scoring peptide matches to query 8
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.6    0.12        V.LQGPDQPK.F
 11.3    0.06        M.IAPNLLQI.I
 11.2    0.08        K.IQLPGAIGN.V
 10.2    0.08        S.KIYPYAK.V
  9.4    0.11        T.LQHKDNK.Q
  8.0    0.11        M.LKEHNNK.R
  7.7    0.04        A.IKLFFSK.I
  7.7    0.11        R.LKFIMSQ.L
  7.7    0.08        K.LQLFSFK.T
  7.5    0.13        S.LKYNNTK.R
Top scoring peptide matches to query 9
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 10.7   -0.11                  C.NKIPVPAR.S
  3.3   -0.10                  K.LPINNPKV.K
  2.8   -0.12                  A.VTRVGHVK.S
  2.1    0.01    1+ mALS3.5eoc NMPCVFK
  1.8   -0.10                  D.NINVPPIK.E
  0.8   -0.02                  N.STGSKSNSK.S
  0.8   -0.08                  F.AQVGHRVK.S
  0.1   -0.11                  P.ATAVLPPAR.A
  0.1   -0.06                  K.DNIPIPIN.V
  0.1   -0.14                  I.PVSRLPVK.D
Top scoring peptide matches to query 10
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.8   -0.06              V.KLISGFIK.V
 18.7    0.03              N.QLDSTTIK.A
 18.7   -0.01              T.QLTTTTIK.N
 16.7    0.01    6  8527.1 K.QIFQELK.T
 16.1   -0.02              W.KEFLGALK.F
 16.0   -0.02              A.KIEQFLK.L
 16.0    0.01              QLEQFLK
 14.3    0.03              E.VCERTIK.E
 13.7    0.11              D.GANDCGALK.A
 12.7   -0.02              I.KLQEFLK.N
Top scoring peptide matches to query 11
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.2    0.03    4  mCHT2 K.LSSAIEEIK.C
 33.2   -0.01             N.LSSTVLELK.K
 28.7   -0.01             H.LSSLISEIK.A
 20.1    0.01             E.LSASNEKLK.H
 18.4    0.03             V.ISIDTLEAK.A
 17.7    0.05             I.LSRDQEIK.K
 17.5   -0.01             L.ISSVTLLEK.R
 16.2    0.06             K.SLSSPEQIK.E
 15.9    0.05             L.ITSGANGELK.L
 14.9   -0.01             L.LSSNLTILK.F
Top scoring peptide matches to query 12
Score greater than 27 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.4    0.77        R.STNFALNDD.I
 13.8    0.71        R.LHQKQNDD.L
 13.6    0.79        R.TFSNDDQNG.D
  9.6    0.78        K.DCFVINDN.N
  9.6    0.77        K.NYQDLTQN.Y
  9.6    0.77        K.NYQDLTQN.Y
  9.6    0.73        K.SSYLAINDD.T
  9.1   -0.29        R.HASQAANIW.F
  7.6   -0.34        R.VPEQLDEVA.S
  7.6    0.77        MAVNGNFND
Top scoring peptide matches to query 13
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.4   -0.78        K.VSAMESQFT.F
 14.0   -0.76        Q.QGSDNGFMK.V
 12.5   -0.79        K.QNSDFDFK.A
 11.8   -0.75        K.THNQNQQQ.Q
 11.7   -0.79        S.QNFDDSFK.V
  8.5    0.10        L.KQLPEEQK.L
  8.4    0.19        K.QNYDMGKK.L
  7.8    0.06        T.ELQAGLIQK.H
  7.8    0.06        Q.QQLLDIAAK.R
  7.5    0.03        K.QQLLKIQK.S
Top scoring peptide matches to query 14
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.3    0.03        R.ASIENVIEK.G
 11.3   -0.09        S.KLLLGLFAK.E
 10.9   -0.02        I.KIAASNSIAK.E
  6.2    0.02        A.SAIKPSANSK.S
  6.1   -0.01        T.SPSKLTLQK.Q
  5.1   -0.08        H.KLLTLSSLK.A
  5.1    0.02        T.ASLQQQLSK.Q
  5.1    0.03        K.GTLQNLDLK.S
  4.9    0.07        T.VATETNPAAK.T
  4.9   -0.01        A.TGSVVVQIAK.N
Top scoring peptide matches to query 15
Score greater than 21 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.0    0.10        Q.QSNEKQMK.L
  8.2    0.08        T.SSAVSTSNEK.Y
  8.2    0.11        S.SSNNKSNQK.K
  6.6    0.00        I.SSMILGKMK.E
  6.0   -0.03        K.RHLSEIQK.D
  5.9    0.10        P.ETTSSNPMK.H
  5.5    0.04        K.RFDNPSFK.S
  5.2    0.02        Y.KTDATSLMK.K
  5.0    0.00        H.KMNTIIMK.K
  5.0    0.02        R.KSSLTSLMQ.R
Top scoring peptide matches to query 16
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.6   -0.01   15  11835.3 F.IVTVLELIK.R
 46.6    0.01   20  6242.2  E.NGKLLELLK.I
 46.6    0.06   19  921.1   T.NSPLLELLK.F
 46.6    0.06   12  9099.2  L.PSIDIELLK.Q
 46.6    0.02   14  10840.2 A.TIPTLQLLK.N
 46.6    0.02   13  25992.1 R.VILSLELIQ.S
 46.6    0.01   18  1801.1  G.VNKAIQLLK.D
 34.8    0.05               N.NAIINQIIK.S
 34.8    0.07   16  10894.2 N.NIQGLNQLK.T
 34.8    0.04               S.NQKNLGIIK.S
Top scoring peptide matches to query 17
Score greater than 32 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.4    0.03   17  19516.2 R.HQDFVPATK.I
 17.1    0.12               K.HAGLDDNATQ.L
 12.8    0.05               Q.HKDENATVK.I
  9.1    0.01               R.VKSTEIHTQ.R
  8.3    0.08               V.ETGQMVFSK.R
  8.0    0.07               L.HYQLNHTK.E
  7.9    0.07               A.HQFGVDDPK.R
  7.9    0.04               E.LNSTQHNTK.Q
  6.9    0.02               Q.DKVTSTYTK.A
  6.5    0.01               G.HKYCLPPK.M
Top scoring peptide matches to query 18
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.4    0.04    4  mCHT2 T.GYPELATALR.G
 15.6    0.03             K.IIIASKDQTT.T
  9.3    0.07             K.AVMELARVEG.L
  8.4    0.06             R.TKNGEIIISN.D
  8.4    0.15             -.DMAVINQPNS.Q
  7.4    0.06             L.ETSQLGDVLK.W
  7.4    0.08             R.LNSESLELW.L
  7.4    0.11             T.SNNQLNNRK.N
  6.8    0.01             K.LLLIMTKGDS.K
  5.4    0.21             K.IQPANNNNNS.N
Top scoring peptide matches to query 19
Score greater than 35 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 45.2    0.04    5  mRBT5 Q.FAGAVGNCVAK.N
 20.2   -0.01             K.KMTVLTGAGIS.C
 14.7    0.08             R.NSTIADGSAGVT.S
 14.3    0.10             K.KSMVDQQQQ.Q
 14.3    0.10             K.KSMVDQQQQ.Q
 11.7    0.06             K.MANIVNSIQS.E
 11.3    0.08             T.MAQGVQEWK.N
 10.9    0.00             R.FAGCGSLLLR.T
 10.8    0.02             K.KFVTNFHVT.W
  9.4    0.03             D.AAGFENNLKK.L
Top scoring peptide matches to query 20
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 28.8    0.04    3  TRBOTR K.SIVHPSYNSN.T
  9.6   -0.01              K.SIVNGLGAGKSN.W
  8.2    0.01              R.ISDRIAGAGGNS.R
  7.0    0.06              K.NVTSTQKHSN.S
  6.7   -0.04              K.LVVVEASSLSN.Y
  6.6    0.06              K.QNLDANQISN.T
  5.6    0.11              -.SNSMLHPNNS.V
  5.0    0.01              K.KPTSNQNKSN.Q
  4.4    0.05              K.HSQTTTNKNS.S
  4.2    0.03              K.NEIPSEVKSN.Q
Top scoring peptide matches to query 21
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 17.6    0.05    2  mALS1.5eoc K.TCTSNGIQIK.Y
 12.5    0.07                  A.NQTISTNTNK.N
 12.5    0.07                  A.NQTISTNTNK.N
 12.4    0.02                  C.NFKSDVSTPK.Q
 12.0    0.05    2  mALS1.5eoc K.TCTSNGIQIK.Y
 10.5    0.01                  L.FPFISSQAPK.F
 10.5    0.02                  Y.PHQMGLPTNK.Q
 10.3    0.09                  D.NMTQVSPSNK.K
  7.8    0.08                  L.SSSLNEQINK.E
  6.9    0.11                  Q.QQQEKDTDK.K
Top scoring peptide matches to query 22
Score greater than 35 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 69.8    0.04    1  mALS3.5eoc D.CSNIHVGITK.G
 18.3    0.09                  K.TQTNKHGINN.V
 17.8   -0.79                  R.DNNYMNIND.E
 16.9    0.11                  K.CSNLLNYLM.E
 16.0    0.09                  K.TQTNKHGINN.V
 15.7    0.19                  R.DNNYMNIND.E
 15.4   -0.03                  L.QTLLNVPLTK.N
 14.6    0.02                  L.AGTSSHLGGTIK.T
 14.0    0.09                  K.TQTNKHGINN.V
 13.6   -0.01                  V.DLIPNTNITK.E
Top scoring peptide matches to query 23
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.3    0.09        F.VGSPLMNSSIK.S
  9.6    0.16        R.VALGMNAENAAS.L
  9.4    0.20        K.QDPQRESNSS.E
  8.7    0.07        R.RSPLLGGNPTH.R
  8.1    0.18        K.KDDVDNINSQ.A
  7.9    0.10        K.YSISEPLDPK.A
  7.4    0.07        F.ENPIYAKWK.L
  7.1   -0.02        E.KPNLIPQIPK.I
  7.1    0.05        S.ILNLTTAAMGK.T
  6.9    0.14        N.NEPSQKSETK.K
Top scoring peptide matches to query 24
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3    0.14        K.NKQSIISMFS.F
Top scoring peptide matches to query 25
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 93.3    0.04    3  TRBOTR TLNNDIMLIK
 38.9    0.07              T.TLDDIINELK.L
 34.8    0.14              H.VNNNNNNDKK.T
 31.8    0.01              A.LTNTFPQIIK.C
 31.1    0.08              I.SQLNNLNNKK.S
 28.9    0.07              P.TIDDDQILIK.A
 28.9    0.07              K.TINDDEILIK.I
 28.4    0.04              T.TINPVDFQLK.I
 26.4    0.06              N.LTSQQIEDLK.N
 25.8    0.10              K.VNEVLNDEIK.I
Top scoring peptide matches to query 26
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.4    0.07        K.KAMNSNFNFL.S
 11.3    0.09        L.YNDYVSNPSK.F
  8.7    0.03        Q.ETDPLLAANNK.S
  5.6    0.04        F.NYFEEMLLK.E
  4.8    0.07        A.MFNFEEKDK.N
  3.7   -0.05        D.QLINSIDKQK.Q
  2.7    0.05        E.MSQRIYMNK.V
  2.4   -0.04        A.NLVDLVDAISK.H
  2.3   -0.04        Q.NVVEILKDEK.N
  1.6   -0.02        L.NIAQKVGNNVK.V
Top scoring peptide matches to query 27
Score greater than 15 indicates homology
Score greater than 46 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0    0.75        -.METKNNWYT.Y
  2.1    0.71        R.NGDDLERQAGGG.Y
  1.0   -0.31        K.SMGSYNTLLST.M
  0.9    0.70        K.GNAAGNDIDLLD.L
  0.5    0.70        K.AAAKNNNNSGGGGG.K
Top scoring peptide matches to query 28
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.6   -0.04        R.AVLYPDFKHI.R
  2.6    0.04        R.QEDEIVQDLL.K
  2.6    0.04        R.QENEIVQDLL.K
  2.4    0.06        -.MDLIGQMHQL.L
  2.0    0.09        K.DDESLMVPPSP.T
  2.0    0.04        R.EEGIDDVEIAL.R
  1.7   -0.05        R.DISASAGIKNIL.L
  0.7   -0.02        K.VLFDALNGVTGP.Y
  0.5    0.04        K.GLQQIACDTVP.E
Top scoring peptide matches to query 29
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.3    0.09        K.VVDKPTTANIGP.H
 10.7    0.26        R.LSICQADMEE.E
  8.2    0.18        N.QWSVQSGQYK.V
  7.4    0.10        K.LSLKQCSYLT.D
  6.9    0.06        A.AEIKLHYPNK.V
  6.9    0.01        P.EAIQDIILGLK.Q
  6.9    0.01        F.ISIKGPEILNK.Y
  6.9    0.01        F.ISIKGPELLNK.Y
  6.9    0.08        R.SIIKDLVNYF.K
  6.9    0.01        R.SILKNSQVPII.V
Top scoring peptide matches to query 30
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.9   -0.07        K.APAPNEIAAKTF.T
  3.1   -0.09        K.ALPKSTNKPSVS.K
  1.9   -0.06        D.APIPDQSSSTVK.S
  1.4   -0.14        K.LGNIVIPKNVY.C
Top scoring peptide matches to query 31
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
109.3    0.05    2+ mALS1.5eoc QTSVDLTADGVK
109.3    0.05    9  2663.2     T.QTSVDLTANGVK.Y
 24.3   -0.00                  Y.QGMTILKLSNK.S
 18.7    0.07                  N.TNSEGTNGGLRK.R
 14.6    0.10                  Q.DYHLNANTRK.G
 13.8    0.08                  K.SSAGNANKSNGLL.R
 13.7    0.02                  F.TSMPNILSSRK.K
 13.5   -0.01                  L.AAAGIYPTVSRK.Y
 13.4    0.15                  G.KGVMNMDFMK.K
 13.3   -0.01                  I.KTWLLSTWAK.A
Top scoring peptide matches to query 32
Score greater than 35 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 37.1    0.06    5  mRBT5   IYDQLPECAK
 37.1    0.06               K.LYDQLPECAK.P
 20.8    0.06    7  12297.1 R.IYDQIPKCAQ.E
 18.4    0.03               S.LYENLINDSR.F
 16.7    0.05               K.LTQFLIQNEE.Q
 16.7    0.05               K.LTQFLIQNEE.Q
 14.8    0.04               R.QEQVFPEVFI.P
 14.6    0.07               K.QEMNLKSIQQ.K
 14.2    0.00               I.YLGGEIQELSK.K
 13.9    0.00               D.EFNLEKDLTK.L
Top scoring peptide matches to query 33
Score greater than 22 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.2   -0.05        K.TNISLTPNPITK.E
  8.6   -0.05        T.INTVKWTPEGR.R
  6.6   -0.09        P.RGFVLPEIVDR.L
  4.3   -0.03        K.SKLANETVPENV.K
  2.6    0.01        T.TPMVDAYFRGK.I
  2.4    0.01        K.CYFDTRPLTK.G
  2.1   -0.04        R.LRIDATGNLNVN.V
  2.1   -0.04        R.LRIDATGNLNVN.V
  2.1   -0.03        M.TEKDLAGQPTIQ.S
  1.9   -0.03        K.ELTYTVSFKNV.A
Top scoring peptide matches to query 34
Score greater than 28 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 34.6    0.05    2  mALS1.5eoc K.YQNVPAGYRPF.I
 13.0    0.05                  T.YQNVSTGSNITK.W
  8.5    0.18                  R.QYNLQQQQQQ.Q
  8.4    0.01                  V.KVYNPASEYIK.S
  7.0    0.16                  N.YQNDQRQNDK.Q
  7.0    0.16                  N.YQNDQRQNDK.Q
  5.5    0.07                  K.NFIEMNKLWV.R
  5.3    0.10                  K.QYNTTNTNIIE.E
  3.8    0.04                  D.NQIFFNREIK.N
  3.3    0.11                  K.QYPALVEMTMP.S
Top scoring peptide matches to query 35
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.7    0.07    6  8527.1 L.SFTGDDKVYASK.N
  5.5    0.11              R.KEIEYTSMTSQ.E
  4.9    0.06              M.SFTFLLSPTMSA.P
  4.8    0.17              R.SFSNQQTMRDT.Q
  4.5    0.10              R.SQHDGQVPITYA.D
  3.3    0.11              T.KEHQTQTQTQS.-
  2.7    0.12              K.GAGSFMNAVIMTS.I
  2.5   -0.02              I.QKLVSDINSWK.Q
  1.7    0.08              K.AGGEPPLSTTATDT.T
  1.2    0.11              T.KEHQTQTQTQS.-
Top scoring peptide matches to query 36
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 29.7    0.06    3  TRBOTR K.SIVHPSYNSNTL.N
 13.6    0.04              D.MTNSKSLQGTHK.Y
  6.5    0.08              K.LSQYQYIAESK.D
  6.5    0.04              K.DVRNVVTAEQSL.Y
  5.8   -0.04              K.MTPILTTLSNKL.S
  4.9    0.11              M.DNLQQQEQNTI.A
  3.6   -0.01              K.IGSQSSVIRGNTL.S
  3.1   -0.00              R.SIPISKFDNPTI.V
  3.1    0.07              R.LSQQATGNANVNI.G
  3.0    0.12              R.ANVFTNYQTGTI.L
Top scoring peptide matches to query 37
Score greater than 42 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
108.9    0.06    6  8527.1 K.KTDDSAPITIVAK.F
 23.6   -0.01              H.KALLEVSTSIGLK.T
 19.7    0.08              P.SQEPFKLPDVAK.F
 19.1    0.18              T.KTSDDHYGPNPK.V
 19.1    0.10              L.QNSVTPINNKIK.N
 19.0    0.10              G.QSPESQLKEIAK.L
 18.9    0.13              V.QTNDPAEIQTIK.L
 16.9    0.27              D.NNNNNINNHTGK.T
 16.4    0.13              K.KQLTEDAIDPTQ.Q
 16.0   -0.79              L.DNNNASAALDQPK.R
Top scoring peptide matches to query 38
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 62.2    0.05    6  8527.1 L.GATDNFIPVTINK.D
 23.2    0.28              NNNNNNNNNNNN
 20.4   -0.76              N.NNNNNNNNAQQK.E
 18.5   -0.70              NNNNNNNNNNNN
 18.5    0.04              G.KDTDEIVSEILK.V
 18.1   -0.75              K.DNNNNNNNIIND.P
 17.8    0.21              K.QDTPNDQTNIEN.F
 15.7    0.12              P.TNKNPNPFNVDK.S
 15.5    0.08              V.QNPFSNIQQALK.L
 15.2    0.02              D.NIETIVLQPFSK.W
Top scoring peptide matches to query 39
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.6    0.02        S.PQDSIISSKSSNK.S
  8.4    0.03        Q.IGQQLPFDGSSSR.T
  8.4    0.03        Q.IGQQLPFDGSSSR.T
  8.4    0.08        G.TSNNNPNTISSNK.F
  8.4    0.08        G.TSNNNPNTISSNK.F
  7.4    0.13        S.TENPQNEDISSR.G
  7.0    0.13        R.SSSSSSSSSSSSNSK.D
  6.8    0.08        G.TSNNNPNTISSNK.F
  6.8    0.08        G.TSNNNPNTISSNK.F
  6.5    0.02        N.LLTVNSQGTESDK.D
Top scoring peptide matches to query 40
Score greater than 31 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.4    0.18        D.INEVENISESLR.N
 19.7    0.13        R.PYNVNLVEKGIR.E
 17.8    0.06        S.SSLVLSLMSKPIK.S
 15.9    0.06        K.FIVNRLVSVNIK.V
 13.5    0.24        I.SSSIVEFLMMNK.N
 13.5    0.24        I.SSSIVEFLMMNK.N
 13.4    0.18        K.KLNDELQSANIR.R
 13.3    0.18        K.KLNDELQSANIR.R
 12.2    0.17        F.RLNAQSEINSLR.E
 11.9    0.17        F.RLNAQSEINSLR.E
Top scoring peptide matches to query 41
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 65.3    0.08    1  mALS3.5eoc L.TCTVSNTLTPSIK.A
 15.4    0.16                  I.NKEGNDNTSVTDK.L
 14.3    0.14                  I.TCSLIGGSEQQNK.S
 13.5    0.10                  L.SSSTTTVATIPDDK.E
 13.1    0.16                  G.NNGRHHNQVTNK.N
 13.1    0.18                  E.DMDDNRINGINK.E
 12.4    0.16                  I.NKEGNDNTSVTDK.L
 12.2    0.16                  G.NNGRHHNQVTNK.N
 11.7    0.16                  I.NKEGNDNTSVTDK.L
 11.4    0.06                  N.TVTETGAVTISTDK.S
Top scoring peptide matches to query 42
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.5    0.06        K.IASTWEGIQAARE.L
  6.4   -0.01        K.VLKAFDAIDINDV.I
  5.1    0.03        G.ILQCQTIAEDIK.Y
  4.5   -0.04        A.VSISATTTPVTLSR.S
  3.4    0.11        K.GNTTTHSASQVTLN.I
  3.4    0.11        K.GNTTTHSASQVTLN.I
  3.4    0.02        L.GPMEVSKIEAISR.T
  2.7    0.05        L.VDQQGSQVLTIDK.L
  2.6   -0.09        A.VLGASIIVGFTLSR.K
  2.6    0.18        R.WTEGTVDNEHMN.K
Top scoring peptide matches to query 43
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.5    0.00        R.LRSEVLLQQQLQ.Q
 14.5    0.07        G.QVQHQTTGGVSAIK.Q
  9.1    0.00        R.LRSEVLLQQQLQ.Q
  8.9   -0.02        N.ALNGVLILLSAQNK.T
  8.9   -0.02        N.ALNGVLILLSAQNK.T
  8.8   -0.01        L.DQIVPKILECLK.Q
  8.8    0.05        T.TLNDQIDQAVPIK.I
  8.8   -0.00        P.VVKQQSSFPPPIK.H
  8.4   -0.05        T.QINLSLRVGVSLR.V
  8.3    0.00        R.LRSEVLLQQQLQ.Q
Top scoring peptide matches to query 44
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 17.9    0.07    1  mALS3.5eoc K.NVPAGYRPFVDAY.I
  4.8    0.19                  R.NAMDNASKNAGDMI.N
  3.4    0.10                  Y.YNSTDQLTEIQR.I
  2.1   -0.76                  K.KGLDEQTNDDMSD.I
  0.2    0.06                  K.NVYDALEKFLQQ.-
  0.2    0.06                  K.NVYDALEKFLQQ.-
Top scoring peptide matches to query 45
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 52.3    0.07    3  TRBOTR K.LQGIVSWGSGCAQK.N
  5.4    0.00              K.IVAKVSNYPGQVTI.K
  5.0    0.14              K.QVAINSNSNIYHQ.V
  5.0    0.14              K.QVAINSNSNIYHQ.V
  4.9   -0.12              R.KLGLILSAFLLVFG.A
  4.7    0.07              K.IKGIEEEDLQPGY.V
  3.8    0.05              F.KINQHGGMIQAHR.A
  3.8    0.05              F.KINQHGGMIQAHR.A
  3.8   -0.01              L.KINYTSLNPVDVK.L
  2.8    0.08              K.FATYANNPTLQHL.W
Top scoring peptide matches to query 46
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 47
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.06        K.ASSTTPSSSSQSSSTT.P
  2.8    0.01        A.NAEVTGSGIENDAPK.V
  2.5    0.04        Q.ENEKANVNNGDAPK.L
  1.6   -0.03        L.VNTDVTRYMEFK.Q
  1.4   -0.08        K.SNINRMDQIIIAL.I
Top scoring peptide matches to query 48
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 74.5    0.07    5  mRBT5 C.VMPQFAGAVGNCVAK.N
 14.0    0.18             D.DDDEPETSSTVEPK.K
 13.7    0.06             K.NDDLTELDFPKLK.T
 11.2    0.12             K.NDPNSLNKYGPISQ.P
 11.2    0.07             K.QLYQGGGAVATLNQQ.M
 11.2    0.12             K.NDPNSLNKYGPISQ.P
  9.9    0.07             G.AGNRMTLGGIDEVAK.F
  9.2   -0.00             T.NDVRYVINEIVSK.R
  8.8    0.11             D.DNDEEVSTITPISK.S
  8.6    0.17             K.QTTELIMGMHGQGQ.I
Top scoring peptide matches to query 49
Score greater than 28 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.9    0.12        K.KLPMVNLNETEVR.K
 14.4    0.13        K.QIIDDLYNAIANVP.N
 13.4    0.13        K.QIIDDLYNAIANVP.N
 13.2    0.23        T.KSMTASAHYNYNR.R
 12.8    0.08        D.QLNPIIYNVLTDR.A
 12.4    0.10        K.KLGANYAPCVKPQL.E
 11.5    0.18        T.QINIDNDIYWHK.K
 11.5   -0.76        L.QNKDNSPQPSSSNR.L
 10.2    0.22        A.QQSQHHRQHQSR.S
  9.9    0.13        Q.KLQSQSQSPEGLEK.Q
Top scoring peptide matches to query 50
Score greater than 13 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6    0.08        K.GLIMNNVGGGGNNYNV.D
  0.5   -0.16        R.KFFNISVVIVTLSK.M
Top scoring peptide matches to query 51
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.1    0.10        K.LAESNDELNAVSFAN.L
  2.1   -0.13        R.KFFNISVVIVTLSK.M
  1.7   -0.74        K.QGNFQHENVPDCM.E
  1.3    0.07        G.NPLDPNMQYDIFK.W
  1.0    0.05        D.IPNAANFETMEKTK.I
  0.8   -0.07        R.PLNRLIQNEILNR.L
  0.8   -0.07        R.PLNRLIQNEILNR.L
  0.8   -0.06        Q.APRQSPELTSPAIVK.T
  0.5   -0.69        K.SPEDANNNNNNNNTG.N
  0.5   -0.69        K.SPEDANNNNNNNNTG.N
Top scoring peptide matches to query 52
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 81.2    0.09   11  mSSR1 K.CSGLNDLSCICTTK.N
  9.8    0.02             K.NNSLTDLSLLNFKM.E
  9.4   -0.04             K.GGQYKLLIMTFLDN.S
  8.3    0.14             -.SCGTAVGETQQDFDN.V
  7.2    0.11             R.SCNFFSSFCFLVN.N
  7.2   -0.03             R.TANPQKVMLIVAPDN.D
  6.9    0.09             A.TYSSSSFSSFNETGK.K
  6.7    0.05             A.DLSQYYDNPNALSK.T
  6.3    0.17             -.MNNHNFIFNSSGDN.N
  6.3    0.17             -.MNNHNFIFNSSGDN.N
Top scoring peptide matches to query 53
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8   -0.03        S.DVSTRINPLGNTLNK.I
  8.4    0.00        G.YQFTIQNSVPFVAK.S
  8.4    0.00        G.YQFTIQNSVPFVAK.S
  8.3    0.02        D.LSSDMNHDASIRVAK.E
  8.3   -0.14        S.ISTANIIQYIIPVAK.S
  6.8   -0.08        T.IINQPIHGANIPINK.V
  6.4    0.06        S.NDSVNNDVEPLQVAK.L
  6.3    0.02        R.NRFSVAAIHGDLSQQ.Q
  6.2   -0.03        L.VTLAFQVDFAVTFGK.S
  5.8    0.04        H.YASIDWQDFSIVAK.V
Top scoring peptide matches to query 54
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
105.9    0.07   10  mALS4.5f K.FITDQTSIDLVADGR.T
 19.7    0.13                -.MEVTQRTQSQTQPT.Q
 16.9    0.17                K.TGEDNLVEKSTDNID.L
 15.0    0.07                K.ESTTIFNDLLFHLT.S
 14.6    0.21                K.QLNDENSDEKNTLQ.G
 14.6    0.21                K.QLNDENSDEKNTLQ.G
 14.0    0.18                K.SVGNSMQIFAHDELT.K
 13.8    0.12                R.MLIGSSTQFFQQFT.G
 13.2    0.21                K.QLNDENSDEKNTLQ.G
 13.2    0.06                K.KATYLQSLPNTAWR.V
Top scoring peptide matches to query 55
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 28.8    0.07    1  mALS3.5eoc K.NVPAGYRPFVDAYIS.A
  7.3    0.14                  R.AFYNGGMLFSMITLS.L
  7.0    0.24                  K.ASNSASYDDYYNIAD.K
  3.0   -0.02                  -.MSIILSVVPYFTIVS.G
  2.2    0.17                  M.SFDEGRNNSLDQVVS.Q
  0.9    0.21                  R.NAMDNASKNAGDMINS.Y
  0.8    0.18                  K.RNNSNSINSSYYYS.D
  0.7    0.11                  R.ISNGSLATVNTENLFS.V
  0.1    0.20                  K.VNSSEDWVALFGDDN.D
Top scoring peptide matches to query 56
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 67.7    0.07    2  mALS1.5eoc K.YTTSQTSVDLTADGVK.Y
 15.7    0.06                  D.HDKTVTSVDISPDGSK.I
  8.8    0.12                  K.LSFTSYNEYKSLSM.E
  7.9   -0.09                  K.IALPAGITIALAQSALY.D
  7.0    0.10                  R.VNVLSPMCKTSSTMV.S
  5.9   -0.13                  R.LLLLQQQQILKTFV.S
  4.8   -0.13                  R.LLLLQQQQILKTFV.S
  4.8   -0.13                  R.LLLLQQQQILKTFV.S
  4.7    0.19                  K.YWTEQNSEGQNKSN.V
  0.6    0.11                  K.TTTNMNWIQSLYVN.H
Top scoring peptide matches to query 57
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.7   -0.04        L.ELLNMKESNLEIIK.I
 16.4   -0.04        K.QIQVQLYESINEIL.R
 16.4   -0.04        K.QIQVQLYESINEIL.R
 15.9   -0.05        N.LDQLKSIFNQLNEK.S
 15.9   -0.05        N.LDQLKSIFNQLNEK.S
 15.9   -0.05        N.LDQLKSIFNQLNEK.S
 15.7    0.03        Q.LFLPQMQMKSHWN.-
 14.7    0.09        K.SLDEDADAEEDQILK.R
 13.3   -0.07        H.LIMNLSLQDPFSVAK.E
 12.9    0.09        Q.EILNEFDESNDPNR.D
Top scoring peptide matches to query 58
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 86.1    0.09    4  mCHT2 Y.CSINGQFNYDTWSK.F
 56.9    0.09    4  mCHT2 Y.CSINGQFNYDTWSK.F
 45.0    0.09    4  mCHT2 Y.CSINGQFNYDTWSK.F
 11.2   -0.01             S.LSLSDLNQWQNGLTK.L
 10.3   -0.25             G.KSLGLLLHALNLSLTK.R
 10.1   -0.04             R.TVSLRLENLCSSINN.G
 10.1   -0.04             R.TVSLRLENLCSSINN.G
  8.9   -0.08             S.IDNISSNISNTSILTK.D
  8.1   -0.01             N.NRFNSNTTTAHDITK.N
  7.9    0.14             N.NNNNNNNNNNNNTTK.S
Top scoring peptide matches to query 59
Score greater than 39 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 82.7    0.18    1  mALS3.5eoc F.STLTCTVSNTLTPSIK.A
 21.7   -0.73                  K.QNSISNIDSSMLLSPT.I
 17.1    0.20                  C.KSSMILGNLWDVTDK.D
 16.9    0.23                  I.VDSNSKLSQTSIENAK.I
 14.6   -0.73                  K.QNSISNIDSSMLLSPT.I
 13.4    0.23                  T.IVANSCSNISIGNFPK.V
 12.6    0.19                  Q.SITNFIDMRTATPQK.G
 11.1    0.24                  T.GSQNPNAFGSISTTVDK.H
 11.1    0.24                  T.GSQNPNAFGSISTTVDK.H
 10.9    0.24                  R.DVSPFVNLPHAPNSDI.I
Top scoring peptide matches to query 60
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
115.0    0.07    1  mALS3.5eoc Y.GDVQIDCSNIHVGITK.G
 16.2    0.00                  Y.GDNLLDLNLAYRIHK.L
 13.2    0.04                  K.EAAKLPNDLTLDDVLQ.-
 12.6    0.10                  N.TTSKLNDPSFAMTPTK.Y
 12.3    0.08                  T.NEGVINVNDELAPELK.V
 11.5    0.06                  V.GTLQMYLSDSANLLTK.E
 11.3    0.05                  R.KAAEINWDPVDNTVLA.N
 11.2   -0.03                  A.SLAGALLLLTYIGCYK.V
 10.1    0.00   16  10894.2    S.INDGLDLINAIVEDLK.N
  9.3    0.16                  G.NGNDENNNKPHRITK.I
Top scoring peptide matches to query 61
Score greater than 13 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.7    0.19        R.AEQQKQQQQQQQQQ.Q
Top scoring peptide matches to query 62
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.6    0.06        N.STEVLTNKEDNSNLAK.L
  9.7    0.02        K.ETKMVLEATMIAIDNS.E
  8.0    0.06        K.STKSSNNNVIEQVVNK.Y
  8.0    0.03        T.SKVTALNMANSADDLAK.V
  8.0    0.03        T.SKVTALNMANSADDLAK.V
  8.0   -0.04        Y.SEKLGESYAQAASILAK.K
  7.6    0.05        K.SKHNQSAQPSQPQLSQ.S
  7.6    0.05        K.SKHNQSAQPSQPQLSQ.S
  7.6    0.09        S.SGNHHHHHHSQHIAK.F
  7.6    0.13        K.SCQDREINAVDSENK.K
Top scoring peptide matches to query 63
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 40.9    0.07    2  mALS1.5eoc K.YQNVPAGYRPFIDAY.I
 11.7   -0.01                  S.QGGYVFLYELVKQTK.N
  8.5    0.20                  R.YKSSDIMNQSPNELE.S
  5.1    0.20                  K.YQNSQGWFSATPGGGES.F
  4.8    0.10                  MSGSSSELFNLVKNSR
  4.5    0.10                  R.FGSNPFPTASKDTLQY.L
  3.5    0.01                  K.YLLNNPINIDVVSVAQ.E
  3.0    0.15                  R.YKVNFEQLADESSED.E
  2.8    0.20                  K.YQNSQGWFSATPGGGES.F
  2.8    0.03                  N.QYLINPITNNNPKDK.D
Top scoring peptide matches to query 64
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.1    0.08        K.SSDCSPVPALGSSFLEK.F
  7.9    0.01        H.SITNNGIISFDSRISR.T
  5.6    0.01        H.SITNNGIISFDSRISR.T
  4.3    0.06        P.TLSTNQSADSERTITR.K
  4.0    0.06        P.TLSTNQSADSERTITR.K
  3.5    0.06        I.QCILSQLDSVYPDLK.N
  3.5    0.04        R.EEMTKNQVSLTCLVK.G
  3.1    0.12        R.ENNKLHYFNSVTSPQ.G
  2.9    0.11        N.ENLEMDLSEKTDNLK.E
  2.5    0.04        E.SDATTITQNLTPSTTTK.N
Top scoring peptide matches to query 65
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.6    0.11        -.LNNIGMDNVLANDVGVD.V
 16.5    0.03        R.KSSFPMPSKPTQLNLN.V
 15.9   -0.00        E.LIEVFLNNARTLNNR.L
 15.3    0.03        R.KSSFPMPSKPTQLNLN.V
 14.5   -0.02        R.LFTGVAIQALQQLTGIN.F
 14.2   -0.00        E.LIEVFLNNARTLNNR.L
 12.5   -0.11        K.GFIAGVGIVMIITSSIIV.L
 11.2    0.00        D.QLMNLVLENVTETLR.G
 10.8    0.17        V.ESSGLWNSNGGNNQPAR.S
 10.8    0.17        V.ESSGLWNSNGGNNQPAR.S
Top scoring peptide matches to query 66
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 93.4    0.08    1  mALS3.5eoc L.SYANEYTCAGGYWQR.A
 11.7   -0.01                  H.SLFHRSHHNGSNFQR.D
 10.4    0.03                  K.FSNSFQSNLFSNRFE.E
 10.1   -0.04                  W.ASYNGATYYIDVFGKR.L
  6.8   -0.01                  H.SLFHRSHHNGSNFQR.D
  3.6   -0.02                  F.NTSFPYSMGIHQAPFK.C
  3.3    0.01                  S.QNPNQSYLSLLQNMR.E
  3.3    0.00                  L.NTSVYYEYAKAEQMK.S
  3.2   -0.13                  I.KQLNFSDLLNYTQLK.N
  3.1   -0.04                  T.QSQGYYNTPPPTSTKR.N
Top scoring peptide matches to query 67
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 68
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 13.8    0.07    1  mALS3.5eoc K.NVPAGYRPFVDAYISAT.D
Top scoring peptide matches to query 69
Score greater than 22 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.5    0.16        R.VAVSSKYQTADNLVQSM.M
  9.5    0.16        R.VAVSSKYQTADNLVQSM.M
  8.8    0.11        K.IVMGKLSNVGTGSFDVFA.Q
  8.1    0.18        K.NPNYFRIIIQSQQSM.T
  6.9    0.10        K.LNLVSPSLNLFLFSFQ.H
  6.0    0.09        A.DPTITALIKEGDDNLAR.I
  5.7    0.13        Q.VHQQTQLRTFSQPNR.N
  5.7    0.13        Q.VHQQTQLRTFSQPNR.N
  5.7    0.13        Q.VHQQTQLRTFSQPNR.N
  5.7    0.13        Q.VHQQTQLRTFSQPNR.N
Top scoring peptide matches to query 70
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 69.4    0.07    5+ mRBT5 K.QSTSSTPCPYWDTGCL.C
 10.9    0.13             K.NSTTSTSTSNANGNGNGNGT.E
 10.9    0.13             K.NSTTSTSTSNANGNGNGNGT.E
 10.9    0.13             K.NSTTSTSTSNANGNGNGNGT.E
 10.9    0.13             K.NSTTSTSTSNANGNGNGNGT.E
 10.0    0.11             M.SSSSTNNTNNNNTSALNL.Q
  6.5   -0.00             R.ESNGAYGGGLTYDGLNGTL.N
  5.0   -0.21             K.MILSSIWLLNPMVITI.S
  2.4   -0.05             R.ITNGLPRNAQLDCLGQS.E
  2.2    0.05             K.QKQQQQQFTYPSAQGS.S
Top scoring peptide matches to query 71
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.5   -0.20        I.TLLNILTPEGYGFRIR.A
  2.4   -0.05        K.ATPTKGGEQHQPGSPAGAAT.S
  2.1    0.05        L.ENYLYQSEREECSR.V
  2.1   -0.08        I.LNPGPVQSNYGSEYIPK.T
  2.1   -0.10        S.NHFALLNQIMFQKQK.V
  2.0   -0.02        K.MDHSGIQAIVNFKNDR.L
  2.0   -0.15        R.KPVARMQCIQSIYVVA.H
  1.5   -0.07        K.DFSAARYIFTELSEIT.R
  1.5    0.79        S.GSLYIYIYIKFNLVR.E
  1.4    0.18        G.NTNNNSNSNSSSSSSNNK.V
Top scoring peptide matches to query 72
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7    0.01        V.FGILPGTHSILGDNFMR.S
  1.1   -0.07        R.IPNFGIKFISNKPISTN.N
  1.1   -0.07        R.IPNFGIKFISNKPISTN.N
  0.9    0.08        M.SGNSRNTGISSLNNNRPT.A
  0.4    0.08        Q.WANNSTELANQRANAVK.S
  0.4    0.08        Q.WANNSTELANQRANAVK.S
  0.3    0.06        R.GFIINALSNAENNVTNPT.I
  0.1   -0.03        K.MLFAPIDIIGEFIPGLQ.G
Top scoring peptide matches to query 73
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1   -0.05        T.DGITHSLANEVIMEGGKK.L
  4.0    0.15        I.EMSNSLCDTNNHNSFK.E
  4.0    0.15        I.EMSNSLCDTNNHNSFK.E
  3.9   -0.19        -.MLSSKIYSLVLLSLFGL.A
  3.9   -0.12        V.SVIIRGANNLVLDETER.S
  3.9   -0.12        V.SVIIRGANNLVLDETER.S
  2.5   -0.08        T.LHNVANTVMKNPAMISK.N
  1.5    0.04        F.TLSNNSNSDGNSALQFTK.I
  1.4    0.01        V.IDGTFNNEMHNLHLVK.G
  1.4   -0.12        K.TVQFTAVLILAYCLTSV.A
Top scoring peptide matches to query 74
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
108.0    0.07    4  mCHT2 S.AAPQCPYPDASLGDLLSK.V
 15.1    0.08             S.AAGQVTVEMDAAPGVDLNK.I
  5.4    0.08             N.NNANNINNKNTNDLSIK.L
  4.0    0.08             N.NNANNINNKNTNDLSIK.L
  4.0    0.08             N.NNANNINNKNTNDLSIK.L
  3.7    0.12             K.THEAEGNYDNVPVTLKN.Q
  3.5    0.06             I.QPTTFNPTINQNGSINR.Q
  3.1   -0.11             L.QPNVLVHQVKLSVLQAK.L
  2.9   -0.03             R.AANVATELTAAAPYELGKL.Y
  2.9    0.03             D.APYPVYDAPSPPPVFASK.E
Top scoring peptide matches to query 75
Score greater than 16 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.7    0.16        C.KTVLPLESTNNTDSFNK.S
  3.1    0.17        L.KSANLSNFNPQNFIDAK.D
  2.7    0.29        K.KGQQPMQQATSSSQQQQ.Q
  2.2   -0.70        E.DAQAYDDEDEPAELISK.I
  2.0   -0.74        R.LSNDKEFSDMVISYFN.N
  1.8   -0.76        I.EESGGEAPFMIDNGTILK.A
  1.5    0.16        E.QLQSFTSLQSQVTSPQK.T
  0.8    0.15        D.VVDEAGTPLTNAINLSHR.C
Top scoring peptide matches to query 76
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 51.1    0.07    4  mCHT2 SNQVALYWGQNGAGGQER
 38.6    0.07    4  mCHT2 SNQVALYWGQNGAGGQER
 27.9    0.07    4  mCHT2 SNQVALYWGQNGAGGQER
 10.1    0.11             D.EISNDNNKNQESIWNK.K
  4.1   -0.05             I.NALNSLQSNFASIEATKK.L
  3.0    0.31             K.NEDADDNEGNEQSANSHS.G
  3.0    0.31             K.NEDADDNEGNEQSANSHS.G
  3.0    0.31             K.NEDADDNEGNEQSANSHS.G
  1.5    0.07             K.QVGNIVENMIMSADGLQL.E
  1.3    0.04             P.NISLAMLSMAANIPDMDK.S
Top scoring peptide matches to query 77
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.2    0.17        E.HAIIDYQYAQNGFENR.K
  5.2    0.17        E.HAIIDYQYAQNGFENR.K
  2.3    0.20        F.TIGAVYMNNVFDYMNR.Y
  1.3    0.21        N.QSFEQQVNNNLSDMDR.L
  0.5    0.21        P.DDSLNDYLNFDYLFGK.R
  0.1    0.12        K.NPSNESLFVSICRFDR.V
Top scoring peptide matches to query 78
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6    0.26        R.TSDMNNRNSSINNNNNN.N
  4.4    0.24        K.CGLDYLYNTHNNNNNN.N
  2.8    0.10        Q.QALQMQQTQQQQHIGR.V
  2.7    0.16        H.NVFNNSSDNQVQINKSK.I
  1.4    0.14        A.NNMGSDLATSVQQSNFGR.S
  0.5    0.10        Q.QALQMQQTQQQQHIGR.V
  0.5    0.07        V.TSGVNFNGNVNIHGISPGR.L
  0.2    0.19        R.NATPAPNGNGNGIGAGAGNDNS.G
  0.1    0.16        H.NVFNNSSDNQVQINKSK.I
Top scoring peptide matches to query 79
Score greater than 27 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 57.1    0.19    3  TRBOTR R.LGEDNINVVEGNEQFISA.S
 39.5   -0.79    3  TRBOTR R.LGEDNINVVEGNEQFISA.S
 38.0   -0.79    3  TRBOTR R.LGEDNINVVEGNEQFISA.S
 19.9   -0.79    3  TRBOTR R.LGEDNINVVEGNEQFISA.S
 15.9   -0.79    3  TRBOTR R.LGEDNINVVEGNEQFISA.S
 11.3    0.19              K.ISQLSQTPTSGNNNNTGIT.N
 11.3    0.19              K.ISQLSQTPTSGNNNNTGIT.N
 11.3    0.19              K.ISQLSQTPTSGNNNNTGIT.N
  9.6    0.12              P.VRGMLLQGNLLNQAFNR.L
  8.4    0.21              K.NHYIINIGSFSYTPYGT.H
Top scoring peptide matches to query 80
Score greater than 13 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6    0.15        S.SLSSSSNSYSSSSMINPNK.Y
  0.8   -0.07        H.LPELNQPLIPQLRSAASK.C
  0.7    0.09        SINSNNYNYLNSITMTK
  0.5    0.11        K.TSRITNFSYPNISDSTSS.I
  0.4   -0.06        L.VIPVFLHTYNSTIMTIK.D
  0.3   -0.01        K.TLESSYLLKIDGEVAELP.Q
  0.1    0.13        K.EACYGGIRYVESLASSSQ.Y
Top scoring peptide matches to query 81
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.4    0.12        I.RVSHGPDPQCMFNDTTK.I
  0.9    0.14        N.GHSNGNSASNTVDANTIDSK.T
  0.9    0.01        N.TAFTFAVFIQDSYSKHK.I
  0.6   -0.02        H.DNLPPLVIERMSSDFIK.N
  0.3    0.08        D.NNLECSPPLTNARMLDK.L
  0.3    0.08        D.NNLECSPPLTNARMLDK.L
  0.3    0.02        K.DQRYLTRPPLPIDQEF.P
  0.0   -0.03        I.DEIPLYGEGSTLERLGLK.G
Top scoring peptide matches to query 82
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.7   -0.06        R.TEPNNNNTSKLTPIQAAAGA.L
  5.7   -0.06        R.TEPNNNNTSKLTPIQAAAGA.L
  5.0   -0.10        K.NQQTKYGFQEVVTPLIF.K
  5.0   -0.10        K.NQQTKYGFQEVVTPLIF.K
  4.6   -0.10        K.NQQTKYGFQEVVTPLIF.K
  4.2   -0.31        M.LLTILISLVVAIYIDLNQ.P
  3.7   -0.03        R.QGALMASSMILIQQNEFI.Y
  3.5   -0.13        S.TVPATSNQEQEILVAQRK.N
  3.5   -0.13        S.TVPATSNQEQEILVAQRK.N
  2.9   -0.04        I.TNRPNTPKQFSASSSFNK.K
Top scoring peptide matches to query 83
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 69.8    0.08    5+ mRBT5 K.QSTSSTPCPYWDTGCLC.V
  6.8   -0.17             Y.MESNLRTIQILETIANR.I
  3.5   -0.08             R.NFELETNFIDADNAHLR.P
  3.5   -0.08             R.NFELETNFIDADNAHLR.P
  3.4   -0.10             -.MEFFSSSLILQAMRAIC.L
  2.3    0.01             R.QSFVSDSPNSSKVMNTLC.C
  1.9   -0.21             K.IYDDLLQSLAGQQTRIGK.T
  1.9   -0.21             K.IYDDLLQSLAGQQTRIGK.T
  1.7   -0.00             R.DFVETPSQMLEYWTWS.K
  1.4   -0.04             T.NTGYRLYCEIGSDSQQK.R
Top scoring peptide matches to query 84
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
131.1    0.08    1  mALS3.5eoc Y.TLSYANEYTCAGGYWQR.A
 12.0   -0.03                  M.ITQSQGYYNTPPPTSTKR.N
 12.0   -0.03                  M.ITQSQGYYNTPPPTSTKR.N
  8.7    0.16                  L.NTMAESSPYGGYGNSSMNR.Y
  7.2    0.16                  L.NTMAESSPYGGYGNSSMNR.Y
  5.5   -0.24                  F.TLLKGVGPAMASLLANLLIK.I
  4.0    0.03                  K.TSITEATGISQLNACSTLDG.E
  3.7   -0.04                  Y.IKFMNEIFPTVVEDADR.D
  2.8    0.24                  R.WNQDDIFQSHDNANENS.N
  2.4    0.02                  D.DLFSFINFNEFEFSQR.G
Top scoring peptide matches to query 85
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8    0.20        E.INNNNNNNNNDDDNGKNK.Q
Top scoring peptide matches to query 86
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6    0.23        K.NETNLNNLEQNNNNTSPD.K
  3.6    0.23        K.NETNLNNLEQNNNNTSPD.K
  3.6    0.23        K.NETNLNNLEQNNNNTSPD.K
  2.6    0.22        K.DDSQQQQQQVTDDDDPTS.V
  2.5    0.01        -.MTSQIADGSSTTTINPLKNG.L
  2.1    0.09        M.SGEEVINSTNRPNTSQSSGS.G
  2.0   -0.11        L.AGCLSKMPQLVHVSLLGNK.N
  1.2   -0.11        T.IVLDSAYDELRFSIIGNK.D
  1.1   -0.02        I.NTTTNSSPLFTNTPLTQSK.R
  0.7    0.04        K.LMEGNMITLNSNTGSNQIL.L
Top scoring peptide matches to query 87
Score greater than 25 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.6   -0.06        R.SLSALPFSYLFPNAILNPS.P
 11.1    0.10        M.SGEEVINSTNRPNTSQSSGS.G
  9.2   -0.10        L.AGCLSKMPQLVHVSLLGNK.N
  9.1    0.10        M.SGEEVINSTNRPNTSQSSGS.G
  7.3    0.01        K.ADDELHELNPYNLPLKNG.K
  5.7    0.14        R.QQQVGLSTTTNQMGPPGSNS.N
  4.5    0.23        K.DDSQQQQQQVTDDDDPTS.V
  3.6   -0.12        N.SNVINVQRQPQTSGGILNK.L
  3.4    0.08        K.QQQQQQQHQQNRDASGGS.S
  3.3   -0.10        K.SVMVKSNTKPPRPSLHQF.N
Top scoring peptide matches to query 88
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.4   -0.01        P.EMLIPHLNGGIESSQPMSK.V
  2.2    0.06        K.ESNKLTCDVMIENSLISN.G
  1.9    0.10        K.NSGINSGNNSNNGTRVSSTVS.D
  1.9    0.06        K.LMEGNMITLNSNTGSNQIL.L
  1.7    0.12        F.QMQDQNPSMNKPWTLSK.L
  1.6    0.09        R.ASSIQSGQPSFFSAQQYFS.R
  1.6    0.09        R.ASSIQSGQPSFFSAQQYFS.R
  1.6    0.09        R.ASSIQSGQPSFFSAQQYFS.R
  1.5    0.74        A.SALLSGTIVISVIEPISIKK.I
  1.5   -0.12        T.LLPIPPIPSDEDYYVLPK.N
Top scoring peptide matches to query 89
Score greater than 35 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
147.9    0.07    1+ mALS3.5eoc K.GLNDWNYPVSSESFSYTK.T
 13.8   -0.11                  C.VAVINAGVVPGVKTDSHNSTK.N
 12.8   -0.01                  E.IGNSGMFRPEMLESMGLPK.N
 12.5    0.04                  D.NNSTPQSQSNLIQDVSKTK.K
 11.6   -0.12                  G.AKSVTNFELLPNPPNARPK.D
 11.4   -0.24                  A.SSLFIFLNLVGGFILGRLK.S
 10.7    0.08                  K.LKENTNSYSMLINSNNSY.T
 10.6    0.08                  K.LKENTNSYSMLINSNNSY.T
 10.3    0.04                  D.NNSTPQSQSNLIQDVSKTK.K
 10.1   -0.03                  L.LSMGFLGPEADNLEVQKTK.R
Top scoring peptide matches to query 90
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 80.2    0.08    6  8527.1 L.GGDVYELGATDNFIPVTINK.D
 14.4    0.22              K.QMAQQMGLGGENGPDLSNIM.N
 11.4    0.19              K.HVVMTSSSQLSASSNESIQN.E
  8.6    0.24              K.AFMYTGINDNIVYSNHDF.I
  8.6    0.24              K.AFMYTGINDNIVYSNHDF.I
  8.5    0.05              F.LYPPSIYQIMSILPETQK.V
  8.4    0.24              P.DNSINNSGGGGSLYLNFFDK.L
  7.8   -0.79              R.FPQQSQQSNISSVANKNQN.I
  7.4    0.09              L.ITLFQNGLNGILADEMGLGK.T
  7.3    0.09              K.SNNASTILLFNSNVPSSLNK.S
Top scoring peptide matches to query 91
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.3    0.06    3  TRBOTR R.LGEDNINVVEGNEQFISASK.S
  4.5   -0.12              N.LEIRIIFINIVQLFGSGTK.S
  4.1    0.16              K.INIDFHPDNPELNYLMEA.N
  3.8    0.15              K.TPQNNSKLQSMQMELFFS.V
  3.3    0.06              K.ERNQLDQLVPDFTFAAIPS.I
  3.3    0.06              K.ERNQLDQLVPDFTFAAIPS.I
  3.2   -0.01              E.VIDEQGKLSQQDLAYASAVK.A
  3.2    0.14              R.VTSLQINFKPTGYGNYQDD.E
  3.2    0.02              A.IGSDLRLGQQSLGVSNNFEK.I
  3.2    0.02              A.IGSDLRLGQQSLGVSNNFEK.I
Top scoring peptide matches to query 92
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3   -0.03        S.PQQSNDDGSTPLQKVTSQNK.R
  6.3   -0.03        S.PQQSNDDGSTPLQKVTSQNK.R
  6.3   -0.03        S.PQQSNDDGSTPLQKVTSQNK.R
  6.3   -0.03        S.PQQSNDDGSTPLQKVTSQNK.R
  6.2    0.04        K.FAPNYDIENPSDNTSTEFI.E
  4.2   -0.18        E.NNSIWAKIQSVLLISCNSK.R
  3.8    0.07        -.SEGEDIDEYGFPKDSLDME.I
  3.8   -0.16        K.LIDISNVGDINSIQTVVMMI.I
  3.5   -0.06        S.LLTNQNQNQNQNQLLMNK.L
  2.9   -0.10        K.RMFYYLETEVLATTYFI.H
Top scoring peptide matches to query 93
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.11        H.NSNGNSNGNGEIYMIECRGK.K
  2.9    0.11        H.NSNGNSNGNGEIYMIECRGK.K
  2.7   -0.01        I.SGKVDGYNSGIFIQNSNADTK.D
  2.4    0.72        R.AVLFGRLFGLQVLINSQIII.L
  2.4   -0.08        K.IQQNQVTRQSILQEIIQLG.N
  2.3    0.07        K.KLNMTSQYNGDTNSTTIDPN.N
  2.2    0.24        K.DNQQSQFNNQINNNNNNTS.A
  2.2   -0.75        K.DNQQSQFNNQINNNNNNTS.A
  2.2   -0.27        R.AVLFGRLFGLQVLINSQIII.L
  1.8    0.04        K.LQQDQLVHNGNQDQGFIVGT.N
Top scoring peptide matches to query 94
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3   -0.08        M.TELMFSEMVKEITGDYVIK.Y
  8.8   -0.00        K.FYPTNDGLGFNCFRLPANK.D
  7.5    0.13        D.LNCFNEWETMSNGNQPMK.R
  7.5    0.13        D.LNCFNEWETMSNGNQPMK.R
  7.4    0.13        D.LNCFNEWETMSNGNQPMK.R
  6.9   -0.06        R.TRISTEGAASFFGAQPMFLGK.D
  5.8   -0.01        E.NQPPNPQFMEEFTHMKLK.V
  5.8   -0.01        E.NQPPNPQFMEEFTHMKLK.V
  5.8   -0.01        E.NQPPNPQFMEEFTHMKLK.V
  4.9   -0.05        K.DNYLASMIGFIKLGSLNDDF.Y
Top scoring peptide matches to query 95
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.1   -0.78               K.EQNVDANQIGNSDEDPTNSLL.L
 10.8    0.06    3  TRBOTR  K.SIVHPSYNSNTLNNDIMLIK.L
 10.7    0.16               S.QGNHNADEGETIFDLIEQLK.I
  7.3    0.13               R.QTPGGNLDNIGNIGSPTSTVDSK.E
  7.3    0.13               R.QTPGGNLDNIGNIGSPTSTVDSK.E
  7.2   -0.09               M.RLFLALLALGFAAVAAVPAYPQ.R
  7.0   -0.78               K.EQNVDANQIGNSDEDPTNSLL.L
  7.0    0.04               R.QTLKLNAAGGLSPNNFLSPGSVS.T
  6.2    0.07               K.KIIDLENEISNLNNIINSTN.S
  6.1   -0.79    8  12997.2 R.EPPNPTVTTTEYWSQSYTTA.T
Top scoring peptide matches to query 96
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 38.3    0.11    3  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 38.0    0.11    3  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 37.2    0.11    3  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 31.6    0.11    3  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  8.6   -0.79              R.NGMSPLQTNVARMAGPNSPAGST.N
  4.3    0.12              L.EITPSDMGNNDRVVIQDLLK.D
  3.8    0.06              H.DGNGLSDITSPNGLKSTPIFIK.Q
  3.1    0.14              L.KLLNYPQFNWGNYQMLIK.S
  3.1    0.14              L.KLLNYPQFNWGNYQMLIK.S
  3.1    0.14              L.KLLNYPQFNWGNYQMLIK.S
Top scoring peptide matches to query 97
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 59.9    0.10    2  mALS1.5eoc M.GFSSSNGDVAIDCSNIHIGITK.G
  1.4    0.11                  L.KNTVLQNNNNDEIFNDGDVK.S
Top scoring peptide matches to query 98
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.3   -0.01        K.QDEVFYNPIQQFNRDLSIM.A
 12.3   -0.01        K.QDEVFYNPIQQFNRDLSIM.A
  5.8   -0.01        K.QDEVFYNPIQQFNRDLSIM.A
  2.5   -0.01        K.QDEVFYNPIQQFNRDLSIM.A
  1.2   -0.19        R.TIQNTQYKGVTKPTEIFFFL.G
  0.8    0.07        K.YDQPENKEEIMSNPSMLADF.I
  0.7    0.00        R.HGQFINNIENNLLSYYSPFT.Q
  0.6   -0.08        R.DYEGHKVEQQPSTIMALVVQS.C
  0.1    0.03        K.QGYENNELQAPIYQDSIEFI.E
Top scoring peptide matches to query 99
Score greater than 17 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.5   -0.13        R.EQHKVFEKPMYLPLLFVNSG.M
  3.9   -0.03        K.SSLSLSGLTGGSSTNLVSAFTSSNT.N
  3.8    0.70        Y.GIIIPLFANSIKSLFILTVGMK.L
  3.6    0.16        R.NGFETVTRNNLTDDENWSTC.V
  3.6    0.16        N.NNNNNNNNNNNDNDEEIEMK.Q
  3.6    0.33        R.NNSEDSQINNNNNNNNNNSSM.H
  3.6    0.03        R.VSVFVDNSFMQFLGRCYYGS.N
  3.6    0.03        R.VSVFVDNSFMQFLGRCYYGS.N
  3.5   -0.02        E.LSQMQTHISDTSVVLSMDNNR.N
  3.5   -0.02        E.LSQMQTHISDTSVVLSMDNNR.N
Top scoring peptide matches to query 100
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.8    0.68        A.ALSGENTYAIIAISNTPSLIIRGR.S
  9.8    0.75        K.ANSDNTGFYLMSIAVVGFIAVLLV.M
  9.8    0.75        K.ANSDNTGFYLMSIAVVGFIAVLLV.M
  9.8    0.72        T.APEAAGLIHTDLQKTFINSIVYK.W
  0.9    0.68        A.ALSGENTYAIIAISNTPSLIIRGR.S
Top scoring peptide matches to query 101
Score greater than 13 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.3   -0.26        F.GVDLLISLVLLILYEFSNNCNK.N
Top scoring peptide matches to query 102
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 103
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.9    0.13        R.NTFSPCRIIQFNFSNVTIISPIDASS.F
 10.9    0.13        R.NTFSPCRIIQFNFSNVTIISPIDASS.F
  6.8   -0.77        N.INCVCNMYFFSHFDTIASSRVFAK.K
  5.8    0.13        R.NTFSPCRIIQFNFSNVTIISPIDASS.F
  5.5   -0.71        -.MSSVNNADISIMSNPTTSDSLSSLDQQA.I
  5.1    0.05        L.NTGMFLLQLAQQVSTFAVNYIGLPFR.E
  5.1    0.05        L.NTGMFLLQLAQQVSTFAVNYIGLPFR.E
  4.8   -0.71        -.MSSVNNADISIMSNPTTSDSLSSLDQQA.I
  4.7    0.07        K.ESLHVKPSVANIDLLFKQLDSNEDGY.I
  4.7    0.05        L.QSEDLGSLIVQMSEVIIARADIELQR.S
Top scoring peptide matches to query 104
Score greater than 14 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.9    0.05        K.LPQSYHNGGIHSIDVNQDNTILVSGGTDN.K
Top scoring peptide matches to query 105
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5   -0.15        K.HYLTFNDETFVIEPPLNTGKQSAFNQLNHIV.S
  0.5   -0.07        S.SQSTQQNVASGAGSGGRGNASSTQGQLPPQLVNLMR.T
  0.2   -0.00        R.LNSPHINMAELAIHNNQKQQQQQQQQQQQQ.Q
  0.1   -0.00        R.LNSPHINMAELAIHNNQKQQQQQQQQQQQQ.Q
  0.1   -0.32        N.SINLLLHPNEWIRQSVINLIISVSANLTDADK.Y
  0.0    0.12        K.QVMNCMLISSSNCWNGSSGGGLFKQQTNEFIG.L
Top scoring peptide matches to query 106
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.4    0.14        K.AGSGVIVPTTNPTPIVNVVGNGNSLVVNQKNNNNQA.S
Top scoring peptide matches to query 107
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.7   -0.09        R.TPNPLQTPLAMQSAQEYPFTVNNNNSNLNSPTTAPQVS.S
  5.5   -0.13        -.VTEVLLETVMISKSFNFVEFVFDTSINEGLNGCNYS.Q
  5.4   -0.09        R.TPNPLQTPLAMQSAQEYPFTVNNNNSNLNSPTTAPQVS.S
  5.4   -0.09        R.TPNPLQTPLAMQSAQEYPFTVNNNNSNLNSPTTAPQVS.S
  5.2    0.00        K.SFELLDNPNIFLEAFNDCIENLVDMGLVFTMMFDS.S
  4.9    0.11        R.GQGSGSRSSLGQSQSQSQSQGQSQGQSQGQGQSQSQSQSQS.Q
  4.9    0.03        K.SSLVRQLSNMSNVPGVNPCDANNLPPQLNPNCDQFDS.K
  4.9    0.03        K.SSLVRQLSNMSNVPGVNPCDANNLPPQLNPNCDQFDS.K
  4.9    0.03        K.SSLVRQLSNMSNVPGVNPCDANNLPPQLNPNCDQFDS.K
  4.9    0.03        K.SSLVRQLSNMSNVPGVNPCDANNLPPQLNPNCDQFDS.K
Top scoring peptide matches to query 108
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 109
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.2   -0.09        M.SLDNEHDQFMDNLKPAVPSSSSSLSSSDLSQAEKELNQL.Q
  1.3   -0.24        K.LTASTNNNNNNNNNNHNPPSSPSLVLLHHLLMIILMGIS.L
  1.1    0.18        R.DLNNKNNTMMHYQQQQHPQQPQQSQQSQQQTQQQS.Q
  1.1    0.18        R.DLNNKNNTMMHYQQQQHPQQPQQSQQSQQQTQQQS.Q
  1.0    0.05        K.SQRNKPGFIQMPTPSNTLINNMSSLTNDHQDGGNNGGGGGD.N
  0.9   -0.09        M.SLDNEHDQFMDNLKPAVPSSSSSLSSSDLSQAEKELNQL.Q
  0.5    0.66        E.SILDELQNDNDKVNLFNNLYSIQSSIIWIIVNLTWK.Y
  0.5    0.01        K.MIDQLSIAVNSTNSQQQQQQQGQQAQQQQQQQQQTQS.V
  0.3    0.05        K.SQRNKPGFIQMPTPSNTLINNMSSLTNDHQDGGNNGGGGGD.N
Top scoring peptide matches to query 110
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.6    0.67        K.EHNPHIEALLDMETLNLILQEPQQLGLNDSHIEFLISF.Q
  7.6    0.73        K.IMGFTTNEMNFIYQVLAIILHLGNITFTSWKSEQANFT.N
  7.6    0.73        K.IMGFTTNEMNFIYQVLAIILHLGNITFTSWKSEQANFT.N
  7.2    0.69        Q.QHGNIPSPLNLSSQQTMGRNLSPVSQTNSPIVTIPPTPLER.N
  7.2    0.69        Q.QHGNIPSPLNLSSQQTMGRNLSPVSQTNSPIVTIPPTPLER.N
  5.0    0.06        T.GIPSEEFQQQQQQQQQEELQDANQGTAINDQEEVMMID.-
  5.0    0.06        T.GIPSEEFQQQQQQQQQEELQDANQGTAINDQEEVMMID.-
  5.0    0.06        T.GIPSEEFQQQQQQQQQEELQDANQGTAINDQEEVMMID.-
  5.0    0.06        T.GIPSEEFQQQQQQQQQEELQDANQGTAINDQEEVMMID.-
  5.0    0.73        K.LCITAGVGSDHYDLDALNERGVAVLEVTGSNVQSVAEHAIMT.M
Top scoring peptide matches to query 111
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8    0.06        R.SYSNSLMPNYHYNNTTTNINTNVGSNTSPQLSNSNTPNPIS.P
  1.6   -0.23        R.ETAYEGQVIDPFRYDFMEKPSFEGAEIYLPDIDVIIIGS.G
  1.3   -0.13        -.TSKETNNVSTMKPIALLLVLFTSLSLADMNMDSHSDMMSGS.H
  1.3   -0.13        -.TSKETNNVSTMKPIALLLVLFTSLSLADMNMDSHSDMMSGS.H
  1.2   -0.21        T.IFIQSRPNNSNSNSKQQQFYPPPSQQQQQYIPPAATTTK.L
  0.6   -0.33        K.LVNGLYLAGQINGTTGYEEAAAQGCIAGINAGLSYLQKPLLEL.K
  0.1    0.72        R.HEFKFSCIIQNENTFGLLLNFQSGSNFVNQHIPILTEK.P
  0.0    0.06        R.SYSNSLMPNYHYNNTTTNINTNVGSNTSPQLSNSNTPNPIS.P
  0.0    0.06        R.SYSNSLMPNYHYNNTTTNINTNVGSNTSPQLSNSNTPNPIS.P