Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0303_q2.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 14 Nov 2006 at 12:06:26 GMT
Significant hits: mPhr2     |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
                  mRBT5     |predicted| C. albicans fungus|CA2558| 241 aa
                  mSSR1     |Candida albicans 212 aa - Secretory Stress Response
                  TRBOTR    trypsin (EC3.4.21.4 ) precursor-bovine
                  mEcm33.3  |predicted|m5366.2|CaECM33
                  12297.1   CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 30 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mPhr2                             Mass: 57243    Score: 228    Queries matched: 5
 |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   520.29   1038.56   1038.50   0.06 0  60  5.4e-005 1  K.SNTDASAFVK.A
8   653.32   1304.62   1304.55   0.07 0  65  1.9e-005 1  K.ASGYESATNDYK.N
11   782.92   1563.82   1563.75   0.07 0  81  4.3e-007 1  R.SIPVGYSANDDSAIR.V
15   809.97   1617.93   1617.82   0.11 0  10  6.8 1  R.DIPYLEAVDTNVIR.V + Deamidation (NQ)
29   756.75   2267.23   2267.12   0.12 0  12  3.4 1  K.NLGIPIFFSEYGCNEVRPR.K

 
      Proteins matching the same set of peptides:
      4604.2                            Mass: 59477    Score: 228    Queries matched: 5
 |Phr2| CONTIG=Contig20237 POSCDS1=156145 POSCDS2=157779
      14612.3                           Mass: 67274    Score: 228    Queries matched: 5
 CONTIG=Contig10237 POSCDS1=160121 POSCDS2=161755

2.    mRBT5                             Mass: 22745    Score: 219    Queries matched: 4
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   618.82   1235.63   1235.59   0.04 0  35  0.017 1  R.IYDQLPECAK.E
21   584.97   1751.90   1751.82   0.07 1  (35) 0.017 1  R.IYDQLPECAKECVK.Q
22   876.96   1751.90   1751.82   0.08 1  68  9.1e-006 1  R.IYDQLPECAKECVK.Q
35   1183.99   3548.95   3548.53   0.42 0  117  1e-010 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 219    Queries matched: 4
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 219    Queries matched: 4
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
3.    mSSR1                             Mass: 20690    Score: 203    Queries matched: 3
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   635.86   1269.71   1269.66   0.06 0  83  2.7e-007 1  -.APPACLLACVAK.V
16   814.89   1627.77   1627.70   0.07 0  104  2.1e-009 1  K.CSGLNDLSCICTTK.N
19   854.94   1707.86   1707.78   0.09 0  16  1.4 1  K.EICPNGDADTAISAFK.S

4.    TRBOTR                            Mass: 24662    Score: 74     Queries matched: 3
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
28   1082.59   2163.16   2163.03   0.12 0  29  0.072 1  R.LGEDNINVVEGNEQFISASK.S + Deamidation (NQ)
30   758.43   2272.26   2272.15   0.11 0  45  0.0018 1  K.SIVHPSYNSNTLNNDIMLIK.L
31   1137.15   2272.28   2272.15   0.13 0  (9) 9.3 1  K.SIVHPSYNSNTLNNDIMLIK.L

5.    mEcm33.3                          Mass: 41984    Score: 57     Queries matched: 1
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   787.44   1572.87   1572.81   0.06 0  57  0.00012 1  K.TIGGALQISDNSELR.S

 
      Proteins matching the same set of peptides:
      5366.2                            Mass: 43798    Score: 57     Queries matched: 1
 |Ecm33.3| CaECM33 CONTIG=Contig10163 POSCDS1=164904 POSCDS2=166142
      24311.1                           Mass: 42880    Score: 57     Queries matched: 1
 CONTIG=Contig20163 POSCDS1=164513 POSCDS2=165751
6.    12297.1                           Mass: 15525    Score: 53     Queries matched: 2
 CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 21   584.97   1751.90   1751.82   0.07 1  (26) 0.14 2  R.IYDQIPKCAQECVK.Q + Deamidation (NQ)
 22   876.96   1751.90   1751.82   0.08 1  53  0.00026 2  R.IYDQIPKCAQECVK.Q + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      24214.1                           Mass: 16067    Score: 53     Queries matched: 2
 CONTIG=Contig20166 POSCDS1=63254 POSCDS2=63697
7.    19584.1                           Mass: 93366    Score: 27     Queries matched: 2
 CONTIG=Contig10143 POSCDS1=61144 POSCDS2=63636
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 21   584.97   1751.90   1751.82   0.07 0  (13) 2.7 3  R.TTQSTLNFEPLGDSNK.R + Deamidation (NQ)
 22   876.96   1751.90   1751.82   0.08 0  27  0.1 3  R.TTQSTLNFEPLGDSNK.R + Deamidation (NQ)

8.    19585.2                           Mass: 93645    Score: 27     Queries matched: 2
 CONTIG=Contig20143 POSCDS1=60861 POSCDS2=63353
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 21   584.97   1751.90   1751.86   0.04 0  (8) 8.5 6  R.TTQSTLNFKPLGDSNK.R + 2 Deamidation (NQ)
 22   876.96   1751.90   1751.86   0.04 0  27  0.1 3  R.TTQSTLNFKPLGDSNK.R + 2 Deamidation (NQ)

9.    13042.2                           Mass: 102761   Score: 20     Queries matched: 2
 CONTIG=Contig20148 POSCDS1=47790 POSCDS2=50471
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 11   782.92   1563.82   1563.76   0.06 1  8  9.6 3  K.SSLTNKDNSINELK.T + 2 Deamidation (NQ)
 22   876.96   1751.90   1751.81   0.09 1  12  3.2 7  K.NYKILNQQYQYMK.E + 3 Deamidation (NQ); Oxidation (M)

 
      Proteins matching the same set of peptides:
      29110.1                           Mass: 103986   Score: 20     Queries matched: 2
 CONTIG=Contig10148 POSCDS1=47768 POSCDS2=50455
10.   4222.2                            Mass: 152716   Score: 16     Queries matched: 1
 CONTIG=Contig10259 POSCDS1=8804 POSCDS2=12805
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   547.31   1092.60   1092.56   0.04 1  16  1.5 1  R.FAQKLSQDR.N + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      20209.1                           Mass: 153746   Score: 16     Queries matched: 1
 CONTIG=Contig20259 POSCDS1=8803 POSCDS2=12804
11.   19934.2                           Score: 16     Queries matched: 1
 CONTIG=Contig20141 POSCDS1=95821 POSCDS2=97869
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   520.29   1038.56   1038.48   0.08 1  17  1.1 2  K.SNSQRYQR.I + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      29168.1                           Score: 16     Queries matched: 1
12.   7980.2                            Mass: 64827    Score: 14     Queries matched: 1
 CONTIG=Contig10158 POSCDS1=57931 POSCDS2=59673
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   1016.25   1015.24   1014.58   0.66 1  15  3.2 1  K.LVEGISKNR.L

13.   4205.1                            Score: 12     Queries matched: 1
 CONTIG=Contig10259 POSCDS1=24355 POSCDS2=26454
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 11   782.92   1563.82   1563.79   0.04 1  12  3.7 2  K.SLSLSQSQSQQSRK.I + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      20181.1                           Score: 12     Queries matched: 1
14.   474.1                             Score: 11     Queries matched: 1
 CONTIG=Contig10262 POSCDS1=146172 POSCDS2=147146
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 22   876.96   1751.90   1751.75   0.15 0  11  4.4 8  K.LNYQQFENICFMK.F + 2 Deamidation (NQ); Oxidation (M)

15.   2830.1                            Score: 10     Queries matched: 1
 CONTIG=Contig2511 POSCDS1=34128 POSCDS2=34952
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   618.82   1235.63   1235.52   0.11 0  10  5.1 2  K.ENFPNDIEQK.T + 3 Deamidation (NQ)

16.   572.2                             Mass: 193116   Score: 10     Queries matched: 1
 CONTIG=Contig2518 POSCDS1=190144 POSCDS2=195330
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   846.42   1690.83   1690.74   0.08 0  10  5.2 1  K.SLDEDADAEEDQILK.R + Deamidation (NQ)

17.   8970.1                            Score: 9      Queries matched: 1
 CONTIG=Contig10053 POSCDS1=61286 POSCDS2=64057
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   547.31   1092.60   1092.53   0.07 0  9  6.9 3  R.MAGFPENALK.A + Oxidation (M)

 
      Proteins matching the same set of peptides:
      26756.1                           Score: 9      Queries matched: 1
18.   3636.2                            Mass: 82469    Score: 9      Queries matched: 1
 CONTIG=Contig10254 POSCDS1=19872 POSCDS2=22001
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   631.84   1261.66   1261.58   0.08 0  9  6.8 1  K.DWDELELSQK.S

 
      Proteins matching the same set of peptides:
      20323.1                           Mass: 83060    Score: 9      Queries matched: 1
 CONTIG=Contig20254 POSCDS1=19872 POSCDS2=22001
19.   3774.2                            Score: 9      Queries matched: 1
 CONTIG=Contig10235 POSCDS1=6495 POSCDS2=8945
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 22   876.96   1751.90   1751.97   -0.07 1  9  7.4 10  R.VLAGEYQIVNKYLIK.D + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      21358.1                           Score: 9      Queries matched: 1
20.   9853.1                            Score: 8      Queries matched: 1
 CONTIG=Contig20170 POSCDS1=73927 POSCDS2=76860
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   520.29   1038.56   1038.48   0.08 0  8  8.5 4  K.MNGATSMTVK.K

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
14   806.38   1610.75   1610.85   -0.10 1  8  8.8 1  WSLKDLAFEFLSR
1   502.79   1003.57   1003.51   0.06 0  8  10 1  MSNVGLQVR + Deamidation (NQ)
10   774.93   1547.84   1547.81   0.03 0  4  26 1  NETVFNFIQPLAR
9   716.88   1431.74   1431.66   0.08 1  3  32 1  TRCLQCHTVEK + Deamidation (NQ)
37   1202.99   3605.95   3605.87   0.08 0  2  28 1  SPGKPTTDSNDIVQITLQRPTTPPLLSQETQLK + 3 Deamidation (NQ)
34   1178.32   3531.93   3532.65   -0.73 1  2  36 1  VTGQSNMVPKDGENAMLLESPKPSPNASSSSINK + 3 Deamidation (NQ); Oxidation (M)
20   874.94   1747.87   1747.87   -0.01 0  2  38 1  SDRPGGLLMYGIPNMK
13   797.91   1593.81   1593.95   -0.14 1  2  38 1  KFFNISVVIVTLSK
17   824.43   1646.84        
23   930.43   1858.84        
24   931.94   1861.86        
25   1010.45   2018.89        
26   1027.03   2052.04        
27   1067.53   2133.04        
32   1213.57   2425.12        
33   921.47   2761.40        
36   1197.32   3588.92        
38   1404.18   4209.53        
39   1423.14   4266.38        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 39

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.5    0.06        -.MSNVGLQVR.Q
  7.3    0.07        R.LDDILSQLS.-
  6.7    0.07        -.MSQSDVPIK.K
  6.3    0.07        R.MVVNIDNAK.L
  3.4    0.06        -.MSNVGLQVR.Q
Top scoring peptide matches to query 2
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.5    0.66   12  7980.2 K.LVEGISKNR.L
 15.5   -0.33   12  7980.2 K.LVEGISKNR.L
  1.9   -0.28              R.VLAIDGGEDK.G
  1.6   -0.20              R.MHQSLQDR.H
  1.5   -0.34              K.AFAVPDKIR.M
  1.5   -0.27              K.ASMMGHKVR.V
  1.3    0.74              R.LDADPSLQR.V
  0.6   -0.27              K.LNAQWIDR.K
  0.5   -0.22              K.IDANPDNTR.I
  0.5   -0.27              K.HFISELDR.G
Top scoring peptide matches to query 3
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 59.9    0.06    1  mPhr2   SNTDASAFVK
 17.0    0.08   11  19934.2 K.SNSQRYQR.I
 10.0    0.08               K.ATQQMSMVK.L
  8.0    0.08   20  9853.1  K.MNGATSMTVK.K
  7.7    0.10               K.NSQSEYSPK.R
  6.3   -0.01               K.SNLPIGPNVK.L
  6.0    0.00               K.ITVHNGDRK.H
  6.0    0.04               -.QFVMVDRK.R
  6.0    0.02               R.QIEHLNRK.Y
  4.3    0.06               R.NMHPEQRK.Q
Top scoring peptide matches to query 4
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.1    0.04   10  4222.2 R.FAQKLSQDR.N
 10.4    0.04   10  4222.2 R.FAQKLSQDR.N
  9.5    0.07   17  8970.1 R.MAGFPENALK.A
  8.3    0.02              R.KFADIGNTVK.K
  7.8    0.11              K.ASTAESEAAQK.L
  6.0    0.09              K.SMKIDQENK.F
  6.0    0.09              K.SMKIDQENK.F
  5.5    0.09              -.MSQEDLLTR.V
  5.0    0.02              R.FAGCGSLLLR.T
  4.2    0.11              K.QSSELSNAQK.N
Top scoring peptide matches to query 5
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.1    0.04    2  mRBT5  IYDQLPECAK
 10.4    0.11   15  2830.1 K.ENFPNDIEQK.T
  6.3    0.07              R.IQITMQENEK.I
  4.1   -0.01              K.IDYQSIQIEK.S
  3.5   -0.00              K.FENETELLLK.Y
  3.2   -0.11              R.HRLLTEIINK.D
  3.1    0.05              R.SIHHELEEDK.K
  3.0    0.11              K.FQPLNDQENK.E
  2.2    0.07              K.GRNEMIQSER.L
  1.6    0.00              K.SSTNTIELNKK.G
Top scoring peptide matches to query 6
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.4    0.08   18  3636.2 K.DWDELELSQK.S
  4.0   -0.04              K.VLYLNLDQRK.K
  0.5   -0.10              R.IRYLILMVNK.L
  0.5    0.02              K.NVAHHVVSQAAK.Q
  0.5   -0.02              R.QDIIIMNIFR.F
  0.0   -0.03              K.LSTQSSAAVLSAK.T
Top scoring peptide matches to query 7
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 83.0    0.06    3  mSSR1 -.APPACLLACVAK.V
  6.4    0.10             K.APKFLTYCNR.F
  2.4    0.05             M.APVVQQPAPSFK.K
Top scoring peptide matches to query 8
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 64.7    0.07    1  mPhr2 K.ASGYESATNDYK.N
  1.5   -0.04             R.KSYNPSPLSSPK.S
Top scoring peptide matches to query 9
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5    0.08        K.TRCLQCHTVEK.G
  1.1   -0.02        K.ENIPSFLEKLDK.Q
  0.7    0.02        K.QSPVSSTGVDVSIR.D
Top scoring peptide matches to query 10
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.7    0.03        K.NETVFNFIQPLAR.S
  0.8    0.18        K.DNNNTIIENEDQK.F
Top scoring peptide matches to query 11
Score greater than 29 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 81.1    0.07    1  mPhr2   R.SIPVGYSANDDSAIR.V
 11.7    0.04   13  4205.1  K.SLSLSQSQSQQSRK.I
  7.7    0.06    9  13042.2 K.SSLTNKDNSINELK.T
  6.7    0.08               K.SINEESEKYSHLK.D
  5.3    0.06    9  13042.2 K.SSLTNKDNSINELK.T
  5.2    0.06               K.SLNTMTLVNERNR.K
  3.0    0.02               R.SLFKNNSSLLDGNR.L
  2.8    0.04   13  4205.1  K.SLSLSQSQSQQSRK.I
  2.7    0.04   13  4205.1  K.SLSLSQSQSQQSRK.I
  2.7    0.04   13  4205.1  K.SLSLSQSQSQQSRK.I
Top scoring peptide matches to query 12
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 56.6    0.06    5  mEcm33.3 K.TIGGALQISDNSELR.S
  1.4    0.01                K.NVGALQGIQFLRQK.G
  1.4    0.01                K.NVGALQGIQFLRQK.G
Top scoring peptide matches to query 13
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7   -0.14        R.KFFNISVVIVTLSK.M
Top scoring peptide matches to query 14
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.6   -0.10        R.WSLKDLAFEFLSR.R
  7.0   -0.09        K.DNSQGQLDILPKQR.R
  0.8   -0.00        K.SEVANQIMNNTLFK.E
  0.8   -0.00        K.SEVANQIMNNTLFK.E
  0.8   -0.19        K.TGLLDLAKGLVAANVR.I
Top scoring peptide matches to query 15
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.7    0.11    1  mPhr2 R.DIPYLEAVDTNVIR.V
  0.6    0.06             K.VEFLGGLDIISNSVR.E
  0.1    0.13             -.LDLMVYHLQNNLK.S
Top scoring peptide matches to query 16
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
103.9    0.07    3  mSSR1 K.CSGLNDLSCICTTK.N
Top scoring peptide matches to query 17
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 18
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.4    0.08   16  572.2 K.SLDEDADAEEDQILK.R
  5.6   -0.02             R.QIIQQSDINRMTLK.N
  5.3    0.04             K.ETEASINQQIVSQNK.Q
  5.3    0.04             K.ETEASINQQIVSQNK.Q
  1.5    0.04             K.ETEASINQQIVSQNK.Q
  1.5    0.04             K.ETEASINQQIVSQNK.Q
Top scoring peptide matches to query 19
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.0    0.09    3  mSSR1 K.EICPNGDADTAISAFK.S
  3.1    0.18             R.WQSNANDQDENKEK.E
  2.7   -0.03             K.QFITLTQLGGNATTLK.D
  2.6    0.18             R.WQSNANDQDENKEK.E
  2.3   -0.07             R.QEKVMHQLNLINLK.K
  0.1    0.15             K.LMKWCNEPQQQNK.I
Top scoring peptide matches to query 20
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8   -0.01        R.SDRPGGLLMYGIPNMK.L
Top scoring peptide matches to query 21
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.1    0.07    2  mRBT5   IYDQLPECAKECVK
 26.0    0.07    6  12297.1 R.IYDQIPKCAQECVK.Q
 13.1    0.07    7  19584.1 R.TTQSTLNFEPLGDSNK.R
 11.9    0.07    7  19584.1 R.TTQSTLNFEPLGDSNK.R
  8.3    0.07    6  12297.1 R.IYDQIPKCAQECVK.Q
  8.1    0.04    8  19585.2 R.TTQSTLNFKPLGDSNK.R
  6.6    0.00               R.SWLPSIYLCITGTNK.L
  5.6   -0.03               K.IYNLYLFLSGQFFK.N
  4.9    0.04               R.FQWIPALMTKNSNGK.F
  4.5    0.04    8  19585.2 R.TTQSTLNFKPLGDSNK.R
Top scoring peptide matches to query 22
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 67.8    0.08    2  mRBT5   IYDQLPECAKECVK
 53.2    0.08    6  12297.1 R.IYDQIPKCAQECVK.Q
 27.2    0.08    7  19584.1 R.TTQSTLNFEPLGDSNK.R
 27.2    0.04    8  19585.2 R.TTQSTLNFKPLGDSNK.R
 23.7    0.08    6  12297.1 R.IYDQIPKCAQECVK.Q
 17.4    0.08    7  19584.1 R.TTQSTLNFEPLGDSNK.R
 12.3    0.09    9  13042.2 K.NYKILNQQYQYMK.E
 10.9    0.15   14  474.1   K.LNYQQFENICFMK.F
 10.9    0.15   14  474.1   K.LNYQQFENICFMK.F
  8.7   -0.07   19  3774.2  R.VLAGEYQIVNKYLIK.D
Top scoring peptide matches to query 23
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 24
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 25
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 26
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 27
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 28
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 29.0    0.12    4  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 27.8    0.12    4  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 24.8    0.12    4  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 18.2    0.12    4  TRBOTR R.LGEDNINVVEGNEQFISASK.S
  2.3    0.01              -.SSALINVPNGHISTRQPMIK.S
  0.6    0.20              K.MILDSNVVAQETGYNTFNK.F
  0.2    0.07              K.ATELAQLQFIAEQNHWHK.F
Top scoring peptide matches to query 29
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.5    0.12    1  mPhr2 K.NLGIPIFFSEYGCNEVRPR.K
Top scoring peptide matches to query 30
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 45.4    0.11    4  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  7.5    0.28              R.NGNNNNNNNNNLQDLLNNLK.-
  5.3    0.16              K.KMILDSNVVAQETGYNTFNK.F
  2.3   -0.70              R.NGNNNNNNNNNLQDLLNNLK.-
Top scoring peptide matches to query 31
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.7    0.13    4  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  3.3    0.17              K.HSPNLTPFNETQNASNFLIK.S
  2.0   -0.78              R.FTNHQYQDLVDPETFKYK.T
  2.0   -0.78              R.FTNHQYQDLVDPETFKYK.T
  2.0   -0.78              R.FTNHQYQDLVDPETFKYK.T
  1.1   -0.77              R.MNENGTLQPLTTDEIQYYK.D
  1.1   -0.78              R.ENGMTPERPSWVMILPCEK.I
  1.1    0.19              K.IWFTGWQNFFESQQGVGLK.K
  1.1    0.19              K.IWFTGWQNFFESQQGVGLK.K
  1.1    0.19              K.IWFTGWQNFFESQQGVGLK.K
Top scoring peptide matches to query 32
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 33
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 34
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8   -0.73        K.VTGQSNMVPKDGENAMLLESPKPSPNASSSSINK.I
Top scoring peptide matches to query 35
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
117.2    0.42    2  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
 92.7   -0.56    2  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
 64.4   -0.56    2  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
 62.3   -0.56    2  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
  2.2    0.13             K.DFYQYCQSKNIPIIVISSGMKPIIYALLEK.L
  2.2    0.13             K.DFYQYCQSKNIPIIVISSGMKPIIYALLEK.L
Top scoring peptide matches to query 36
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 37
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.0    0.08        K.SPGKPTTDSNDIVQITLQRPTTPPLLSQETQLK.G
  0.7    0.17        K.SSEESLYNLSQEFVSHNLGTKYLQLTTQFIK.D
Top scoring peptide matches to query 38
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 39
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide