Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0307_q2.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 22 Mar 2007 at 12:34:27 GMT
Significant hits: mALS3.5eoc  |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mALS1.5eoc  |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  mCHT2       583 aa - chitinase 2 precursor Candida albicans
                  mRBT5       |predicted| C. albicans fungus|CA2558| 241 aa
                  8527.1      |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
                  12297.1     CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
                  TRBOTR      trypsin (EC3.4.21.4 ) precursor-bovine
                  mALS4.5f    |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
                  mIPF19516   |mHYR1| validated by us| C. albicans fungus|CA1576| 900 aa
                  2663.2      |Als6| CONTIG=Contig2514 POSCDS1=42108 POSCDS2=46208
                  mEcm33.3    |predicted|m5366.2|CaECM33
                  mCrh11      |predicted| C. albicans |CA0375|: 453 aa
                  9505.1      CONTIG=Contig10101 POSCDS1=15485 POSCDS2=16807
                  mPga10      |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
                  mPga24      |predicted| mIPF5185 C. albicans |CA1678| 533 aa

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 43 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mALS3.5eoc                        Mass: 94266    Score: 866    Queries matched: 12
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   352.69   703.37   703.40   -0.03 0  32  0.78 1  R.APFTLR.W
5   385.73   769.45   769.47   -0.02 0  15  22 1  R.VIPSLNK.V
 10   448.21   894.40   894.41   -0.01 0  7  2e+002 9  L.NMPCVFK.F
24   564.80   1127.59   1127.58   0.02 0  80  9.7e-006 1  D.CSNIHVGITK.G
40   711.38   1420.75   1420.72   0.03 0  64  0.00044 1  L.TCTVSNTLTPSIK.A
43   732.86   1463.70   1463.67   0.03 0  54  0.0039 1  F.NVGGTGSSVDLEDSK.C
44   734.88   1467.75   1467.71   0.03 0  37  0.19 1  K.NVPAGYRPFVDAY.I
56   841.92   1681.82   1681.78   0.04 0  152  6.7e-013 1  L.AFNVGGTGSSVDLEDSK.C
60   878.46   1754.90   1754.86   0.03 0  131  9.1e-011 1  Y.GDVQIDCSNIHVGITK.G
63   913.40   1824.79   1824.75   0.04 0  90  1e-006 1  L.SYANEYTCAGGYWQR.A
79   1020.47   2038.92   2038.88   0.04 0  107  2e-008 1  Y.TLSYANEYTCAGGYWQR.A
83   1047.49   2092.96   2092.94   0.02 0  117  2.1e-009 1  K.GLNDWNYPVSSESFSYTK.T

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 862    Queries matched: 12
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 862    Queries matched: 12
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928

2.    mALS1.5eoc                        Mass: 69052    Score: 349    Queries matched: 7
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   448.21   894.40   894.41   -0.01 0  7  2e+002 9  L.NMPCVFK.Y
21   532.30   1062.59   1062.58   0.00 0  38  0.19 1  R.SQSKPFTLR.W
30   617.32   1232.63   1232.62   0.01 0  43  0.05 1  S.QTSVDLTADGVK.Y
35   656.34   1310.67   1310.64   0.03 0  32  0.67 1  K.YQNVPAGYRPF.I
37   661.85   1321.68   1321.65   0.03 0  79  1.3e-005 1  F.STLTCTVNDALK.S
62   887.45   1772.89   1772.85   0.04 0  43  0.05 1  K.YQNVPAGYRPFIDAY.I
 83   1047.49   2092.96   2092.94   0.02 0  117  2.1e-009 1  K.GLNDWNYPVSSESFSYTK.T

 
      Proteins matching the same set of peptides:
      21498.1                           Mass: 133402   Score: 346    Queries matched: 7
 |Als1| CONTIG=Contig20233 POSCDS1=71475 POSCDS2=75257
      13002.2                           Mass: 133694   Score: 346    Queries matched: 7
 |Als1| CONTIG=Contig10233 POSCDS1=72223 POSCDS2=76005
3.    mCHT2                             Mass: 59565    Score: 270    Queries matched: 5
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   525.29   1048.57   1048.56   0.01 0  12  76 6  K.VPLDFAFIQ.F
71   951.99   1901.96   1901.92   0.04 0  96  2.9e-007 1  S.AAPQCPYPDASLGDLLSK.V
74   647.02   1938.03   1938.01   0.02 0  (27) 2.4 1  K.LFVGVPATSNIAGYVDTSK.L
75   970.03   1938.04   1938.01   0.03 0  121  9.6e-010 1  K.LFVGVPATSNIAGYVDTSK.L
80   1020.47   2038.92   2038.89   0.03 0  48  0.014 1  K.FGAGEDPERPFDDAVVDGF.D

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 269    Queries matched: 5
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
4.    mRBT5                             Mass: 22745    Score: 264    Queries matched: 5
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
22   547.28   1092.55   1092.54   0.01 0  42  0.071 1  Q.FAGAVGNCVAK.N
31   618.80   1235.58   1235.59   -0.00 0  42  0.07 1  R.IYDQLPECAK.E
48   775.39   1548.77   1548.74   0.03 0  53  0.0055 1  C.VMPQFAGAVGNCVAK.N + Deamidation (NQ)
67   930.39   1858.77   1858.75   0.02 0  69  0.00014 1  K.QSTSSTPCPYWDTGCL.C
78   1010.41   2018.81   2018.78   0.03 0  61  0.00092 1  K.QSTSSTPCPYWDTGCLC.V

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 263    Queries matched: 5
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 263    Queries matched: 5
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
5.    8527.1                            Mass: 21461    Score: 223    Queries matched: 4
 |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   453.25   904.50   904.50   -0.01 0  26  2.6 1  K.QIFQELK.T
29   615.85   1229.68   1229.65   0.03 0  23  4.9 1  K.TDDSAPITIVAK.F
38   679.89   1357.77   1357.75   0.03 1  102  7.5e-008 1  K.KTDDSAPITIVAK.F
84   1062.05   2122.08   2122.06   0.02 0  78  1.7e-005 1  L.GGDVYELGATDNFIPVTINK.D

 
      Proteins matching the same set of peptides:
      mIPF8527|mPga29:                  Mass: 19928    Score: 223    Queries matched: 4
 189 aa - Candida albicans unknown function
      21875.1                           Mass: 22824    Score: 223    Queries matched: 4
 CONTIG=Contig20225 POSCDS1=30286 POSCDS2=30900
6.    12297.1                           Mass: 15525    Score: 151    Queries matched: 3
 CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 31   618.80   1235.58   1235.59   -0.00 1  20  9.4 3  R.IYDQIPKCAQ.E + Deamidation (NQ)
 67   930.39   1858.77   1858.75   0.02 0  69  0.00014 1  K.QSTSSTPCPYWDTGCL.C
 78   1010.41   2018.81   2018.78   0.03 0  61  0.00092 1  K.QSTSSTPCPYWDTGCLC.V

 
      Proteins matching the same set of peptides:
      24214.1                           Mass: 16067    Score: 151    Queries matched: 3
 CONTIG=Contig20166 POSCDS1=63254 POSCDS2=63697
7.    TRBOTR                            Mass: 24662    Score: 144    Queries matched: 4
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   559.27   1116.53   1116.52   0.01 0  14  45 1  K.SIVHPSYNSN.T
26   587.84   1173.66   1173.64   0.02 0  53  0.005 1  N.TLNNDIMLIK.L
85   1082.04   2162.07   2162.05   0.02 0  37  0.19 1  R.LGEDNINVVEGNEQFISASK.S
90   758.74   2273.19   2273.14   0.06 0  41  0.079 1  K.SIVHPSYNSNTLNNDIMLIK.L + Deamidation (NQ)

8.    mALS4.5f                          Mass: 167909   Score: 114    Queries matched: 1
 |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
52   825.94   1649.86   1649.83   0.03 0  114  3.9e-009 1  K.FITDQTSIDLVADGR.T

 
      Proteins matching the same set of peptides:
      13010.2                           Mass: 169769   Score: 113    Queries matched: 1
 |Als4.5'| CONTIG=Contig2201 POSCDS1=7312 POSCDS2=12093
9.    mIPF19516                         Mass: 90303    Score: 97     Queries matched: 2
 |mHYR1| validated by us| C. albicans fungus|CA1576| 900 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   521.77   1041.53   1041.52   0.01 0  34  0.38 1  R.HQDFVPATK.I
53   826.92   1651.83   1651.80   0.04 0  68  0.00018 1  T.AYQTITNNGQICLR.H + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      19734.1                           Mass: 94169    Score: 97     Queries matched: 2
 |Hyr1| CONTIG=Contig20216 POSCDS1=152490 POSCDS2=155303
      m19734.1                          Mass: 91992    Score: 97     Queries matched: 2
 |mHyr1| validated by us| C. albicans fungus 917 aa
      19516.2                           Mass: 94340    Score: 97     Queries matched: 2
 |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
10.   2663.2                            Mass: 143308   Score: 92     Queries matched: 2
 |Als6| CONTIG=Contig2514 POSCDS1=42108 POSCDS2=46208
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 30   617.32   1232.63   1232.62   0.01 0  43  0.05 1  T.QTSVDLTANGVK.Y + Deamidation (NQ)
 43   732.86   1463.70   1463.67   0.03 0  54  0.0039 1  F.NVGGTGSSVNIQDSK.C + 2 Deamidation (NQ)

11.   mEcm33.3                          Mass: 41984    Score: 64     Queries matched: 1
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   726.41   1450.80   1450.77   0.04 0  64  0.00042 1  S.DTGLSSLTGINVFK.L

 
      Proteins matching the same set of peptides:
      24311.1                           Mass: 42880    Score: 64     Queries matched: 1
 CONTIG=Contig20163 POSCDS1=164513 POSCDS2=165751
      5366.2                            Mass: 43798    Score: 63     Queries matched: 1
 |Ecm33.3| CaECM33 CONTIG=Contig10163 POSCDS1=164904 POSCDS2=166142
12.   mCrh11                            Mass: 44667    Score: 60     Queries matched: 1
 |predicted| C. albicans |CA0375|: 453 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
58   851.92   1701.82   1701.78   0.05 0  63  0.00057 1  F.GGDPYQWQSNYFIK.G

 
      Proteins matching the same set of peptides:
      14360.2                           Mass: 46818    Score: 60     Queries matched: 1
 |Crh11| CONTIG=Contig10158 POSCDS1=92919 POSCDS2=94280
      24611.1                           Mass: 47890    Score: 60     Queries matched: 1
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
13.   9505.1                            Mass: 49296    Score: 59     Queries matched: 4
 CONTIG=Contig10101 POSCDS1=15485 POSCDS2=16807
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   352.69   703.37   703.33   0.04 0  18  21 3  R.APQTMR.Q + Deamidation (NQ)
17   514.32   1026.62   1026.56   0.06 0  42  0.062 1  I.VEPAQELLK.I + Deamidation (NQ)
 62   887.45   1772.89   1772.79   0.10 1  3  5.1e+002 10  K.KYFNAVNGMLDEQID.F + Deamidation (NQ); Oxidation (M)
 107   1489.62   4465.84   4465.99   -0.16 1  4  3.3e+002 2  R.HAAMNSPPPTGASSIASTGTGGELPAYSPGGYNQPYGDSKYQPPS.S + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      26118.1                           Mass: 53875    Score: 58     Queries matched: 4
 CONTIG=Contig20101 POSCDS1=15540 POSCDS2=16862
14.   mPga10                            Mass: 23610    Score: 56     Queries matched: 2
 |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 31   618.80   1235.58   1235.59   -0.00 0  42  0.07 1  K.IYDQLPECAK.E
 48   775.39   1548.77   1548.74   0.03 0  17  23 4  C.VMPQFGGAIGDCVAK.N

 
      Proteins matching the same set of peptides:
      20169.1                           Mass: 25603    Score: 56     Queries matched: 2
 |Pga10| CONTIG=Contig10231 POSCDS1=59560 POSCDS2=60312
      21543.1                           Mass: 25731    Score: 56     Queries matched: 2
 CONTIG=Contig20231 POSCDS1=59564 POSCDS2=60316
15.   mPga24                            Mass: 52805    Score: 47     Queries matched: 1
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
33   635.84   1269.67   1269.64   0.03 0  47  0.02 1  K.VITVVACDEHK.C

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 47     Queries matched: 1
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 47     Queries matched: 1
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
16.   4477.2                            Mass: 84912    Score: 41     Queries matched: 1
 CONTIG=Contig10215 POSCDS1=240696 POSCDS2=242981
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   514.32   1026.62   1026.56   0.06 0  42  0.062 1  K.VAPEEELLK.F

 
      Proteins matching the same set of peptides:
      22371.1                           Mass: 92252    Score: 41     Queries matched: 1
 CONTIG=Contig20215 POSCDS1=240199 POSCDS2=242484
17.   2988.1                            Score: 35     Queries matched: 2
 CONTIG=Contig2500 POSCDS1=59732 POSCDS2=62020
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 26   587.84   1173.66   1173.60   0.06 1  28  1.7 3  I.SQLNNLNNKK.S + 2 Deamidation (NQ)
 83   1047.49   2092.96   2092.87   0.09 1  9  1.3e+002 7  M.ASHSNSNSNSLFQNDKNNN.S + 2 Deamidation (NQ)

18.   18798.2                           Score: 34     Queries matched: 2
 CONTIG=Contig10191 POSCDS1=9126 POSCDS2=11864
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 39   701.94   1401.86   1401.76   0.10 1  20  13 2  R.PYNVNLVEKGIR.E + Deamidation (NQ)
 55   839.93   1677.84   1677.82   0.02 1  15  31 3  E.ENNNLIRFNDLSVK.L + 3 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      8893.2                            Score: 32     Queries matched: 2
19.   1827.2                            Score: 30     Queries matched: 2
 CONTIG=Contig10216 POSCDS1=228365 POSCDS2=229999
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 24   564.80   1127.59   1127.51   0.08 0  14  33 6  V.QTAYANGSSTK.Y + Deamidation (NQ)
 52   825.94   1649.86   1649.76   0.09 0  18  17 4  -.MSIEQTLSQYLPSH.P + Deamidation (NQ); Oxidation (M)

20.   11835.3                           Score: 29     Queries matched: 1
 CONTIG=Contig20204 POSCDS1=19727 POSCDS2=21805
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   514.32   1026.62   1026.67   -0.05 0  31  0.81 3  F.IVTVLELIK.R

 
      Proteins matching the same set of peptides:
      28414.1                           Score: 29     Queries matched: 1
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   417.24   832.46   832.47   -0.01 0  27  2.5 1  IPYINTI
9   441.79   881.56   881.46   0.10 0  25  3.1 1  LQGPDQPK
46   743.40   1484.79   1484.66   0.12 0  25  3.5 1  MSNFSNLSLNNLM + Deamidation (NQ)
14   500.32   998.62   998.54   0.08 0  23  4.5 1  QLQQLLQQ + Deamidation (NQ)
39   701.94   1401.86   1401.71   0.15 0  23  6.7 1  INEVENISESLR
27   594.33   1186.64   1186.53   0.11 1  23  5.1 1  KAMNSNFNFL + 2 Deamidation (NQ)
20   525.29   1048.57   1048.63   -0.06 1  22  6.8 1  SSLFINKLK
82   1035.98   2069.94   2070.05   -0.11 0  20  11 1  YCVPIIFLFFFCFLGK
55   839.93   1677.84   1677.83   0.01 1  19  14 1  SEKTVQEDVLESSVK + Deamidation (NQ)
57   846.41   1690.80   1690.80   0.00 1  18  16 1  LFLPQMQMKSHWN + 2 Oxidation (M)
45   739.36   1476.70   1476.78   -0.08 1  18  17 1  KAVYKPEISAEDK
32   632.86   1263.70   1263.49   0.22 0  18  19 1  SNNDNNNDNIK + 3 Deamidation (NQ)
12   486.24   970.47   970.54   -0.07 0  17  17 1  VLNLDQLR + Deamidation (NQ)
25   574.83   1147.65   1147.61   0.04 1  17  22 1  RSPLLGGNPTH
7   406.04   810.06   810.52   -0.46 0  17  33 1  SLVIGPIL
15   500.57   999.13   998.58   0.56 1  15  56 1  LKLIVQDGN
36   659.82   1317.63   1317.63   0.00 1  15  36 1  RQSVEGDSNGLR + Deamidation (NQ)
41   716.87   1431.73   1431.75   -0.03 1  14  39 1  GANLHVIKSSMFK + Deamidation (NQ)
72   636.70   1907.08   1906.79   0.29 1  14  51 1  VQDVANGTLNQNSDKNGQ + 6 Deamidation (NQ)
10   448.21   894.40   894.48   -0.08 0  13  48 1  QEVVVPPQ
13   491.24   980.48   980.45   0.03 0  13  51 1  NPDPEDVPV
100   1368.92   4103.74   4103.68   0.05 1  11  62 1  YPKHMEYETYEQLNYILNQFDNLEMMNHDNMS + 2 Deamidation (NQ); 3 Oxidation (M)
2   603.34   602.33   602.30   0.03 0  11  99 1  QGNATL
51   806.37   1610.72   1610.86   -0.14 1  11  80 1  HFMVVAAPLKTQPR + Deamidation (NQ); Oxidation (M)
77   989.00   1975.98   1976.09   -0.11 1  11  80 1  LPELNQPLIPQLRSAASK + 2 Deamidation (NQ)
16   501.78   1001.54   1001.53   0.02 0  10  97 1  ASIHAFTQK
28   606.86   1211.70   1211.59   0.11 0  10  1.1e+002 1  KPSASNFGNYK
49   780.44   1558.88   1558.82   0.06 1  10  1.2e+002 1  KLGANYAPCVKPQL + Deamidation (NQ)
6   405.71   809.40   809.44   -0.04 0  10  81 1  NPAIAPAR + Deamidation (NQ)
88   1117.00   2231.98   2231.22   0.76 1  9  1.3e+002 1  VPEQLQPLLTFPLHKLDNK + 2 Deamidation (NQ)
65   921.51   1841.01   1840.78   0.24 0  9  1.4e+002 1  EHGMGAIMNGIAAFGANY + 2 Deamidation (NQ); Oxidation (M)
86   1088.46   2174.91   2174.88   0.03 1  9  1.5e+002 1  SEGEDIDEYGFPKDSLDME
19   1048.99   1047.99   1047.40   0.59 0  8  3.1e+002 1  NAYAMSYNN + Deamidation (NQ)
95   850.76   2549.27   2549.24   0.03 0  8  1.5e+002 1  IETINSIMTNTEDLIISNNGDLK + 2 Deamidation (NQ)
92   1189.03   2376.04   2376.39   -0.34 1  8  1.6e+002 1  LSKFTAILLAVLIALFACALTQ
81   1026.98   2051.94   2051.86   0.08 1  8  1.6e+002 1  EQQQQKQEASNSESGSGSGS
47   755.38   1508.75   1508.86   -0.11 1  8  1.8e+002 1  LKQINELKPDPSK
59   874.92   1747.82   1747.85   -0.03 1  7  1.9e+002 1  ILKPEIEPKYDSDDS
73   966.98   1931.95   1932.03   -0.07 1  7  1.9e+002 1  VNPVKLPMSTLETLNLY + Deamidation (NQ)
70   946.45   1890.89   1890.99   -0.10 1  7  2.1e+002 1  YFHKITSPSQLTGLWI + Deamidation (NQ)
99   1202.85   3605.54   3605.59   -0.05 1  7  2.1e+002 1  SQTQMPPQPTVPITSMGAATTTSSHQQANMPSRS + 3 Deamidation (NQ); 3 Oxidation (M)
64   921.41   1840.81   1841.00   -0.19 1  6  2.5e+002 1  LKVEATGNSNINVIDVR
104   1423.26   4266.75   4266.14   0.60 1  6  2.1e+002 1  SEIPLTIPAGVDNNGKPIGTNKFYTNLLLGNQDFMVYPL + 3 Deamidation (NQ)
34   643.81   1285.60   1285.54   0.06 0  5  2.9e+002 1  QQQQQQSQPSP + 3 Deamidation (NQ)
54   831.92   1661.82   1661.92   -0.10 0  5  3.1e+002 1  VFYSGLIPSLFGLLH
91   1188.51   2375.02   2374.98   0.03 1  5  3.3e+002 1  YDQPENKEEIMSNPSMLADF + 2 Deamidation (NQ); Oxidation (M)
93   1266.51   2531.00   2531.25   -0.24 1  5  4.1e+002 1  ESLMFIKIKPSSDTGSYSINNLS + Deamidation (NQ)
68   931.91   1861.80   1861.99   -0.19 1  5  3.5e+002 1  KPVARMQCIQSIYVVA
61   590.66   1768.95   1768.91   0.04 1  5  3.7e+002 1  LQKAILCQLFNYQK + 3 Deamidation (NQ)
76   647.99   1940.96   1940.96   -0.00 0  4  3.7e+002 1  HQQWTANDIVYDIPLK + Deamidation (NQ)
107   1489.62   4465.84   4465.93   -0.10 1  4  3e+002 1  SGGISEKNNPHFPSSLAHQIPNTSSPSTCSSSTSMAFQNHFS + 4 Deamidation (NQ)
69   937.47   1872.93   1872.97   -0.04 0  4  4.1e+002 1  QIFNLVELYNIMFTK + Deamidation (NQ)
94   1269.52   2537.04   2537.16   -0.12 1  4  5.2e+002 1  VWYDNKDQILNNSVPVGADEPY + 2 Deamidation (NQ)
106   1476.93   4427.78   4427.84   -0.06 0  4  3.7e+002 1  MFGNKPATSGTGFSFGQTNQTAANGTNQTSQQQQQQPAVTIGS + 13 Deamidation (NQ)
102   1422.92   4265.75   4265.94   -0.19 0  3  4.5e+002 1  LFVSDQLINSTNNTEQSSCGITSLAFRPQDALNFACGTS + 3 Deamidation (NQ)
50   797.90   1593.78   1593.84   -0.06 0  3  5.5e+002 1  IVAFVSAIGEISMNK + Oxidation (M)
98   1197.18   3588.53   3588.74   -0.21 1  3  5.3e+002 1  NHWLVFVTFLQHTDPTMPHYTSKEWTFAR
97   1178.84   3533.49   3533.76   -0.27 1  3  5.5e+002 1  YAHNFTSDPEEILNQYTVLIIPKTVIGDNAR + 3 Deamidation (NQ)
87   1108.01   2214.00   2213.95   0.05 0  2  6.6e+002 1  NVGYLVVNEDSQFQVPNGSGS + 5 Deamidation (NQ)
96   1023.79   3068.36   3068.32   0.04 1  2  6.4e+002 1  GRGSNHNSWNQQPYGSVPPPPQQQPYGS + 5 Deamidation (NQ)
3   622.08   621.07   620.28   0.79 0  0  1.5e+003 1  GGGSTDK
1   396.12   395.11        
66   921.89   1841.76        
89   1137.09   2272.16        
101   1403.95   4208.83        
103   1067.48   4265.91        
105   1457.94   4370.80        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : semiTrypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 107

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 19 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.2    0.03        K.QGNATL.Y
 10.7    0.03        R.NANATI.D
  6.1    0.04        R.GDLIEG.W
  6.1    0.11        K.GDPEQG.R
  6.1    0.04        K.GLEVEG.E
  6.1    0.00        K.ISVVEG.I
  6.1    0.00        R.IVSVEG.T
  6.0    0.00        K.LLATEG.P
  5.7   -0.01        K.KPKSSG.K
  5.3    0.04        R.NSPVSV.N
Top scoring peptide matches to query 3
Score greater than 13 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.1    0.79        T.GGGSTDK.T
  0.1    0.79        S.NGSTDK.S
  0.1    0.79        E.NGSTNK.A
  0.1    0.78        S.NGSTSR.E
Top scoring peptide matches to query 4
Score greater than 42 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 31.9   -0.03    1  mALS3.5eoc APFTLR
 27.9    0.00                  R.APFDVR.G
 17.6    0.04   13  9505.1     R.APQTMR.Q
 16.2    0.05                  L.ADEDVR.K
 16.2    0.02                  L.ADQITR.R
 14.7   -0.03                  PAFLTR
 14.7    0.00                  D.PAFVNR.I
 14.1   -0.02                  E.APFIEK.V
 14.1    0.01                  L.APMIEK.G
 14.1   -0.00                  N.APMKNK.Q
Top scoring peptide matches to query 5
Score greater than 26 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 15.1   -0.02    1  mALS3.5eoc R.VIPSLNK.V
 14.7   -0.01                  K.VIPSIIQ.E
 14.4    0.09                  K.SPFEPPP.T
 12.3    0.03                  K.GEPLLIE.G
 12.3    0.02                  K.GPEILNK.Y
 12.3    0.02                  K.GPELLNK.Y
  8.0    0.05                  K.NPPVTNK.V
  6.0    0.04                  Y.QVSATHK.L
  6.0    0.05                  H.PSIYYK.R
  6.0    0.05                  T.SPLYYK.I
Top scoring peptide matches to query 6
Score greater than 21 indicates homology
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.7   -0.04        T.NPAIAPAR.R
  7.8    0.02        K.KTQMMGV.E
  7.5    0.03        N.QFNIMR.N
  7.4    0.02        K.KMFNNR.R
  7.4    0.09        G.QMNMNR.I
  7.3    0.03        R.KMDSSSR.D
  6.4    0.05        K.QNFNMR.F
  6.3    0.03        A.KNSSSMR.Q
  6.3    0.05        K.QNFNMR.F
  6.0    0.02        Y.QGVYGMR.Q
Top scoring peptide matches to query 7
Score greater than 28 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.5   -0.46        R.SLVIGPIL.R
 15.1    0.76        R.STDGSQSQ.N
 12.6    0.71        N.STDSGTSR.Q
 10.0    0.69        R.SSSVSTKN.T
  9.5   -0.42        R.LDLAGPLL.A
  9.1    0.67        A.SKAFDNK.L
  8.4    0.66        K.SDHQVKP.Y
  7.5    0.63        A.SKVFSSR.N
  7.5    0.75        R.SQFEGEN.D
  7.5    0.67        S.SQFVSNK.S
Top scoring peptide matches to query 8
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.5   -0.01        C.IPYINTI.-
 14.3    0.03        V.IPYTPDK.N
 14.3   -0.04        N.LPYLVTK.G
 13.1    0.06        H.LPNFDAR.A
 13.0   -0.04        R.IFIVQTI.A
 12.6   -0.01        R.IPPPPLEA.S
 12.6   -0.02        S.LPGYAGKK.R
 12.6   -0.04        R.LPKYLTV.H
 12.6    0.02        V.LPQYNAK.C
 12.2   -0.01        R.IFIKEPS.R
Top scoring peptide matches to query 9
Score greater than 30 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.8    0.10        V.LQGPDQPK.F
 16.5    0.09        T.LQHKDNK.Q
 14.7    0.09        M.LKEHNNK.R
 13.9    0.04        M.IAPNLLQI.I
 12.8    0.09        K.IQRHSLE.N
 12.4    0.10        R.IKHQDEL.D
 12.4    0.10        R.IKNHEEI.Y
 12.4    0.19        R.IQCGYQN.Y
 12.4    0.12        K.LKHNQQN.T
 12.4    0.12        K.LKHNQQN.T
Top scoring peptide matches to query 10
Score greater than 25 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 12.9   -0.08                  K.QEVVVPPQ.V
 11.2   -0.08                  L.QTYKQVK.E
  9.5   -0.08                  T.KQSFTGVK.R
  9.3   -0.10                  G.KNFYPVK.H
  9.1   -0.05                  C.QSIMSSVK.Y
  7.4   -0.14                  A.VTRVGHVK.S
  7.3   -0.01                  A.KQMSGSQK.N
  6.7   -0.05                  R.KQVTGYQA.F
  6.6   -0.01    1+ mALS3.5eoc NMPCVFK
  6.5   -0.01                  R.QQVNYDK.W
Top scoring peptide matches to query 11
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.1   -0.01    5  8527.1 K.QIFQELK.T
 21.1   -0.04              A.KIEQFLK.L
 21.1   -0.01              QLEQFLK
 19.9   -0.04              H.QIFLKEK.L
 19.6    0.03              T.KLEQMEK.N
 19.6    0.06              H.QLQQMQK.T
 18.2   -0.01              K.VPPPAPSLQ.V
 17.1   -0.08              V.KLISGFIK.V
 16.7    0.03              K.QFIQELQ.M
 16.5   -0.05              E.KLSGLLMK.A
Top scoring peptide matches to query 12
Score greater than 25 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.1   -0.07        S.VLNLDQLR.Q
 11.1   -0.02        A.YFTTGNLR.D
 11.0   -0.05        G.QPSKDAVAR.S
 10.3   -0.09        E.KAQDLQIR.V
 10.1    0.07        K.NENGNTALH.W
 10.0   -0.07        L.EVVVQVAAR.A
  9.5    0.05        K.SSQLGTSQY.R
  9.4   -0.09        G.NIVNNKLR.G
  8.6   -0.11        L.IVNKINIR.V
  8.5   -0.11        K.TIILQDLR.A
Top scoring peptide matches to query 13
Score greater than 20 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.7    0.03        Y.NPDPEDVPV.-
  7.1    0.05        K.QMSQSRQV.Y
  5.8    0.07        R.GPHYNFMV.T
  2.5    0.02        L.QSEFGQRK.K
  2.3   -0.03        W.NPDKHSVGK.N
  2.0    0.08        K.ENPNDMVY.A
  0.8   -0.02        R.NNIQAPPGIG.M
  0.8   -0.02        R.SVIPNQHSV.S
  0.1    0.01        A.ASAAAGYGSAR.Y
Top scoring peptide matches to query 14
Score greater than 31 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 23.3    0.08        -.QLQQLLQQ.Q
 17.8    0.00        H.QLAIVSLQK.L
 17.6    0.04        K.QLQQLIEK.L
 16.3    0.07        L.KTLNHATSK.Q
 15.9    0.11        N.KITEMFSK.I
 15.9    0.00        K.KLTSPIVNK.W
 15.9    0.04        E.QLQVTPSVK.Q
 15.9    0.11        K.QLTANNIPQ.A
 15.9    0.11        K.QLTANNIPQ.A
 15.8    0.00        F.KLVPSSQIK.Y
Top scoring peptide matches to query 15
Score greater than 22 indicates homology
Score greater than 45 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.0    0.56        R.LKLIVQDGN.M
 15.0    0.62        R.LSRPLEGGGN.G
 15.0   -0.41        K.SGKPVVRSNG.V
 15.0   -0.31        K.STTFMRSNG.Y
 15.0    0.66        K.THLQSKNGN.S
 15.0   -0.33        K.THLQSKNGN.S
 14.4   -0.44        R.VLETLVRGN.T
 14.4   -0.32        K.VSTTTFSSNG.T
  9.1   -0.36        G.PAMPPQGFR.N
  9.1   -0.38        P.PPAITQSMR.N
Top scoring peptide matches to query 16
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.2    0.02        I.ASIHAFTQK.G
  9.3    0.01        K.GTLQNLDLK.S
  8.3   -0.03        E.LASKINDIK.D
  6.4    0.04        K.IASQINLNE.L
  6.3    0.09        K.MFNFEAVK.N
  5.8   -0.03        E.TALNEITIK.V
  5.1   -0.03        A.TGLVGSQIVK.V
  5.1    0.05        K.TGNCPNLVK.G
  5.0    0.04        V.TGVNPQSAVK.T
  4.4    0.06        R.SMANPPAAVK.M
Top scoring peptide matches to query 17
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.0    0.06   16  4477.2  K.VAPEEELLK.F
 42.0    0.06   13  9505.1  I.VEPAQELLK.I
 30.8   -0.05   20  11835.3 F.IVTVLELIK.R
 30.8   -0.05               K.LISLVELIK.L
 27.9   -0.02               M.ALNKVQLIK.L
 27.9    0.02               L.LLDPSELLK.L
 27.9    0.01               N.NAIINQIIK.S
 27.9   -0.02               E.NGKLLELLK.I
 27.9    0.02               T.NSPLLELLK.F
 27.9    0.08               L.PGQENELLK.K
Top scoring peptide matches to query 18
Score greater than 33 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein   Peptide
 33.8    0.01    9  mIPF19516 R.HQDFVPATK.I
 18.7    0.10                 K.HAGLDDNATQ.L
 10.7    0.10                 K.HAGLDDNATQ.L
 10.1    0.05                 L.HKASMMGHK.V
  7.2    0.07                 I.ENFMAWTK.M
  7.0    0.01                 I.KTANVDHTR.H
  6.3    0.02                 Q.HKDENATVK.I
  6.3    0.01                 Q.HKWDQLSK.I
  5.3   -0.09                 K.LRDTLPVTK.N
  5.2    0.05                 L.HKASMMGHK.V
Top scoring peptide matches to query 19
Score greater than 20 indicates homology
Score greater than 46 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.5    0.59        K.NAYAMSYNN.Y
  8.5    0.59        K.NAYAMSYNN.Y
  8.5   -0.39        K.NAYAMSYNN.Y
  8.5   -0.39        K.NAYAMSYNN.Y
  8.3   -0.62        V.GQMFVKVLK.K
  7.0    0.35        W.AILVQIYTK.L
  5.7   -0.61        W.VQSLASFIGK.I
  5.7    0.35        I.IAQIVLYTK.K
  5.2    0.50        K.LAMEISQQQ.K
  5.2    0.50        K.LAMEISQQQ.K
Top scoring peptide matches to query 20
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.1   -0.06             L.SSLFINKLK.L
 15.1    0.03             T.SSIAQTNAKK.N
 13.8    0.00             T.SNASLAAFLR.N
 13.6    0.07             G.CDMNLGVLK.N
 12.6    0.03             I.CNTAPVFLK.I
 11.6    0.01    3  mCHT2 K.VPLDFAFIQ.F
 11.3   -0.01             I.TANFLLELK.L
 10.5   -0.03             A.SVYRAVNLK.T
 10.0    0.04             M.SSIAQELSTL.P
  9.9    0.12             T.CTPQNATEK.S
Top scoring peptide matches to query 21
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 37.6    0.00    2  mALS1.5eoc R.SQSKPFTLR.W
 19.3    0.09                  K.QSSGPSAKSSQ.I
 17.7    0.06                  S.SQSQKSSPSK.K
 16.5    0.02                  A.KSGASSVASAAK.S
 16.4    0.02                  G.SKSQLTGTNK.H
 15.1    0.02                  R.KAAPPAPVQSP.S
 14.1    0.19                  K.SNEQGDKMH.I
 12.5    0.08                  S.NTNASSGQKR.I
 12.5    0.07                  G.NTSKQVEQK.R
 11.3    0.14                  P.QSSYFMQR.N
Top scoring peptide matches to query 22
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 41.6    0.01    4  mRBT5 Q.FAGAVGNCVAK.N
 16.2   -0.04             K.KMTVLTGAGIS.C
 15.6   -0.01             G.KMTNGTINAK.I
 14.0    0.05             R.NSTIADGSAGVT.S
 12.4   -0.05             D.KAIATYNGQK.F
 12.0    0.02             A.QSMAAATNTAK.Q
 11.8    0.07             -.MTVSPNTAEQ.A
 10.4    0.05             K.QSSELSNAQK.N
 10.4    0.04             W.KADGPYNAEK.Y
 10.2    0.02             K.VTETNSNKTV.S
Top scoring peptide matches to query 23
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.5    0.01    7  TRBOTR K.SIVHPSYNSN.T
  6.6    0.14              K.QMEQEFSSN.H
  6.3    0.03              K.IANLEENNSN.K
  6.2    0.05              K.VYRNYSNSN.N
  5.3    0.13              R.GNMNTQGTYN.N
  5.3    0.13              R.GNMNTQGTYN.N
  5.0    0.08              -.SNSMLHPNNS.V
  5.0    0.10              K.TASGHSEGEEN.I
  3.9    0.03              K.NVTSTQKHSN.S
  3.7    0.04              R.ANGQVGICPSN.Y
Top scoring peptide matches to query 24
Score greater than 38 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 79.8    0.02    1  mALS3.5eoc D.CSNIHVGITK.G
 20.7   -0.00                  L.AGTSSHLGGTIK.T
 15.9    0.07                  R.RYFQNGLTQ.L
 15.9    0.09                  K.SETDYNGLTK.N
 15.4    0.03                  F.KSFQQFNTK.Y
 14.5    0.08   19  1827.2     V.QTAYANGSSTK.Y
 13.0   -0.00                  K.SNNSIHKVTK.P
 12.9   -0.03                  V.DLIPNTNITK.E
 12.8   -0.00                  K.SNNSIHKVTK.P
 12.5   -0.03                  T.IKDGEQPLTK.T
Top scoring peptide matches to query 25
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.0    0.04        R.RSPLLGGNPTH.R
 13.1    0.18        Y.QNDQRQNDK.Q
 12.2   -0.04        E.KPNLIPQIPK.I
 11.8    0.06        F.VGSPLMNSSIK.S
 10.0    0.18        K.QDPQRESNSS.E
  9.6    0.18        Y.QNDQRQNDK.Q
  9.1    0.23        K.ENENSESNPQ.A
  8.8    0.15        K.KDDVDNINSQ.A
  8.7    0.02        L.KLVSSMKPSR.I
  8.6    0.10        I.PQNGLFNETK.N
Top scoring peptide matches to query 26
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 53.3    0.02    7  TRBOTR TLNNDIMLIK
 28.9    0.12              H.VNNNNNNDKK.T
 28.0    0.06   17  2988.1 I.SQLNNLNNKK.S
 23.8    0.02              N.FNVENPTLIK.T
 22.3    0.05              T.TLDDIINELK.L
 21.6   -0.02              I.NFVLNLVNIK.W
 20.5    0.06   17  2988.1 I.SQLNNLNNKK.S
 19.3    0.06              Q.TNLNDNKEVK.G
 18.0    0.01              L.ITLTQLIENK.Q
 17.9    0.07              R.TLNQNVLVESG.H
Top scoring peptide matches to query 27
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 23.1    0.11        K.KAMNSNFNFL.S
 12.2    0.11        K.KAMNSNFNFL.S
 10.8    0.13        L.YNDYVSNPSK.F
  3.1    0.13        I.FSPQGMNFMK.R
  1.1    0.22        H.NYENSDSNDK.D
  1.1    0.02        V.LPDVLGEAVMK.N
  0.5   -0.77        H.NYENSDSNDK.D
Top scoring peptide matches to query 28
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.8    0.11        M.KPSASNFGNYK.M
  7.9    0.03        K.LEAKLNSINPI.R
  5.4    0.08        K.LSLKQCSYLT.D
  5.0    0.10        R.GALVMLWQFF.T
  4.9    0.06        K.VVDKPTTANIGP.H
  2.6    0.12        K.QAKPNTLYNY.D
  2.0    0.29        R.QPSQQNNNYN.N
  1.9    0.04        K.QVLTPVNERR.T
  1.2    0.12        T.KLPDGDYNYK.T
  1.2    0.06        K.KQSQPSIIPNV.N
Top scoring peptide matches to query 29
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 23.2    0.03    5  8527.1 K.TDDSAPITIVAK.F
 10.3    0.12              K.KYGGNEYSDVV.I
  9.9   -0.02              V.NTALALNSLGKK.V
  9.7    0.01              S.TPNSLNIGKSAK.L
  9.5    0.14              S.TDNSNKMFTR.F
  8.0    0.13              R.TNDVTTTFSFP.E
  6.9    0.04              K.QNQIILTMAPT.A
  5.7    0.16              D.TNDDEGIFYR.S
  5.6    0.15              E.ESTTAAHEDNR.N
  5.2    0.05              K.TGAFPAPVATNAI.A
Top scoring peptide matches to query 30
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 43.3    0.01    2  mALS1.5eoc QTSVDLTADGVK
 43.3    0.01   10  2663.2     T.QTSVDLTANGVK.Y
  9.4    0.09                  K.QEITQLQNEQ.I
  6.9   -0.01                  R.TALNNSTNKIR.D
  6.9   -0.01                  R.TALNNSTNKIR.D
  6.8    0.13                  K.QETGNTSHMQV.P
  6.1    0.07                  K.DGGEGDSTVQIR.F
  5.8   -0.08                  T.KQVQFISVGVK.S
  5.1    0.03                  D.QELQSQQSRK.Y
  5.1    0.03                  D.QELQSQQSRK.Y
Top scoring peptide matches to query 31
Score greater than 35 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 41.7   -0.00    4+ mRBT5   IYDQLPECAK
 41.7   -0.00               K.LYDQLPECAK.P
 20.5   -0.00    6  12297.1 R.IYDQIPKCAQ.E
 16.3   -0.03               S.LYENLINDSR.F
 14.0   -0.01               K.LTQFLIQNEE.Q
 13.7   -0.01               K.LTQFLIQNEE.Q
 13.0   -0.02               R.YINKILNDDQ.S
 13.0   -0.05               I.YLNKLNDLDK.A
 11.7   -0.05               I.YLGGEIQELSK.K
 11.5   -0.03               -.KLSFQNQDIGS.S
Top scoring peptide matches to query 32
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.6    0.22        D.SNNDNNNDNIK.N
 15.2    0.14        R.TTGCEVEIDLQ.K
 10.3    0.18        R.NSNSSSSLKNSH.K
 10.2    0.09        T.QYSLSHDSSLK.G
  9.1    0.19        Q.SDNDNDVQEVK.Y
  8.8    0.14        S.GSDDEIQQMIK.D
  7.6    0.12        Q.LQNITDSTNEK.F
  7.6    0.12        Q.LQNITDSTNEK.F
  7.1    0.22        D.SNNDNNNDNIK.N
  7.1   -0.78        H.TTNNNNNNNNK.V
Top scoring peptide matches to query 33
Score greater than 28 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.9    0.03   15  mPga24 K.VITVVACDEHK.C
 13.0   -0.01              R.TPITSTSSALVPP.S
  8.9   -0.06              N.IADIVQDQLKK.E
  7.1   -0.01              V.TNPVILQDLQK.F
  7.1   -0.01              V.TNPVILQDLQK.F
  6.8    0.01              T.PNISTQPAANKK.Q
  6.7   -0.06              R.IVLSQVNEIQK.H
  6.4    0.05              L.PDTAPEELDRK.T
  6.4    0.10              T.LAEVEGSFCMK.L
  6.4    0.04              D.IVTECETYKK.G
Top scoring peptide matches to query 34
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.06        K.QQQQQQSQPSP.T
  4.2   -0.04        -.TRQQQQQQLQ.R
  4.2    0.00        S.QKEQVMHEQK.Q
  4.2   -0.04        N.FTTMAHPGRPR.G
  3.7    0.06        K.QQQQQQSQPSP.T
  3.6   -0.02        R.QQQQQPLSSIQ.F
  3.3    0.21        -.NNDENNCQSST.L
  3.3    0.21        -.NNDENNCQSST.L
  3.3    0.21        -.NNDENNCQSST.L
  3.0   -0.03        Q.QQQQQQQQLK.H
Top scoring peptide matches to query 35
Score greater than 29 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 31.7    0.03    2  mALS1.5eoc K.YQNVPAGYRPF.I
 14.3    0.02                  T.YQNVSTGSNITK.W
  8.3    0.02                  D.NQIFFNREIK.N
  8.3    0.15                  R.QYNLQQQQQQ.Q
  7.5    0.13                  N.YQNDQRQNDK.Q
  7.5    0.13                  N.YQNDQRQNDK.Q
  5.5    0.15                  R.KDDGQDFENQI.E
  5.3    0.07                  K.QYNTTNTNIIE.E
  4.0    0.05                  K.NFIEMNKLWV.R
  3.8    0.04                  K.RNFLEFQQTQ.I
Top scoring peptide matches to query 36
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.7    0.00        L.RQSVEGDSNGLR.R
  8.5   -0.08        L.SSLQNLTNKALK.Q
  8.0   -0.06        T.RHLHNSTPSLR.A
  7.9   -0.05        P.SSSPITINSSPTK.E
  7.0   -0.03        I.RQPAIDFNNLK.T
  6.9    0.02        L.SSLYSNFEKNK.I
  6.0    0.02        N.NGNSNPTIQNKK.K
  5.3    0.01        SSIPSVNQNQSR
  5.3    0.01        SSIPSVNQNQSR
  5.3    0.01        SSIPSVNQNQSR
Top scoring peptide matches to query 37
Score greater than 37 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 79.1    0.03    2  mALS1.5eoc F.STLTCTVNDALK.S
 19.7    0.01                  Q.STIIKMSHYDK.L
 17.7    0.09                  N.STIQQSVENADK.I
 17.1   -0.03                  K.YGTKLINETIVA.S
 12.9   -0.04                  R.TSLTTTNSKTIR.F
 12.1    0.03                  I.TSNQLIFNINR.L
 10.7    0.08                  K.NANRDAIMSSSR.V
  9.4    0.06                  S.SVDTQLQNSSIK.I
  9.4   -0.01                  N.SVDLTEQFKQK.R
  9.1   -0.02                  K.KMIQQFQTIVA.F
Top scoring peptide matches to query 38
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
101.7    0.03    5  8527.1 K.KTDDSAPITIVAK.F
 25.0   -0.04              H.KALLEVSTSIGLK.T
 22.3    0.05              V.TGNGVVEGLKQGAK.E
 20.5    0.10              K.KQLTEDAIDPTQ.Q
 17.5    0.07              L.QNSVTPINNKIK.N
 17.5    0.07              D.SEAKEVDASPVVK.E
 17.2    0.10              K.TQSIVPNQINKN.V
 17.2    0.10              K.TQSIVPNQINKN.V
 17.2    0.10              K.TQSIVPNQINKN.V
 16.8    0.07              G.QSPESQLKEIAK.L
Top scoring peptide matches to query 39
Score greater than 34 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 23.2    0.15               D.INEVENISESLR.N
 20.4    0.10   18  18798.2 R.PYNVNLVEKGIR.E
 16.9    0.05               C.QVQFIAIKWLR.D
 16.9    0.05               C.QVQFIAIKWLR.D
 16.9    0.24               S.SSANNNNKNNPAR.T
 16.7    0.14               S.PSNSSKLSQANLR.K
 16.0    0.15               K.KLNDELQSANIR.R
 14.6    0.24               S.SSANNNNKNNPAR.T
 14.6    0.24               S.SSANNNNKNNPAR.T
 14.4    0.14               S.PSNSSKLSQANLR.K
Top scoring peptide matches to query 40
Score greater than 38 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 63.9    0.03    1  mALS3.5eoc L.TCTVSNTLTPSIK.A
 22.1    0.11                  I.NKEGNDNTSVTDK.L
 18.3    0.11                  G.NNGRHHNQVTNK.N
 18.2    0.06                  S.MILGNLWDVTDK.D
 14.1   -0.01                  P.DATKFLNGLVTSR.L
 13.9    0.11                  G.NNGRHHNQVTNK.N
 13.9    0.11                  G.NNGRHHNQVTNK.N
 13.9    0.11                  G.NNGRHHNQVTNK.N
 13.9    0.11                  G.NNGRHHNQVTNK.N
 13.8    0.10                  A.MNTQSPLVNASNK.W
Top scoring peptide matches to query 41
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.3   -0.03        S.GANLHVIKSSMFK.L
 12.0    0.03        K.IASTWEGIQAARE.L
 11.6   -0.00        K.LVAEVDMKEALASG.Q
  9.8    0.11        A.SECVVHYYMTK.K
  9.5   -0.04        S.ALGMSLIGIDALNK.L
  7.5   -0.07        A.VSISATTTPVTLSR.S
  7.3    0.00        K.QSPVSSTGVDVSIR.D
  6.8    0.00        K.PFLNTTNTPANLK.S
  6.5   -0.00        G.ILQCQTIAEDIK.Y
  6.5   -0.00        G.ILQCQTIAEDIK.Y
Top scoring peptide matches to query 42
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 64.3    0.04   11  mEcm33.3 S.DTGLSSLTGINVFK.L
 14.2    0.16                P.PTTSSSSLNNDAEK.V
 14.2    0.16                P.PTTSSSSLNNDAEK.V
 11.0    0.06                K.ESAVSTIAANPHLAA.P
 10.5    0.08                Q.QSQEYNILLDVK.T
 10.4    0.15                S.QQQSGSQHHQRK.R
 10.4    0.15                S.QQQSGSQHHQRK.R
 10.4    0.15                S.QQQSGSQHHQRK.R
  9.3    0.15                K.SDIASSAGENFVTPG.Q
  9.1    0.20                T.SPSNSNSNSSKPNK.T
Top scoring peptide matches to query 43
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 54.2    0.03    1  mALS3.5eoc F.NVGGTGSSVDLEDSK.C
 54.2    0.03   10  2663.2     F.NVGGTGSSVNIQDSK.C
  8.4    0.11                  K.DPTNGSDGEISSING.E
  6.2    0.02                  R.ATNTTTTNTTMLPP.S
  5.0   -0.13                  T.NVLEAIKPNIPEK.Y
  4.2   -0.05                  L.NLPCLEFFSLPK.C
  4.0   -0.04                  N.NISNGSNGSRFALK.S
  3.4    0.05                  K.NQQGNSAVQYPGTV.L
  2.0    0.00                  E.HHQIGSNVLSENK.N
  1.4   -0.05                  K.ANTVIILYGIDSGE.Y
Top scoring peptide matches to query 44
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 37.2    0.03    1  mALS3.5eoc K.NVPAGYRPFVDAY.I
  4.4    0.06                  Y.YNSTDQLTEIQR.I
  3.4    0.09                  K.RGPGQGQGQELQNP.Q
  3.1    0.09                  K.RGPGQGQGQELQNP.Q
  2.6   -0.09                  S.NVPVTKTLAEIQR.E
  2.3    0.15                  R.VSSDCHSLSQDFS.G
  2.1    0.15                  R.NAMDNASKNAGDMI.N
  0.2   -0.12                  G.NVPADVITSKIIAK.N
Top scoring peptide matches to query 45
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.8   -0.08        C.KAVYKPEISAEDK.L
 14.3   -0.00        R.HYLQMTGIGKSQN.T
 14.3   -0.00        R.HYLQMTGIGKSQN.T
 10.8    0.01        T.KENEANWFPVNK.L
 10.2   -0.05        G.QDGINYINIAINK.L
  9.7    0.06        F.QEGEYLANYFDK.L
  8.7   -0.05        K.NDLTTLKYVEPAN.P
  8.2   -0.03        H.QKSDNTDIISLDK.N
  8.0   -0.02        S.NGEINNGSITKSSR.Q
  6.7   -0.01        K.QTDVTKLKPCGCA.D
Top scoring peptide matches to query 46
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.6    0.12        R.MSNFSNLSLNNLM.F
 20.1    0.01        -.MSNVGLQVRQAVPS.I
 17.7    0.12        R.MSNFSNLSLNNLM.F
 17.7    0.12        R.MSNFSNLSLNNLM.F
 10.1    0.10        R.DFNGMTQFVIPSI.N
  8.0    0.12        R.TELSPQQHETNVT.T
  7.5    0.10        S.VQQSNFGRSFNLS.-
  7.5    0.10        S.VQQSNFGRSFNLS.-
  7.5    0.10        S.VQQSNFGRSFNLS.-
  6.5    0.12        R.MSNFSNLSLNNLM.F
Top scoring peptide matches to query 47
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.6   -0.11        L.LKQINELKPDPSK.G
  6.8    0.02        A.KLVAYDNDNGSWK.N
  6.4   -0.04        K.KLLQWDHQQWK.S
  6.0   -0.09        N.PNSIDAWQLKLPK.Y
  5.0   -0.04        E.QIGILQSEINQHK.Q
  4.7   -0.11        I.IKSLNDLTNIIHK.L
  4.6   -0.01        F.KIVAMNLTEMESK.V
  4.0   -0.03        S.LQKINSQVFSQSK.N
  2.4    0.02        R.IKGIQEEYEGELT.S
  2.2   -0.12        Q.LKGGQNVPLQQSLK.K
Top scoring peptide matches to query 48
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 52.8    0.03    4  mRBT5  C.VMPQFAGAVGNCVAK.N
 21.4    0.03    4  mRBT5  C.VMPQFAGAVGNCVAK.N
 16.9   -0.00              L.SGSNDSSIKLWDLK.Q
 16.6    0.03   14  mPga10 C.VMPQFGGAIGDCVAK.N
  7.5   -0.02              L.TNLKSFDWNSIPK.I
  7.1   -0.04              K.VNFQNISPFQLLK.I
  7.1   -0.04              K.VNFQNISPFQLLK.I
  6.7    0.03              Q.VNNNLSDMDRLIK.R
  6.7    0.05              K.VDEIMLETEVINQ.G
  6.3    0.08              K.KMELLEDVNDDNV.I
Top scoring peptide matches to query 49
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.8    0.06        K.KLGANYAPCVKPQL.E
  8.8    0.09        K.QLKNNSGNLEDLIT.E
  8.3    0.04        Q.QQQQAPIPVPVPVR.H
  7.5    0.14        K.LQLYNENVSQFGF.F
  6.9    0.11        D.QLPQFDQNNDVIK.E
  6.5    0.12        K.QIKSLNQTENQQQ.Q
  5.9    0.14        S.ATNLSKNFMIMEK.L
  5.6    0.07        K.KLPMVNLNETEVR.K
  5.2    0.04        Q.QQQQAPIPVPVPVR.H
  5.1    0.12        K.QIKSLNQTENQQQ.Q
Top scoring peptide matches to query 50
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8   -0.06        E.IVAFVSAIGEISMNK.S
  2.4   -0.04        E.RIVTIMQNPTNYK.I
  1.6   -0.17        R.KFFNISVVIVTLSK.M
  1.3    0.04        R.LIELNCDSINMEK.I
  1.2   -0.11        E.FNNLQKLSIINYK.S
  1.1   -0.09        Q.APRQSPELTSPAIVK.T
  0.9    0.18        R.IVGTDNNNNNNNNSS.N
  0.9    0.18        R.IVGTDNNNNNNNNSS.N
  0.8   -0.08        K.VKPVVSLTYVQVFD.H
  0.2   -0.04        E.RIVTIMQNPTNYK.I
Top scoring peptide matches to query 51
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.1   -0.14        S.HFMVVAAPLKTQPR.D
  6.9   -0.10        S.NISSGGNLTFLFWR.S
  6.9   -0.10        S.NLSSGGNLTFLFWR.S
  6.8   -0.10        A.INTANANKSHPLTTK.Q
  6.8   -0.07        A.EQQQDQQPLDLIR.F
  6.8   -0.07        A.EQQQDQQPLDLIR.F
  6.8   -0.07        A.EQQQDQQPLDLIR.F
  4.8   -0.02        K.ALDTAIASSNEYKDN.E
  4.3   -0.10        A.INTANANKSHPLTTK.Q
  2.7   -0.15        A.NGIDNKPAPIMVLTK.L
Top scoring peptide matches to query 52
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
114.4    0.03    8  mALS4.5f K.FITDQTSIDLVADGR.T
 19.7    0.08                R.MLIGSSTQFFQQFT.G
 18.7    0.09                -.MEVTQRTQSQTQPT.Q
 18.1    0.09   19  1827.2   -.MSIEQTLSQYLPSH.P
 17.8    0.17                K.QLNDENSDEKNTLQ.G
 17.8    0.17                K.QLNDENSDEKNTLQ.G
 17.8    0.17                K.QLNDENSDEKNTLQ.G
 15.9    0.03                V.QVYAIESDDLVNKR.L
 15.6    0.13                K.SVGNSMQIFAHDELT.K
 15.3    0.03                -.FLNRNNNLTSIEIT.R
Top scoring peptide matches to query 53
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein   Peptide
 67.8    0.04    9  mIPF19516 T.AYQTITNNGQICLR.H
 65.3    0.04    9  mIPF19516 T.AYQTITNNGQICLR.H
 55.2    0.04    9  mIPF19516 T.AYQTITNNGQICLR.H
 16.3    0.04    9  mIPF19516 T.AYQTITNNGQICLR.H
 15.7    0.00                 F.SETIKTSLTMPTSEK.E
 11.2    0.29                 K.DDNNNSNNNADDNDT.Q
 11.1    0.03                 Y.SFEKQTNQLLSNNK.G
 10.4    0.10                 K.VYLLNGDDWIDNGTG.F
 10.3    0.29                 K.DDNNNSNNNADDNDT.Q
 10.0    0.29                 K.DDNNNSNNNADDNDT.Q
Top scoring peptide matches to query 54
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.2   -0.10        K.VFYSGLIPSLFGLLH.V
  4.2    0.14        K.YCVLDEADTLFDDS.F
  3.0   -0.00        K.LEIHNPDMSLRSIH.T
  1.9    0.04        K.YENGAVYLTDLEKF.T
  1.3    0.08        R.LHPDTSYENIQAHH.W
  0.9   -0.04        K.TIDFNYKSLVYVLS.L
Top scoring peptide matches to query 55
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.6    0.01               K.SEKTVQEDVLESSVK.K
 17.4    0.10               A.VVQSTNEENNVNNSK.S
 15.3    0.02   18  18798.2 E.ENNNLIRFNDLSVK.L
 15.3    0.06               V.KCQNLNNQTVCAVK.V
 14.9   -0.06               S.ICGIVSIFNLNSLVK.S
 13.2    0.10               S.NSENNGEAVSAPSSSVK.L
 13.1    0.08               D.LDAWTDDQIENMVK.W
 12.4   -0.03               V.QIGNLSSYGRLQVDK.F
 12.3    0.10               A.VVQSTNEENNVNNSK.S
 12.2    0.09               W.DQQEEKMVDQVANK.F
Top scoring peptide matches to query 56
Score greater than 41 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
151.9    0.04    1  mALS3.5eoc AFNVGGTGSSVDLEDSK
 19.3    0.01                  Q.YQLGKLNTDGIQDSK.F
 15.6    0.02                  S.FANVNNAGTNLFVNGK.D
 12.1   -0.11                  M.AFCVIIGDTIPHVLK.A
 11.8   -0.02                  N.IFNNTGGEFLLQNSK.I
 10.7    0.04                  -.MSNSSIVPTYNGYIH.N
 10.2   -0.02                  P.FENLSDVADLFREK.L
  9.8    0.09                  D.MAFMQSFYNGGQKR.Q
  9.4   -0.02                  Q.TESSSTATIASGASVSVK.R
  9.1    0.02                  S.FANVNNAGTNLFVNGK.D
Top scoring peptide matches to query 57
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.1    0.00        Q.LFLPQMQMKSHWN.-
 16.4    0.06        K.NNQLIMSQQQDKQP.S
 15.2   -0.07        K.QIQVQLYESINEIL.R
 15.1   -0.07        L.ELLNMKESNLEIIK.I
 11.4    0.12        F.NQNNDNNLNNSHYK.N
 10.9    0.06        K.QPEINMSTSESPNLQ.H
 10.3   -0.03        L.IEMANSTSNPAIIMAK.D
  9.2   -0.07        K.ELLDKLSEQFIELD.F
  8.8   -0.07        K.QIQVQLYESINEIL.R
  8.6    0.03        K.VKYQVQQAQNQQQP.Y
Top scoring peptide matches to query 58
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 62.6    0.05   12  mCrh11 F.GGDPYQWQSNYFIK.G
 15.7    0.12              A.YDQNPMTSYPPMDK.S
 12.7   -0.03              L.NNPYIILPNDTKNGK.N
 12.7   -0.03              L.NNPYIILPNDTKNGK.N
 12.1    0.09              D.DNYNIESFNDTIQK.Q
 11.7    0.02              I.NNKLNSFLQMFSNK.S
 11.3   -0.00              N.GMQVQNDPNVKTIEK.D
 11.3   -0.00              N.GMQVQNDPNVKTIEK.D
 11.3   -0.00              N.GMQVQNDPNVKTIEK.D
 11.3   -0.00              N.GMQVQNDPNVKTIEK.D
Top scoring peptide matches to query 59
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.4   -0.03        R.ILKPEIEPKYDSDDS.D
  7.0    0.03        K.QLNLAEVNSKNDSNDS.Q
  5.8   -0.13        K.WNDIPLAPPDKILGIS.E
  5.8    0.04        K.HVTLYAVGYNNNFFS.R
  5.8   -0.07        R.IALVQTMEESLLNIAS.T
  5.8    0.01        K.SLGHRVGNGTTGSSSSASS.G
  5.8    0.07        K.TGAASINCVMNIHNCS.K
  5.8    0.05        R.TNNSSCNQNPAVLLQS.L
  5.8    0.05        R.TNNSSCNQNPAVLLQS.L
  5.8    0.05        R.TNNSSCNQNPAVLLQS.L
Top scoring peptide matches to query 60
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
130.5    0.03    1  mALS3.5eoc Y.GDVQIDCSNIHVGITK.G
 24.2   -0.04                  Y.GDNLLDLNLAYRIHK.L
 16.7    0.00                  K.EAAKLPNDLTLDDVLQ.-
 15.3   -0.00                  A.NKMNNTPVLVNLQPR.D
 15.3   -0.00                  A.NKMNNTPVLVNLQPR.D
 15.3   -0.00                  A.NKMNNTPVLVNLQPR.D
 14.9   -0.03                  S.INDGLDLINAIVEDLK.N
 14.9    0.04                  T.NEGVINVNDELAPELK.V
 14.8   -0.07                  A.SLAGALLLLTYIGCYK.V
 13.0    0.01                  -.MSNYHLIILVHGVWG.N
Top scoring peptide matches to query 61
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8    0.04        L.LQKAILCQLFNYQK.E
  1.5    0.03        R.KPVIANYREQIQFY.E
Top scoring peptide matches to query 62
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 43.2    0.04    2  mALS1.5eoc K.YQNVPAGYRPFIDAY.I
  8.4   -0.05                  S.QGGYVFLYELVKQTK.N
  4.0    0.11                  R.YKVNFEQLADESSED.E
  3.8    0.05                  P.QQQQQLIPSSGATEQK.V
  3.6    0.28                  T.CNNNSSSNNNNLEMR.I
  3.5    0.16                  R.YKSSDIMNQSPNELE.S
  3.4   -0.06                  E.QSAGAAIVNNLQTMVKK.K
  3.3    0.05                  P.QQQQQLIPSSGATEQK.V
  3.3    0.05                  P.QQQQQLIPSSGATEQK.V
  3.1    0.10   13  9505.1     K.KYFNAVNGMLDEQID.F
Top scoring peptide matches to query 63
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 90.1    0.04    1  mALS3.5eoc L.SYANEYTCAGGYWQR.A
  8.6   -0.08                  W.ASYNGATYYIDVFGKR.L
  6.7   -0.01                  I.SAYDEMPHIGYDINGK.R
  6.1   -0.02                  G.SSSGGHKSSSSGSVGESSSK.G
  5.7   -0.07                  R.IQPPQYEMEEYILR.V
  5.7   -0.07                  R.IQPPQYEMEEYLLR.I
  5.2   -0.11                  S.SSESSSPLIKSSISSSSR.S
  4.4   -0.05                  H.SLFHRSHHNGSNFQR.D
  3.4   -0.01                  R.HHNSDIQQANLENFR.R
  3.4   -0.01                  R.HHNSDIQQANLENFR.R
Top scoring peptide matches to query 64
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.2   -0.19        K.LKVEATGNSNINVIDVR.K
  6.1   -0.11        A.LINGNNSVIEKDDPNAK.D
  6.1   -0.11        A.LINGNNSVIEKDDPNAK.D
  5.5   -0.02        S.MNSSGSPFNFLAPSQVR.G
  1.7    0.23        K.TGNNFHNNSGNNNNSNN.G
  1.5    0.23        K.TGNNFHNNSGNNNNSNN.G
  1.5    0.23        K.TGNNFHNNSGNNNNSNN.G
Top scoring peptide matches to query 65
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3    0.24        R.EHGMGAIMNGIAAFGANY.K
  7.7    0.10        N.DLLQQIELWENFHR.G
  7.1    0.21        K.INLELSSNGGSGNSQYSN.L
  4.4    0.04        K.VTGNVKLNTLAPSIINGQ.L
  3.7    0.12        L.ELINQLTIMYNETMK.L
  3.5   -0.01        I.NKIDQLSISEAIEIIR.D
  3.2    0.06        L.LALGNENGVEGLSVDGVAK.L
  1.3    0.08        K.DILQKELLPNITQEEG.F
  1.3    0.08        K.DILQKELLPNITQEEG.F
  1.1    0.14        K.HVRIHDLGSNDNLSYT.F
Top scoring peptide matches to query 66
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 67
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 69.3    0.02    4+ mRBT5 K.QSTSSTPCPYWDTGCL.C
 11.4    0.08             K.NSTTSTSTSNANGNGNGNGT.E
 11.4    0.08             K.NSTTSTSTSNANGNGNGNGT.E
 11.4    0.08             K.NSTTSTSTSNANGNGNGNGT.E
 11.4    0.08             K.NSTTSTSTSNANGNGNGNGT.E
  6.7    0.07             M.SSSSTNNTNNNNTSALNL.Q
  5.5   -0.20             K.YFLTQPKLLYTPEFV.Q
  3.5   -0.08             K.MLLSQCNLGSLLYMQA.E
  2.7   -0.00             K.QKQQQQQFTYPSAQGS.S
  2.6   -0.19             L.GVTKSQLIDPENSSSAVK.Q
Top scoring peptide matches to query 68
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.0   -0.19        R.KPVARMQCIQSIYVVA.H
  3.1   -0.09        P.GSANLTTQSNDSVVPKNK.E
  2.8   -0.14        S.NHFALLNQIMFQKQK.V
  2.6    0.78        H.LIHHHTISLPNIHAMK.W
  2.2   -0.06        L.EQSVYDTVEQIVNAHK.L
  1.9   -0.00        D.QTTFNSIMKCDMDVR.K
  1.8    0.72        P.PLLIILFYAVIICGQK.I
  1.6    0.02        R.NNNIVHNRSMGDTISGN.V
  1.6    0.02        R.NNNIVHNRSMGDTISGN.V
  1.6    0.02        R.NNNIVHNRSMGDTISGN.V
Top scoring peptide matches to query 69
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.0   -0.04        V.QIFNLVELYNIMFTK.Q
  3.6   -0.15        P.AVSNIVIMLVLMQVAKK.L
  3.4   -0.10        D.LKDMQVEIVTELGLSAK.L
  3.2   -0.12        T.LFNLLQADIITLQELK.L
  2.3   -0.03        Q.GVSNHPNHISLFHGTKK.Y
  2.2   -0.01        A.SDVEGVQQIIDNLNISK.V
  2.0   -0.08        V.LLHNHQVNNNTLLTLK.V
  1.6   -0.06        F.QLSYIHTLQIPSTKDK.S
  1.4   -0.11        A.SGVVTLESLALVLERCK.L
  1.3   -0.02        D.NNSQLDKINPFDLKPK.L
Top scoring peptide matches to query 70
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.8   -0.10        R.YFHKITSPSQLTGLXI.X
  6.6   -0.03        A.ENDKSSSLLNSNINNIK.V
  6.2   -0.03        A.ENDKSSSLLNSNINNIK.V
  5.0   -0.04        S.GTMPTVISPQEDFLNLK.T
  5.0   -0.09        K.LEYPIMVKSTAGGGGIGLQ.K
  4.7   -0.07        R.EFPPQNFICILTIWL.L
  4.7   -0.07        R.EFPPQNFICILTIWL.L
  4.1   -0.06        V.VMSLGNLYVNYQSFKK.I
  4.1   -0.06        V.VMSLGNLYVNYQSFKK.I
  4.0    0.01        R.TNKSNLSNGAGDIANTSKP.V
Top scoring peptide matches to query 71
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 95.5    0.04    3  mCHT2 S.AAPQCPYPDASLGDLLSK.V
 10.8    0.09             A.AANQSDRLNDGLNDGALR.S
 10.4    0.05             N.NNANNINNKNTNDLSIK.L
  9.0    0.01             D.APYPVYDAPSPPPVFASK.E
  9.0    0.06             S.AAGQVTVEMDAAPGVDLNK.I
  7.9    0.06             S.AAGQVTVEMDAAPGVDLNK.I
  6.1    0.05             N.NNANNINNKNTNDLSIK.L
  6.1    0.05             N.NNANNINNKNTNDLSIK.L
  5.7   -0.05             R.AANVATELTAAAPYELGKL.Y
  5.6   -0.07             V.AAAGKEISTRPFQLVTGR.V
Top scoring peptide matches to query 72
Score greater than 21 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.2    0.29        K.VQDVANGTLNQNSDKNGQ.D
  8.1    0.08        D.VNLEGNNNLTLVLLHDK.T
  8.1    0.08        D.VNLEGNNNLTLVLLHDK.T
  8.1    0.08        D.VNLEGNNNLTLVLLHDK.T
  8.1    0.08        D.VNLEGNNNLTLVLLHDK.T
  6.0    0.11        C.KTVLPLESTNNTDSFNK.S
  5.2    0.26        K.QYQNLLTNTNNSALMY.N
  5.2    0.26        K.QYQNLLTNTNNSALMY.N
  5.2    0.26        K.QYQNLLTNTNNSALMY.N
  5.1    0.06        I.KNVVLDLTPFLGDHPGGK.E
Top scoring peptide matches to query 73
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.2   -0.07        K.VNPVKLPMSTLETLNLY.Q
  7.2   -0.08        D.EQHQQPVQLLKDDILK.K
  7.0    0.03        R.SRVQGSNANNLNDIFAPL.R
  4.9    0.05        P.QAITTVQQQQGQQQSQK.V
  4.2    0.12        R.DIAVCENENNHLAGNVY.V
  4.2    0.03        F.QAIEGETPEQTMERVSK.D
  3.8    0.01        R.FLQEETALSFQLYVNK.L
  3.4    0.13        R.NSSYGGGSSVSSLQQFLPN.N
  2.9   -0.01        H.YSTNYSNIAAPIPVPAPR.K
  2.8    0.12        R.SFNSITVDGDMSTNDTIV.A
Top scoring peptide matches to query 74
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.6    0.02    3  mCHT2 K.LFVGVPATSNIAGYVDTSK.L
Top scoring peptide matches to query 75
Score greater than 42 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
120.7    0.03    3  mCHT2 K.LFVGVPATSNIAGYVDTSK.L
 21.9    0.08             QQQQQQQQLNAPVNRK
 21.9    0.08             QQQQQQQQLNAPVNRK
 21.6    0.08             QQQQQQQQLNAPVNRK
 16.4    0.08             QQQQQQQQLNAPVNRK
 16.4    0.08             QQQQQQQQLNAPVNRK
 16.4    0.08             QQQQQQQQLNAPVNRK
 16.4    0.08             QQQQQQQQLNAPVNRK
 14.1    0.17             H.QTQGDSTVQELYAHTMK.Q
 12.5    0.13             K.FLTENNCQDDAIQLKK.I
Top scoring peptide matches to query 76
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4   -0.00        H.HQQWTANDIVYDIPLK.N
  1.6    0.06        M.HEDLIAKDNESQQLGNK.I
  1.6    0.06        M.HEDLIAKDNESQQLGNK.I
  0.8   -0.06        S.LNDPESKNPQIIFNALK.A
Top scoring peptide matches to query 77
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.0   -0.11        H.LPELNQPLIPQLRSAASK.C
  8.8    0.06        V.QPNIHNDIENQPTAEQK.G
  8.8    0.06        V.QPNIHNDIENQPTAEQK.G
  8.8    0.06        V.QPNIHNDIENQPTAEQK.G
  8.4    0.01        K.YTITTTTTQPNKSSLYSA.I
  5.4    0.05        R.SNHLVQNLCVYADQSKV.K
  4.7   -0.23        L.LQPLLLLLVIQVDQLKK.Q
  4.5   -0.12        K.KIIYIYIYIPPFSSFL.F
  3.9    0.10        R.SHPVFNNQGSLMNTINLA.E
  3.7   -0.06        I.ILLIDNARMAVDDFNLK.Y
Top scoring peptide matches to query 78
Score greater than 20 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 61.4    0.03    4+ mRBT5 K.QSTSSTPCPYWDTGCLC.V
  3.8   -0.15             -.MEFFSSSLILQAMRAIC.L
  3.7   -0.12             R.NFELETNFIDADNAHLR.P
  3.7   -0.12             R.NFELETNFIDADNAHLR.P
  3.0   -0.10             R.GVSTCSTRFVSGGSAGGYGGGV.S
  2.9   -0.03             R.QSFVSDSPNSSKVMNTLC.C
  0.4    0.03             K.QEMSSFGNPQGYVCPRC.G
  0.2   -0.04             K.HCPPQYQQMFGIQGPET.Y
Top scoring peptide matches to query 79
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
107.1    0.04    1  mALS3.5eoc Y.TLSYANEYTCAGGYWQR.A
  4.0    0.21                  R.WNQDDIFQSHDNANENS.N
  2.6   -0.22                  Q.TLSVLNILSPLINNWGRK.Y
  2.4   -0.22                  Q.TLSVLNILSPLINNWGRK.Y
  2.2    0.12                  L.NTMAESSPYGGYGNSSMNR.Y
  1.3    0.12                  L.NTMAESSPYGGYGNSSMNR.Y
  1.0    0.09                  R.NVSSSSSSSSSSSSEDIIQY.E
Top scoring peptide matches to query 80
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 48.5    0.03    3  mCHT2 K.FGAGEDPERPFDDAVVDGF.D
 13.9   -0.16             K.LASLNPIGHSNNKSAVITGF.D
 11.4   -0.11             G.FESATVDARNAASLLGVATF.-
 10.1   -0.02             R.HSISISPSHKENNASTLSE.S
  9.1   -0.02             R.FNQGRPYYKLSSIMNGF.K
  9.1   -0.02             R.FNQGRPYYKLSSIMNGF.K
  5.2   -0.18             K.SIFGLIKMLINNQIITGF.T
  5.2   -0.18             K.SIFGLIKMLINNQIITGF.T
  5.2   -0.18             K.SIFGLIKMLINNQIITGF.T
  4.8    0.04             -.MASITSNPQILINNDSSTN.K
Top scoring peptide matches to query 81
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.9    0.08        K.EQQQQKQEASNSESGSGSGS.E
  5.4   -0.19        K.SKLGANAILGVSLAAANAAAAAQ.G
  5.3   -0.14        L.AGCLSKMPQLVHVSLLGNK.N
  4.2   -0.02        -.MTSQIADGSSTTTINPLKNG.L
  3.8   -0.04        R.ANENYSDEALIKTNELLI.I
  3.5   -0.02        M.AVFQECLQQFNASPVNAK.K
  3.5   -0.02        M.AVFQECLQQFNASPVNAK.K
  3.3   -0.12        K.ETHGGVANAKFLNGQPIVLS.N
  3.1   -0.01        K.ANMTSSVLENSISNDKINL.L
  2.1    0.06        M.SGEEVINSTNRPNTSQSSGS.G
Top scoring peptide matches to query 82
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.9   -0.11        N.YCVPIIFLFFFCFLGK.L
 11.2    0.23        E.SDDMSPGINNNNNNNSNNK.T
 11.2    0.23        E.SDDMSPGINNNNNNNSNNK.T
 11.2    0.23        E.SDDMSPGINNNNNNNSNNK.T
 11.2    0.23        E.SDDMSPGINNNNNNNSNNK.T
  9.6   -0.05        K.QEQEVNPDGSISLNQNGIK.K
  9.6   -0.05        K.QEQEVNPDGSISLNQNGIK.K
  9.5   -0.15        W.DNLYMIKGVSFLGQLMLK.R
  8.9    0.01        K.QQIMNLVTSPVMNDSTQF.N
  8.1   -0.29        F.NLIKYSTGLGPLLINVLLK.R
Top scoring peptide matches to query 83
Score greater than 37 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
116.7    0.02    1+ mALS3.5eoc K.GLNDWNYPVSSESFSYTK.T
 17.1   -0.28                  A.SSLFIFLNLVGGFILGRLK.S
 12.3   -0.15                  C.VAVINAGVVPGVKTDSHNSTK.N
 10.8   -0.14                  G.SVPTSINYSALSQISGALRK.R
  9.9   -0.17                  G.AKSVTNFELLPNPPNARPK.D
  8.8   -0.08                  L.LSMGFLGPEADNLEVQKTK.R
  8.8    0.09   17  2988.1     M.ASHSNSNSNSLFQNDKNNN.S
  8.5   -0.16                  L.AVIAEWLAYITTGHRQHK.L
  7.3    0.04                  N.GNGNGNANSNTTTIMNNNRK.S
  7.0   -0.05                  E.IGNSGMFRPEMLESMGLPK.N
Top scoring peptide matches to query 84
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 77.9    0.02    5  8527.1 L.GGDVYELGATDNFIPVTINK.D
 25.6    0.13              I.ENDNVAVNDWTKLINSCK.N
 20.3   -0.80              D.FNNNNELCDYFTNTINK.I
 19.4    0.19              D.FNNNNELCDYFTNTINK.I
 19.4    0.19              D.FNNNNELCDYFTNTINK.I
 19.4    0.19              D.FNNNNELCDYFTNTINK.I
 19.4    0.19              D.FNNNNELCDYFTNTINK.I
 17.3    0.18              D.QNNNNNNNNNNHKPNINK.L
 14.1    0.01              E.FLVNYLEQLYMLYGQVK.D
 13.9    0.03              K.ILSAYANKMNNTPVLVNLQ.P
Top scoring peptide matches to query 85
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 37.2    0.02    7  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 12.9   -0.14              S.NLADKVIVLIGGNYFGLSIR.R
  6.2    0.08              R.RQLIMNSMENMDYLLMI.A
  5.8    0.07              I.NEFYQDGLRLANANLMYK.L
  3.0   -0.06              L.VTWLAALTVGAQAVSFGNNLK.D
  2.5   -0.08              K.QIVDSVSVIVGNPSKSIHHF.N
  2.2   -0.04              K.GIDVQDQVIENDGLIEVPIP.Q
  2.1    0.14              K.LIYNGMYHQAGENYNYIP.S
  2.0   -0.03              G.YTIRMASMALIGVNTVMYK.L
  2.0    0.15              K.SSIFTSNNNNNNNNNTPPPT.G
Top scoring peptide matches to query 86
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.0    0.03        -.SEGEDIDEYGFPKDSLDME.I
  5.9   -0.23        E.NNSIWAKIQSVLLISCNSK.R
  5.5   -0.21        K.LIDISNVGDINSIQTVVMMI.I
  5.3   -0.05        E.GSSSNLVDSSDAQNHLSVDDK.S
  5.3    0.77        M.SANIDDVPIEVSKVFDTILV.L
  4.6   -0.01        K.FAPNYDIENPSDNTSTEFI.E
  4.1   -0.10        S.LLTNQNQNQNQNQLLMNK.L
  4.1   -0.07        R.SFNNEAYTERNLNNVIEF.I
  4.1   -0.07        R.SFNNEAYTERNLNNVIEF.I
  4.1   -0.07        R.SFNNEAYTERNLNNVIEF.I
Top scoring peptide matches to query 87
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7    0.05        R.NVGYLVVNEDSQFQVPNGSGS.A
  0.4   -0.13        K.IQQNQVTRQSILQEIIQLG.N
  0.4   -0.13        K.IQQNQVTRQSILQEIIQLG.N
  0.4   -0.13        K.IQQNQVTRQSILQEIIQLG.N
  0.3    0.06        R.NNSIDNDSNVQNDVINRHGS.V
  0.1   -0.18        K.LEIMIRLASEQNSALLLGEL.K
Top scoring peptide matches to query 88
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3    0.76        K.VPEQLQPLLTFPLHKLDNK.S
  8.7   -0.05        K.FYPTNDGLGFNCFRLPANK.D
  7.4   -0.11        R.TRISTEGAASFFGAQPMFLGK.D
  6.2    0.09        D.LNCFNEWETMSNGNQPMK.R
  5.6    0.11        C.FVGCACVCVCDGTNQENNK.T
  5.6    0.11        C.FVGCACVCVCDGTNQENNK.T
  3.9    0.78        K.TLVKNLAQELTLLNMDLIAT.R
  3.9    0.78        K.TLVKNLAQELTLLNMDLIAT.R
  3.7   -0.10        K.DNYLASMIGFIKLGSLNDDF.Y
  3.5    0.09        D.LNCFNEWETMSNGNQPMK.R
Top scoring peptide matches to query 89
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 90
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 41.4    0.06    7  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 40.8    0.06    7  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 37.2    0.06    7  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
 33.9    0.06    7  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  7.0    0.07              N.QLITGFQDTNFMIRETTLK.S
  6.6    0.05              K.RQVFSPEEEVDLLNIVEEK.S
  5.9   -0.01              N.QILLDHLQQHNRQFDQLK.M
  5.5    0.00              H.DGNGLSDITSPNGLKSTPIFIK.Q
  5.1    0.23              R.NGNNNNNNNNNLQDLLNNLK.-
  3.6    0.08              A.IFQNINLDYNAITGGLVYDK.L
Top scoring peptide matches to query 91
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.2    0.03        K.YDQPENKEEIMSNPSMLADF.I
  4.8   -0.00        K.YNNKETNNGGLMNMGQTVEDF.E
  4.0   -0.23        I.ASSESNGKMSLLVVEPPILFNK.V
  3.9   -0.24        C.DYEVAYALYMIIIQLIAVMK.D
  2.8   -0.12        E.LNIDQNLNWEFKLDGVNGER.L
  2.8   -0.12        E.LNIDQNLNWEFKLDGVNGER.L
  2.8   -0.12        E.LNIDQNLNWEFKLDGVNGER.L
  2.7   -0.12        K.SSLSLSGLTGGSSTNLVSAFTSSNT.N
  2.7   -0.12        K.SSLSLSGLTGGSSTNLVSAFTSSNT.N
  2.2   -0.03        K.NYNQTTTTLNKMTVLYNHTN.C
Top scoring peptide matches to query 92
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.1   -0.34        M.LSKFTAILLAVLIALFACALTQ.A
  4.8    0.05        R.CYYGSNRNSEMGALLYHHST.R
  4.8    0.05        R.CYYGSNRNSEMGALLYHHST.R
  4.7   -0.29        N.ILLNTLMITTDRNLFINILK.C
  4.4   -0.29        K.ILPHIYLGSLKHASCLSILNK.L
  4.1   -0.27        E.FEPLVIQQLSNIIIYPYGIR.N
  4.1   -0.27        E.FEPLVIQQLSNIIIYPYGIR.N
  4.1   -0.27        E.FEPLVIQQLSNIIIYPYGIR.N
  4.1   -0.01        R.VSVFVDNSFMQFLGRCYYGS.N
  4.1   -0.01        R.VSVFVDNSFMQFLGRCYYGS.N
Top scoring peptide matches to query 93
Score greater than 18 indicates homology
Score greater than 44 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.1   -0.24        R.ESLMFIKIKPSSDTGSYSINNLS.T
  5.1   -0.24        R.ESLMFIKIKPSSDTGSYSINNLS.T
  5.1   -0.15        R.GNINSQTMRTNDILISDSLVSYS.R
  5.1   -0.29        K.ISGYLNVTLNLPSTFSYWLRVS.S
  5.1   -0.08        R.KPQFQYGWDWGPNLNTCGFES.I
  5.1   -0.08        R.KPQFQYGWDWGPNLNTCGFES.I
  5.1   -0.33        -.MTNSVIGQLKNFLTALNLLSIHS.S
  5.1   -0.21        K.QHNAQLRMHHFEDLTGFLIHS.P
  5.1   -0.21        K.QHNAQLRMHHFEDLTGFLIHS.P
  5.1   -0.21        K.QHNAQLRMHHFEDLTGFLIHS.P
Top scoring peptide matches to query 94
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.7   -0.12        K.VWYDNKDQILNNSVPVGADEPY.K
  3.7   -0.12        K.VWYDNKDQILNNSVPVGADEPY.K
  3.7   -0.12        K.VWYDNKDQILNNSVPVGADEPY.K
  3.7   -0.12        K.VWYDNKDQILNNSVPVGADEPY.K
  3.7   -0.12        K.VWYDNKDQILNNSVPVGADEPY.K
  3.7   -0.12        K.VWYDNKDQILNNSVPVGADEPY.K
  2.1   -0.15        L.QSSYQSHENLDNNIPHANLSIR.D
  1.4   -0.19        R.YHNSTHAPNPVICLSNLDSVLVS.G
  1.1   -0.05        R.NQTYNSTESSSSLIPTESDDLTF.E
  1.1   -0.05        R.NQTYNSTESSSSLIPTESDDLTF.E
Top scoring peptide matches to query 95
Score greater than 19 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3    0.03        E.IETINSIMTNTEDLIISNNGDLK.N
  6.4    0.20        P.EQQQQSQQQQPQQTEQISEIK.K
  4.6    0.23        N.NNNNNNNGVINMENPQSNQLCK.S
  2.4   -0.00        K.AVSEALNTVATLSSGNGAKIEATESK.K
  0.6    0.23        N.NNNNNNNGVINMENPQSNQLCK.S
  0.5   -0.06        R.LQTDISKLTNFVHAVSDHPIMIA.I
Top scoring peptide matches to query 96
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6    0.04        R.GRGSNHNSWNQQPYGSVPPPPQQQPYGS.V
  0.6    0.80        K.NLPPLIIGGAVFNYQYSSDPHSLPVQEL.I
  0.1   -0.19        K.NLPPLIIGGAVFNYQYSSDPHSLPVQEL.I
Top scoring peptide matches to query 97
Score greater than 14 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5   -0.27        M.YAHNFTSDPEEILNQYTVLIIPKTVIGDNAR.V
  0.9   -0.24        K.LPNIIIIASTSGQMQFVDIFDQTNVYLYQAD.L
  0.9   -0.24        K.LPNIIIIASTSGQMQFVDIFDQTNVYLYQAD.L
  0.9   -0.24        K.LPNIIIIASTSGQMQFVDIFDQTNVYLYQAD.L
  0.6    0.70        K.EPPKIFFLINSSSPHFAMAWSQLELEPPHIA.Y
  0.0   -0.24        P.VDIGMTQLSAIPDSYPIPNFNETLNSITPNQK.L
Top scoring peptide matches to query 98
Score greater than 14 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5   -0.21        V.NHWLVFVTFLQHTDPTMPHYTSKEWTFAR.G
  0.9    0.15        K.GEGADNQVMEENNDIGASGTATTMDQQQQQQQQ.K
  0.7   -0.15        K.SDSQPMFQSPSPVQITPSTTSINNAPSPTKPETT.V
  0.7   -0.15        K.SDSQPMFQSPSPVQITPSTTSINNAPSPTKPETT.V
  0.6    0.79        V.VSNTQFAPHEFNEIVLPTANAETKLANANPAFK.G
  0.2   -0.13        R.MNQEIQMVTYKTISHALSMTPNLLEFLASEN.I
  0.2   -0.13        R.MNQEIQMVTYKTISHALSMTPNLLEFLASEN.I
Top scoring peptide matches to query 99
Score greater than 18 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.5   -0.05        K.SQTQMPPQPTVPITSMGAATTTSSHQQANMPSRS.K
  6.5    0.02        R.IGHPNKFQQQQQQHQQQQQQQYYQQSNGGS.G
  5.7   -0.21        K.SGIEMLLLFFYFVAHQVGLEELVEICCKTGS.A
  5.6   -0.16        K.XSPINERHGSQFTLDHDILDSFNLVDNQLVGS.A
  5.6   -0.16        K.XSPINERHGSQFTLDHDILDSFNLVDNQLVGS.A
  5.6   -0.16        K.XSPINERHGSQFTLDHDILDSFNLVDNQLVGS.A
  4.7    0.03        M.SQFGEFYDTYSVENNQQYDTDLNNSTNTPIV.Q
  4.0   -0.01        K.SSSSNKSSNGGSSSSSSTVSGTDLDPDEMAPALSQLM.I
  3.8   -0.05        K.SQTQMPPQPTVPITSMGAATTTSSHQQANMPSRS.K
  3.8   -0.18        R.VLSSPFVEQPVANTQPVDPFDIGLQESFLDNLS.I
Top scoring peptide matches to query 100
Score greater than 21 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.4    0.05        K.YPKHMEYETYEQLNYILNQFDNLEMMNHDNMS.K
  7.9   -0.31        R.QDDEFSSSALQQTVAKVIPALASNGLSPVNNEIEFLLAS.F
  7.9   -0.36        K.KIYYSQGVITYTNLQFVSFSFWILIEQAPSNTFLS.L
  7.5   -0.17        -.LEFSVPFVWDLIVAKFNQVADDSNVEDEMQDSLVTS.K
  7.5   -0.17        -.LEFSVPFVWDLIVAKFNQVADDSNVEDEMQDSLVTS.K
  7.4    0.72        S.STTSTIASQNDNTNVPLINMSINNIMQKLPGVESILPK.D
  7.4    0.72        S.STTSTIASQNDNTNVPLINMSINNIMQKLPGVESILPK.D
  7.4    0.72        S.STTSTIASQNDNTNVPLINMSINNIMQKLPGVESILPK.D
  7.4    0.72        S.STTSTIASQNDNTNVPLINMSINNIMQKLPGVESILPK.D
  7.4    0.09        K.KINVSMISNNNNNNSNNNNNNTNNSSTGNSNIVNMLPS.V
Top scoring peptide matches to query 101
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 102
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9   -0.19        K.LFVSDQLINSTNNTEQSSCGITSLAFRPQDALNFACGTS.N
  2.8   -0.39        R.SEIPLTIPAGVDNNGKPIGTNKFYTNLLLGNQDFMVYPL.P
  2.8   -0.39        R.SEIPLTIPAGVDNNGKPIGTNKFYTNLLLGNQDFMVYPL.P
  2.8   -0.19        K.LFVSDQLINSTNNTEQSSCGITSLAFRPQDALNFACGTS.N
  2.7   -0.20        K.QSQPQPQPPPQPQPQQQPQQQSRSHHHHVPNPAHLFS.H
  2.5   -0.30        K.SLMLFPINYTPVNDNGVATAAATATATAPVNGIVTTNSLNGNS.I
  2.5   -0.13        K.STDPNVLFQYAQYMLQTALLLESELQNMVNNGNGNGNGS.Q
  2.5   -0.30        K.VRAMDQLNYTEFILSLSNLFTHAFGLQCVIFSEISPS.F
  2.5    0.68        K.SLMLFPINYTPVNDNGVATAAATATATAPVNGIVTTNSLNGNS.I
  2.3    0.11        M.AYYQQQMGNPQNMQFYQSNYSYQQPTNAQGTSGMMGS.M
Top scoring peptide matches to query 103
Score greater than 41 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 104
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.1    0.60        R.SEIPLTIPAGVDNNGKPIGTNKFYTNLLLGNQDFMVYPL.P
  2.9    0.60        R.SEIPLTIPAGVDNNGKPIGTNKFYTNLLLGNQDFMVYPL.P
  2.0    0.78        K.VPAWIINHDLNLNCHHIASSTPCSAVSASHQFQQSHLS.L
  1.4    0.60        R.SEIPLTIPAGVDNNGKPIGTNKFYTNLLLGNQDFMVYPL.P
  0.6   -0.15        K.LTMAQSVFQEQMSDVDSLLQDSNIMGLYESNIDPVSRA.I
  0.6   -0.15        K.LTMAQSVFQEQMSDVDSLLQDSNIMGLYESNIDPVSRA.I
  0.6   -0.15        K.LTMAQSVFQEQMSDVDSLLQDSNIMGLYESNIDPVSRA.I
  0.6   -0.15        K.LTMAQSVFQEQMSDVDSLLQDSNIMGLYESNIDPVSRA.I
  0.5   -0.15        K.LTMAQSVFQEQMSDVDSLLQDSNIMGLYESNIDPVSRA.I
  0.5   -0.15        K.LTMAQSVFQEQMSDVDSLLQDSNIMGLYESNIDPVSRA.I
Top scoring peptide matches to query 105
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 106
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.7   -0.06        -.MFGNKPATSGTGFSFGQTNQTAANGTNQTSQQQQQQPAVTIGS.T
  3.4   -0.16        S.SYVNQSFNHSQSQAVDQQQQQQHLYMQGMNTQRMSPR.F
  3.4   -0.16        S.SYVNQSFNHSQSQAVDQQQQQQHLYMQGMNTQRMSPR.F
  3.4   -0.16        S.SYVNQSFNHSQSQAVDQQQQQQHLYMQGMNTQRMSPR.F
  1.7   -0.20        R.SNDIYANNANMSMQGTIFWMAPEVIDSMVEGYSAKIDIW.S
  1.7   -0.20        R.SNDIYANNANMSMQGTIFWMAPEVIDSMVEGYSAKIDIW.S
  1.7   -0.20        R.SNDIYANNANMSMQGTIFWMAPEVIDSMVEGYSAKIDIW.S
  1.7   -0.20        R.SNDIYANNANMSMQGTIFWMAPEVIDSMVEGYSAKIDIW.S
  1.7   -0.20        R.SNDIYANNANMSMQGTIFWMAPEVIDSMVEGYSAKIDIW.S
  1.7   -0.20        R.SNDIYANNANMSMQGTIFWMAPEVIDSMVEGYSAKIDIW.S
Top scoring peptide matches to query 107
Score greater than 17 indicates homology
Score greater than 42 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4   -0.10              K.SGGISEKNNPHFPSSLAHQIPNTSSPSTCSSSTSMAFQNHFS.F
  4.1   -0.16   13  9505.1 R.HAAMNSPPPTGASSIASTGTGGELPAYSPGGYNQPYGDSKYQPPS.S
  4.0   -0.39              I.SGESYAGHYVPSFANAVHKADIPLNSILIGNGVTDPVVQLGEK.S
  3.9   -0.16              -.MTINSSYEPMLQQPHNDNSSSSSPPPPAPPSYASHILNDIGS.S
  3.9   -0.16              -.MTINSSYEPMLQQPHNDNSSSSSPPPPAPPSYASHILNDIGS.S
  3.8   -0.16              -.MTINSSYEPMLQQPHNDNSSSSSPPPPAPPSYASHILNDIGS.S
  2.9   -0.22              K.AQDSTGFTSAGNAITTAITATGAVTTSVGGQGSTDYSNAGNTIAAGSGS.D
  1.9    0.79              R.SINLKVNGMFCNHCPDIITQYLTNYGDAVVINDPISLDH.P
  1.9    0.79              R.SINLKVNGMFCNHCPDIITQYLTNYGDAVVINDPISLDH.P
  1.8   -0.17              R.NTTLSLNEYVQQQRMQHQNQQQLHDTTSQPGAPVGGGGGGGGS.I