Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0302_q1.pkl
Database        : MSDB 20052909 (2344227 sequences; 779380795 residues)
Timestamp       : 10 Nov 2006 at 16:50:33 GMT
Significant hits: Q5AFN8_CANAL  Hypothetical protein CCW14.- Candida albicans SC5314.
                  Q5AFA2_CANAL  Potential cell wall glycosidase.- Candida albicans SC5314.
                  1BFP2         blue fluorescent protein mutant (S65, H66, G67 replaced with IIC 66, Y145F), fragment 2 - jellyfish
                  Q5A5U4_CANAL  Hypothetical LDG family protein 7.- Candida albicans SC5314.

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 55 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    Q5AFN8_CANAL                      Mass: 22993    Score: 153    Queries matched: 2
 Hypothetical protein CCW14.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
33   814.92   1627.83   1628.68   -0.85 0  103  8.8e-007 1  K.CSGLNDLSCICTTK.N + Deamidation (NQ)
36   855.96   1709.90   1708.76   1.14 0  52  0.13 1  K.EICPNGDADTAISAFK.S + Deamidation (NQ)

2.    Q5AFA2_CANAL                      Mass: 46818    Score: 138    Queries matched: 3
 Potential cell wall glycosidase.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   548.30   1094.59   1094.49   0.10 0  22  1.1e+002 1  R.YDQAQDDIK.K
37   882.97   1763.92   1763.76   0.15 0  48  0.29 1  K.QYSYSDQSGSWESIK.A
38   891.00   1779.99   1779.83   0.15 0  72  0.0011 1  K.SSDCSPVPALGSSFLEK.F

3.    1BFP2                             Mass: 18750    Score: 117    Queries matched: 2
 blue fluorescent protein mutant (S65, H66, G67 replaced with IIC 66, Y145F), fragment 2 - jellyfish
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   525.81   1049.61   1049.51   0.09 0  51  0.16 1  K.FEGDTLVNR.I
21   674.39   1346.77   1346.65   0.12 1  70  0.0021 1  R.TIFFKDDGNYK.T

 
      Proteins matching the same set of peptides:
      1C4FA                             Mass: 25412    Score: 117    Queries matched: 2
 green fluorescent protein mutant 65 67 REPLACED BY CRO, S65T SUBSTITUTION, Q80R substitution - jell
      1EMB2                             Mass: 18766    Score: 117    Queries matched: 2
 green fluorescent protein mutant Q80R chromophore containing protein 65 67 denoted as cro, fragment
      1EMCA2                            Mass: 15904    Score: 117    Queries matched: 2
 green fluorescent protein mutant INS(A1[B]), F64L, I167T, K238N, chain A, fragment 2 - jellyfish
      1EME2                             Mass: 18855    Score: 117    Queries matched: 2
 green fluorescent protein mutant INS(A1[B]), F64L, I167T, K238N, fragment 2 - jellyfish
      1EMF2                             Mass: 18839    Score: 117    Queries matched: 2
 green fluorescent protein mutant INS(A1[B]), F64L, Y66H, V163A, fragment 2 - jellyfish
      1EMGA                             Mass: 25499    Score: 117    Queries matched: 2
 green fluorescent protein mutant 65 67 REPLACED BY CRO, S65T SUBSTITUTION, Q80R substitution - jell
      1EMK2                             Mass: 18754    Score: 117    Queries matched: 2
 green fluorescent protein mutant INS(A1[B]), F64L, S65C, I167T, K238N, fragment 2 - jellyfish
      1GFLA                             Mass: 25978    Score: 117    Queries matched: 2
 green fluorescent protein mutant Q80R, chain A - Aequorea victoria
      1YFPA                             Mass: 25472    Score: 117    Queries matched: 2
 yellow fluorescent protein mutant S65G, V68L, S72A, Q80R, H148G, T203Y, chain A - jellyfish (fragme
      2EMD2                             Mass: 18867    Score: 117    Queries matched: 2
 green fluorescent protein mutant INS(A1[B]), F64L, Y66H, fragment 2 - jellyfish
      2EMO2                             Mass: 18738    Score: 117    Queries matched: 2
 green fluorescent protein mutant INS(A1[B]), F64L, Y66H, V163A, fragment 2 - jellyfish
      2YFPA                             Mass: 25479    Score: 117    Queries matched: 2
 green fluorescent protein mutant YES - jellyfish (fragments)
      Q6YGZ0_9CNID                      Mass: 26993    Score: 117    Queries matched: 2
 Green fluorescent protein.- Aequorea coerulescens (belt jellyfish).
      Q8GHE2_AZOVI                      Mass: 27011    Score: 117    Queries matched: 2
 Green fluorescence protein.- Azotobacter vinelandii.
      Q8GHE3_AZOVI                      Mass: 26984    Score: 117    Queries matched: 2
 Green fluorescence protein.- Azotobacter vinelandii.
      Q71RY9_AZOVI                      Mass: 26983    Score: 117    Queries matched: 2
 Green fluorescence protein.- Azotobacter vinelandii.
      CAE00346                          Mass: 32261    Score: 117    Queries matched: 2
 Sequence 1 from Patent EP1314980.- synthetic construct.
      CAE00347                          Mass: 88566    Score: 117    Queries matched: 2
 Sequence 3 from Patent EP1314980.- synthetic construct.
      CAE00348                          Mass: 88636    Score: 117    Queries matched: 2
 Sequence 5 from Patent EP1314980.- synthetic construct.
      CAE00349                          Mass: 32222    Score: 117    Queries matched: 2
 Sequence 7 from Patent EP1314980.- synthetic construct.
      CAE00350                          Mass: 32674    Score: 117    Queries matched: 2
 Sequence 9 from Patent EP1314980.- synthetic construct.
      CAE00351                          Mass: 33483    Score: 117    Queries matched: 2
 Sequence 11 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00352                          Mass: 31938    Score: 117    Queries matched: 2
 Sequence 13 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00353                          Mass: 32911    Score: 117    Queries matched: 2
 Sequence 15 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00354                          Mass: 33614    Score: 117    Queries matched: 2
 Sequence 17 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00355                          Mass: 32961    Score: 117    Queries matched: 2
 Sequence 19 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00357                          Mass: 36435    Score: 117    Queries matched: 2
 Sequence 23 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00358                          Mass: 35857    Score: 117    Queries matched: 2
 Sequence 25 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00359                          Mass: 39447    Score: 117    Queries matched: 2
 Sequence 27 from Patent EP1314980.- synthetic construct.
      CAE00360                          Mass: 39675    Score: 117    Queries matched: 2
 Sequence 29 from Patent EP1314980.- synthetic construct.
      CAE00365                          Mass: 26997    Score: 117    Queries matched: 2
 Sequence 47 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00366                          Mass: 27003    Score: 117    Queries matched: 2
 Sequence 49 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00367                          Mass: 27095    Score: 117    Queries matched: 2
 Sequence 51 from Patent EP1314980.- synthetic construct.
      CAE00369                          Mass: 51333    Score: 117    Queries matched: 2
 Sequence 169 from Patent EP1314980.- synthetic construct.
      CAE00371                          Mass: 98603    Score: 117    Queries matched: 2
 Sequence 173 from Patent EP1314980.- synthetic construct.
      CAE00372                          Mass: 86044    Score: 117    Queries matched: 2
 Sequence 175 from Patent EP1314980.- synthetic construct.
      CAE00373                          Mass: 89432    Score: 117    Queries matched: 2
 Sequence 177 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00374                          Mass: 63244    Score: 117    Queries matched: 2
 Sequence 179 from Patent EP1314980.- synthetic construct.
      AAG00925                          Mass: 31019    Score: 117    Queries matched: 2
 Green fluorescent protein.- Cloning vector pDXA-GFP2.
      AAB02576                          Mass: 29467    Score: 117    Queries matched: 2
 ENHANCED GREEN FLUORESCENT PROTEIN.- Cloning vector pEGFP-C1.
      AAT02644                          Mass: 27084    Score: 117    Queries matched: 2
 AY589050 NID: - Cloning vector pHyVec3
      CAA03418                          Mass: 29820    Score: 117    Queries matched: 2
 SEQUENCE 10 FROM PATENT WO9627675.- unidentified.
      AAF04100                          Mass: 26959    Score: 117    Queries matched: 2
 Green fluorescent protein.- synthetic construct.
      AAU04872                          Mass: 26879    Score: 117    Queries matched: 2
 AY672109 NID: - Bursa aurealis delivery vector pBursa
      CAH05668                          Mass: 35566    Score: 117    Queries matched: 2
 CQ834934 NID: - synthetic construct
      AAX07425                          Mass: 28391    Score: 117    Queries matched: 2
 AY902485 NID: - Expression vector pLuxR-wt
      AAB08058                          Mass: 30061    Score: 117    Queries matched: 2
 ENHANCED GREEN FLUORESCENT PROTEIN.- Cloning vector pEGFP-C2.
      AAK08507                          Mass: 26961    Score: 117    Queries matched: 2
 GFP.- Plant DNA excision vector pX6-GFP.
      CAC08897                          Mass: 105812   Score: 117    Queries matched: 2
 Sequence 1 from Patent WO0023091.- synthetic construct.
      CAC08899                          Mass: 113826   Score: 117    Queries matched: 2
 Sequence 5 from Patent WO0023091.- synthetic construct.
      CAC08901                          Mass: 115901   Score: 117    Queries matched: 2
 Sequence 9 from Patent WO0023091.- synthetic construct.
      CAC08902                          Mass: 89824    Score: 117    Queries matched: 2
 Sequence 11 from Patent WO0023091.- synthetic construct.
      CAC08903                          Mass: 115645   Score: 117    Queries matched: 2
 Sequence 13 from Patent WO0023091.- synthetic construct.
      CAC08904                          Mass: 63083    Score: 117    Queries matched: 2
 Sequence 15 from Patent WO0023091.- synthetic construct.
      CAC09301                          Mass: 26982    Score: 117    Queries matched: 2
 Sequence 11 from Patent WO9902694.- synthetic construct.
      CAE11751                          Mass: 53651    Score: 117    Queries matched: 2
 Sequence 1 from Patent WO03029827.- Aequorea victoria (Jellyfish).
      CAE11753                          Mass: 40640    Score: 117    Queries matched: 2
 Sequence 5 from Patent WO03029827.- Aequorea victoria (Jellyfish).
      BAB11884                          Mass: 27065    Score: 117    Queries matched: 2
 Enhanced cyan-green fluorescent protein.- synthetic construct.
      CAD12121                          Mass: 100534   Score: 117    Queries matched: 2
 Sequence 1 from Patent WO0179526.- synthetic construct.
      CAD12122                          Mass: 126496   Score: 117    Queries matched: 2
 Sequence 3 from Patent WO0179526.- synthetic construct.
      CAD12123                          Mass: 125606   Score: 117    Queries matched: 2
 Sequence 5 from Patent WO0179526.- synthetic construct.
      CAD12124                          Mass: 126472   Score: 117    Queries matched: 2
 Sequence 7 from Patent WO0179526.- synthetic construct.
      CAD12125                          Mass: 116223   Score: 117    Queries matched: 2
 Sequence 23 from Patent WO0179526.- synthetic construct.
      CAD12126                          Mass: 105810   Score: 117    Queries matched: 2
 Sequence 25 from Patent WO0179526.- synthetic construct.
      CAD12127                          Mass: 100448   Score: 117    Queries matched: 2
 Sequence 29 from Patent WO0179526.- synthetic construct.
      CAD12128                          Mass: 126409   Score: 117    Queries matched: 2
 Sequence 31 from Patent WO0179526.- synthetic construct.
      AAK13447                          Mass: 29514    Score: 117    Queries matched: 2
 LacZ-GFP fusion protein.- Cloning vector pFH2191.
      AAP13536                          Mass: 80190    Score: 117    Queries matched: 2
 Avermectin-sensitive chloride channel GluCl alpha/yellow fluorescent protein fusion.- synthetic con
      AAP13537                          Mass: 77356    Score: 117    Queries matched: 2
 Avermectin-sensitive chloride channel GluCl beta/cyan fluorescent protein fusion.- synthetic constr
      AAR13802                          Mass: 78682    Score: 117    Queries matched: 2
 AY438650 NID: - Cloning vector pMACSiBac
      AAX13969                          Mass: 55882    Score: 117    Queries matched: 2
 AY916793 NID: - Dual fluorescent protein cloning vector pGRFP
      AAX14065                          Mass: 27006    Score: 117    Queries matched: 2
 AY894753 NID: - Reporter vector pUS23
      AAO16875                          Mass: 60315    Score: 117    Queries matched: 2
 PAP2A-GFP fusion protein.- Mus musculus (Mouse).
      AAO16876                          Mass: 62319    Score: 117    Queries matched: 2
 Wunen-nonfunctional GFP fusion protein.- Drosophila melanogaster (Fruit fly).
      AAG16959                          Mass: 27082    Score: 117    Queries matched: 2
 GFPS.- synthetic construct.
      AAY17031                          Mass: 66145    Score: 117    Queries matched: 2
 DQ000653 NID: - synthetic construct
      AAL17988                          Mass: 26997    Score: 117    Queries matched: 2
 Green fluorescent protein.- Expression vector pNUS-GFPcH.
      CAD20729                          Mass: 27025    Score: 117    Queries matched: 2
 Sequence 1 from Patent WO0198338.- Aequorea victoria (Jellyfish).
      CAD20730                          Mass: 26952    Score: 117    Queries matched: 2
 Sequence 3 from Patent WO0198338.- Aequorea victoria (Jellyfish).
      CAC22448                          Mass: 27068    Score: 117    Queries matched: 2
 Sequence 39 from Patent WO0075324.- Cloning vector pINT1.
      CAD23750                          Mass: 27039    Score: 117    Queries matched: 2
 Sequence 1 from Patent EP1178109.- Aequorea victoria (Jellyfish).
      AAD25336                          Mass: 26965    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN.- Cloning vector pLM10.
      CAH25979                          Mass: 32640    Score: 117    Queries matched: 2
 CQ860012 NID: - synthetic construct
      CAH25982                          Mass: 41981    Score: 117    Queries matched: 2
 CQ860095 NID: - synthetic construct
      CAH25985                          Mass: 133764   Score: 117    Queries matched: 2
 CQ860101 NID: - synthetic construct
      CAH25988                          Mass: 42664    Score: 117    Queries matched: 2
 CQ860107 NID: - synthetic construct
      AAG26343                          Mass: 39943    Score: 117    Queries matched: 2
 Cox8atp6gfp fusion protein.- Cloning vector pINT1.
      AAG26344                          Mass: 35725    Score: 117    Queries matched: 2
 Cox8ND6gfp fusion protein.- Cloning vector pINT1.
      AAV27315                          Mass: 27892    Score: 117    Queries matched: 2
 AY741665 NID: - Cloning vector p713-909
      AAW28902                          Mass: 41422    Score: 117    Queries matched: 2
 AY841887 NID: - Trafficking reporter vector pIN-G
      AAG29454                          Mass: 26991    Score: 117    Queries matched: 2
 GFP.- Promoter probe vector pPROBE-NT.
      AAG29470                          Mass: 28334    Score: 117    Queries matched: 2
 GFP[AAV].- Promoter probe vector pPROBE-gfp[AAV].
      AAG29478                          Mass: 28350    Score: 117    Queries matched: 2
 GFP[ASV].- Promoter probe vector pPROBE-gfp[ASV].
      AAG29486                          Mass: 28376    Score: 117    Queries matched: 2
 GFP[LVA].- Promoter probe vector pPROBE-gfp[LVA].
      AAG34036                          Mass: 27041    Score: 117    Queries matched: 2
 Yellow fluorescent protein yfp.- yfp marker plasmid pWM1008.
      AAG34040                          Mass: 26927    Score: 117    Queries matched: 2
 Cyan fluorescent protein cfp.- cfp marker plasmid pWM1009.
      AAG34521                          Mass: 29800    Score: 117    Queries matched: 2
 Enhanced green fluorescent protein 3.- N-terminal GFP fusion vector pUG34.
      AAT34984                          Mass: 51144    Score: 117    Queries matched: 2
 AY598429 NID: - Expression vector pMF280
      AAT34986                          Mass: 77618    Score: 117    Queries matched: 2
 AY598430 NID: - Expression vector pMF309
      CAD37450                          Mass: 26939    Score: 117    Queries matched: 2
 Sequence 1 from Patent EP1209167.- Aequorea victoria (Jellyfish).
      CAD37453                          Mass: 46753    Score: 117    Queries matched: 2
 Sequence 4 from Patent EP1209167.- synthetic construct.
      CAC37686                          Mass: 27794    Score: 117    Queries matched: 2
 Green fluorescent protein.- Integration vector pSMRG2+.
      CAC38925                          Mass: 37940    Score: 117    Queries matched: 2
 Sequence 5 from Patent WO0132900 (Fragment).- synthetic construct.
      CAC39546                          Mass: 28624    Score: 117    Queries matched: 2
 Sequence 7 from Patent WO0132852 (Fragment).- synthetic construct.
      CAC39554                          Mass: 28566    Score: 117    Queries matched: 2
 Sequence 11 from Patent WO0132684 (Fragment).- synthetic construct.
      CAC39555                          Mass: 31621    Score: 117    Queries matched: 2
 Sequence 13 from Patent WO0132684 (Fragment).- synthetic construct.
      AAC40225                          Mass: 27018    Score: 117    Queries matched: 2
 RATIOMETRIC PHLUORIN.- synthetic construct.
      AAC40226                          Mass: 27058    Score: 117    Queries matched: 2
 ECLIPTIC PHLUORIN.- synthetic construct.
      AAY43691                          Mass: 65337    Score: 117    Queries matched: 2
 AY994192 NID: - Cloning vector pSJS1472
      AAS45194                          Mass: 28406    Score: 117    Queries matched: 2
 AY523997 NID: - Expression vector pTH6nGFPc
      AAS45196                          Mass: 28446    Score: 117    Queries matched: 2
 AY523998 NID: - Expression vector pTH6cGFPn
      AAB47853                          Mass: 29890    Score: 117    Queries matched: 2
 Modified green fluorescent protein GFP-ER.- synthetic construct.
      AAB47998                          Mass: 26941    Score: 117    Queries matched: 2
 MODIFIED GREEN FLUORESCENT PROTEIN GFP5.- synthetic construct.
      AAO48591                          Mass: 27445    Score: 117    Queries matched: 2
 Yellow fluorescent protein.- Expression vector pBS-35S-YFP.
      AAO48597                          Mass: 28595    Score: 117    Queries matched: 2
 Yellow fluorescent protein.- Expression vector pBS-35S-Ala-YFP.
      AAO48599                          Mass: 28268    Score: 117    Queries matched: 2
 Yellow fluorescent protein.- Expression vector pBS-35S-YFP-Ala.
      AAG49142                          Mass: 52483    Score: 117    Queries matched: 2
 SooQI-507GFP fusion protein.- Cloning vector pINT1.
      AAG49427                          Mass: 31992    Score: 117    Queries matched: 2
 Nuclear eGFP.- Stinger GFP transformation vector.
      AAB51347                          Mass: 28122    Score: 117    Queries matched: 2
 Green fluorescent protein.- synthetic construct.
      AAB51348                          Mass: 28076    Score: 117    Queries matched: 2
 Green fluorescent protein.- synthetic construct.
      CAD53293                          Mass: 29400    Score: 117    Queries matched: 2
 Cyan fluorescent protein.- Cloning vector pDXA-CFP-MCS.
      CAD53296                          Mass: 29485    Score: 117    Queries matched: 2
 Yellow fluorescent protein.- Cloning vector pDXA-YFP-MCS.
      CAD53299                          Mass: 29769    Score: 117    Queries matched: 2
 Yellow fluorescent protein.- Cloning vector pDXA-YFP-NotI.
      CAD53302                          Mass: 29298    Score: 117    Queries matched: 2
 Yellow fluorescent protein.- Cloning vector pDXA-MCS-YFP.
      CAD53309                          Mass: 28366    Score: 117    Queries matched: 2
 Cyan fluorescent protein.- Cloning vector pDXA-CFP.
      CAD53312                          Mass: 28452    Score: 117    Queries matched: 2
 Yellow fluorescent protein.- Cloning vector pDXA-yFP.
      AAC53659                          Mass: 27073    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN, S65T VARIANT.- Cloning vector phGFP-S65T.
      AAC53684                          Mass: 26759    Score: 117    Queries matched: 2
 GFP PROTEIN (FRAGMENT).- Cloning vector pFW_GFP.
      AAK54502                          Mass: 46315    Score: 117    Queries matched: 2
 45 kDa SIGFI-GFP fusion protein.- synthetic construct.
      AAK54682                          Mass: 61083    Score: 117    Queries matched: 2
 Secretory IgCEPUS-GFP fusion protein.- synthetic construct.
      AAD55053                          Mass: 26955    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN.- Expression vector FRMwg.
      AAW55663                          Mass: 34860    Score: 117    Queries matched: 2
 AY860671 NID: - Expression vector pTGPI-GFP
      AAO61297                          Mass: 27944    Score: 117    Queries matched: 2
 EGFP.- BAC cloning vector pEBAC190G.
      CAB61435                          Mass: 30952    Score: 117    Queries matched: 2
 Green flourescent protein.- Schizosaccharomyces pombe (Fission yeast).
      AAF62891                          Mass: 29352    Score: 117    Queries matched: 2
 Enhanced GFP variant.- Cloning vector pEGAD.
      AAY63958                          Mass: 64830    Score: 117    Queries matched: 2
 DQ022572 NID: - Expression vector pEGFP-Pax9
      CAH64883                          Mass: 27035    Score: 117    Queries matched: 2
 AJ851278 NID: - Cloning vector pRU1097
      CAH64884                          Mass: 28138    Score: 117    Queries matched: 2
 AJ851279 NID: - Cloning vector pRU1098
      CAH64885                          Mass: 28124    Score: 117    Queries matched: 2
 AJ851280 NID: - Cloning vector pRU1099
      CAH64886                          Mass: 28166    Score: 117    Queries matched: 2
 AJ851281 NID: - Cloning vector pRU1100
      CAH64887                          Mass: 28140    Score: 117    Queries matched: 2
 AJ851282 NID: - Cloning vector pRU1101
      CAA65278                          Mass: 26981    Score: 117    Queries matched: 2
 UNGFPJELL NID: - unidentified
      AAF65344                          Mass: 28449    Score: 117    Queries matched: 2
 MGFP5*, hexaHis tagged.- Binary vector pCAMBIA-1302.
      AAF65347                          Mass: 97388    Score: 117    Queries matched: 2
 GUSA (N358Q)/MGFP5 fusion, hexaHis tagged.- Binary vector pCAMBIA-1303.
      AAF65352                          Mass: 97388    Score: 117    Queries matched: 2
 MGFP5-GUSA fusion protein.- Binary vector pCAMBIA-1304.
      AAF65451                          Mass: 61819    Score: 117    Queries matched: 2
 ECFP-estrogen receptor ligand binding domain fusion protein.- Homo sapiens (Human).
      AAF65452                          Mass: 77947    Score: 117    Queries matched: 2
 ECFP-retinoic acid receptor alpha fusion protein.- Homo sapiens (Human).
      AAF65453                          Mass: 58701    Score: 117    Queries matched: 2
 ECFP-retinoic acid receptor ligand binding domain fusion protein.- Homo sapiens (Human).
      AAF65454                          Mass: 30817    Score: 117    Queries matched: 2
 PBP interaction domain-EYFP fusion protein.- Mus musculus (Mouse).
      AAF65455                          Mass: 27089    Score: 117    Queries matched: 2
 SRC1 interaction domain-EYFP fusion protein.- Homo sapiens (Human).
      AAS66682                          Mass: 27038    Score: 117    Queries matched: 2
 AY533296 NID: - synthetic construct
      AAK67296                          Mass: 59462    Score: 117    Queries matched: 2
 SIGF1-GFP fusion protein.- synthetic construct.
      AAK67297                          Mass: 58771    Score: 117    Queries matched: 2
 IGFII-GFP fusion protein.- synthetic construct.
      BAB68313                          Mass: 27357    Score: 117    Queries matched: 2
 Codon-optimized GFPmut1.- Expression vector pTub-tel3 GFP3.
      CAB69249                          Mass: 30044    Score: 117    Queries matched: 2
 SEQUENCE 1 FROM PATENT WO9855873.- unidentified.
      CAB69293                          Mass: 97035    Score: 117    Queries matched: 2
 SEQUENCE 42 FROM PATENT WO9845704.- unidentified.
      CAB69294                          Mass: 72745    Score: 117    Queries matched: 2
 SEQUENCE 44 FROM PATENT WO9845704.- unidentified.
      CAB69295                          Mass: 69357    Score: 117    Queries matched: 2
 SEQUENCE 46 FROM PATENT WO9845704.- unidentified.
      CAB69296                          Mass: 111408   Score: 117    Queries matched: 2
 SEQUENCE 48 FROM PATENT WO9845704.- unidentified.
      CAB69297                          Mass: 81521    Score: 117    Queries matched: 2
 SEQUENCE 50 FROM PATENT WO9845704.- unidentified.
      CAB69298                          Mass: 89736    Score: 117    Queries matched: 2
 SEQUENCE 52 FROM PATENT WO9845704.- unidentified.
      CAB69299                          Mass: 118782   Score: 117    Queries matched: 2
 SEQUENCE 54 FROM PATENT WO9845704.- unidentified.
      CAB69302                          Mass: 96470    Score: 117    Queries matched: 2
 SEQUENCE 60 FROM PATENT WO9845704.- unidentified.
      CAB69303                          Mass: 72444    Score: 117    Queries matched: 2
 SEQUENCE 62 FROM PATENT WO9845704.- unidentified.
      CAB69304                          Mass: 69225    Score: 117    Queries matched: 2
 SEQUENCE 64 FROM PATENT WO9845704.- unidentified.
      CAB69305                          Mass: 111617   Score: 117    Queries matched: 2
 SEQUENCE 66 FROM PATENT WO9845704.- unidentified.
      CAB69309                          Mass: 81551    Score: 117    Queries matched: 2
 SEQUENCE 74 FROM PATENT WO9845704.- unidentified.
      CAB69310                          Mass: 88986    Score: 117    Queries matched: 2
 SEQUENCE 76 FROM PATENT WO9845704.- unidentified.
      CAB69311                          Mass: 119527   Score: 117    Queries matched: 2
 SEQUENCE 78 FROM PATENT WO9845704.- unidentified.
      CAB69312                          Mass: 99103    Score: 117    Queries matched: 2
 SEQUENCE 108 FROM PATENT WO9845704.- unidentified.
      CAB69313                          Mass: 98583    Score: 117    Queries matched: 2
 SEQUENCE 110 FROM PATENT WO9845704.- unidentified.
      CAB69314                          Mass: 61793    Score: 117    Queries matched: 2
 SEQUENCE 112 FROM PATENT WO9845704.- unidentified.
      CAB69315                          Mass: 61754    Score: 117    Queries matched: 2
 SEQUENCE 114 FROM PATENT WO9845704.- unidentified.
      CAB69316                          Mass: 95882    Score: 117    Queries matched: 2
 SEQUENCE 116 FROM PATENT WO9845704.- unidentified.
      CAB69317                          Mass: 96955    Score: 117    Queries matched: 2
 SEQUENCE 118 FROM PATENT WO9845704.- unidentified.
      CAB69320                          Mass: 68671    Score: 117    Queries matched: 2
 SEQUENCE 124 FROM PATENT WO9845704.- unidentified.
      CAB69321                          Mass: 50130    Score: 117    Queries matched: 2
 SEQUENCE 126 FROM PATENT WO9845704.- unidentified.
      CAB69322                          Mass: 43220    Score: 117    Queries matched: 2
 SEQUENCE 128 FROM PATENT WO9845704.- unidentified.
      CAB69328                          Mass: 88418    Score: 117    Queries matched: 2
 SEQUENCE 140 FROM PATENT WO9845704.- unidentified.
      CAB69329                          Mass: 88453    Score: 117    Queries matched: 2
 SEQUENCE 142 FROM PATENT WO9845704.- unidentified.
      AAA69542                          Mass: 27357    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-1.
      AAA69546                          Mass: 29987    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-C3.
      AAA69550                          Mass: 29410    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-C1.
      AAA69552                          Mass: 30004    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-C2.
      CAH69765                          Mass: 32466    Score: 117    Queries matched: 2
 CQ896999 NID: - Aequorea victoria
      CAH69776                          Mass: 31931    Score: 117    Queries matched: 2
 CQ897001 NID: - Aequorea victoria
      AAQ74414                          Mass: 85222    Score: 117    Queries matched: 2
 AY299332 NID: - synthetic construct
      CAI75176                          Mass: 76606    Score: 117    Queries matched: 2
 CS055383 NID: - synthetic construct
      AAT76174                          Mass: 28340    Score: 117    Queries matched: 2
 AY653731 NID: - Cloning vector pICFP
      AAT76175                          Mass: 28426    Score: 117    Queries matched: 2
 AY653732 NID: - Cloning vector pIYFP
      AAN76202                          Mass: 65195    Score: 117    Queries matched: 2
 Lysosomal cysteine proteinase cathepsin B/green fluorescent protein EGFP fusion protein (EC 3.4.22.
      AAS76482                          Mass: 28666    Score: 117    Queries matched: 2
 AY561434 NID: - Cloning vector pHyVec1
      AAC78774                          Mass: 26993    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN (FRAGMENT).- Expression vector pYZ3N-GFP.
      AAA79304                          Mass: 29349    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN, RSGFP4 VARIANT.- Cloning vector pRSGFP-C1.
      AAA79306                          Mass: 29424    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN, S65T VARIANT.- Cloning vector pS65T-C1.
      CAD80175                          Mass: 16870    Score: 117    Queries matched: 2
 N'-EGFP (Fragment).- synthetic construct.
      AAY81662                          Mass: 99358    Score: 117    Queries matched: 2
 AY739899 NID: - Cloning vector pRGK337
      AAC82461                          Mass: 27081    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN.- Cloning vector pAVA319.
      AAX83124                          Mass: 27010    Score: 117    Queries matched: 2
 AY952326 NID: - synthetic construct
      BAD84181                          Mass: 27213    Score: 117    Queries matched: 2
 AB195239 NID: - Paramecium synthetic construct
      AAK85195                          Mass: 30077    Score: 117    Queries matched: 2
 MCS-GFP309-His tag fusion.- Expression vector pBGH.
      CAC88661                          Mass: 48770    Score: 117    Queries matched: 2
 Sequence 47 from Patent WO0166565.- Synechocystis sp. (strain PCC 6803).
      CAD90235                          Mass: 61325    Score: 117    Queries matched: 2
 Sequence 13 from Patent WO03025172.- synthetic construct.
      BAD91039                          Mass: 53625    Score: 117    Queries matched: 2
 AB205477 NID: - synthetic construct
      BAD91040                          Mass: 51415    Score: 117    Queries matched: 2
 AB205478 NID: - synthetic construct
      BAD91041                          Mass: 53996    Score: 117    Queries matched: 2
 AB205481 NID: - synthetic construct
      BAD91042                          Mass: 51786    Score: 117    Queries matched: 2
 AB205482 NID: - synthetic construct
      AAB92477                          Mass: 27096    Score: 117    Queries matched: 2
 GREEN FLUORESCENT PROTEIN GFP+.- synthetic construct.
      Q93125_AEQVI                      Mass: 26937    Score: 117    Queries matched: 2
 Green fluorescent protein mutant 3.- Aequorea victoria (Jellyfish).
      AAQ93355                          Mass: 27990    Score: 117    Queries matched: 2
 AY391252 NID: - Yellow H-Pelican YFP transformation vector
      AAQ96626                          Mass: 27361    Score: 117    Queries matched: 2
 AY303166 NID: - CFP Integration vector pSMUC2+
      AAQ96629                          Mass: 27447    Score: 117    Queries matched: 2
 AY303167 NID: - YFP Integration vector pSMUY2+
      AAX97736                          Mass: 28638    Score: 117    Queries matched: 2
 AY995137 NID: - Cloning vector pBS 35S YFP-attR
      AAV97899                          Mass: 27092    Score: 117    Queries matched: 2
 AY818369 NID: - Cloning vector pSAT6-Citrine-N1
      Q8GHE4_9GAMM                      Mass: 26999    Score: 116    Queries matched: 2
 Green fluorescence protein.- Azomonas agilis.
      CAC08898                          Mass: 120509   Score: 116    Queries matched: 2
 Sequence 3 from Patent WO0023091.- synthetic construct.
      CAH25994                          Mass: 73949    Score: 116    Queries matched: 2
 CQ866776 NID: - synthetic construct
      AAQ55067                          Mass: 68221    Score: 116    Queries matched: 2
 AY292281 NID: - synthetic construct
      CAB69292                          Mass: 69525    Score: 116    Queries matched: 2
 SEQUENCE 40 FROM PATENT WO9845704.- unidentified.
      CAB69301                          Mass: 69380    Score: 116    Queries matched: 2
 SEQUENCE 58 FROM PATENT WO9845704.- unidentified.
      CAB69318                          Mass: 114004   Score: 116    Queries matched: 2
 SEQUENCE 120 FROM PATENT WO9845704.- unidentified.
      CAB69319                          Mass: 114034   Score: 116    Queries matched: 2
 SEQUENCE 122 FROM PATENT WO9845704.- unidentified.
      CAB69323                          Mass: 128761   Score: 116    Queries matched: 2
 SEQUENCE 130 FROM PATENT WO9845704.- unidentified.
      CAB69324                          Mass: 129892   Score: 116    Queries matched: 2
 SEQUENCE 132 FROM PATENT WO9845704.- unidentified.
      CAB69325                          Mass: 106146   Score: 116    Queries matched: 2
 SEQUENCE 134 FROM PATENT WO9845704.- unidentified.
      CAB69326                          Mass: 106013   Score: 116    Queries matched: 2
 SEQUENCE 136 FROM PATENT WO9845704.- unidentified.
      CAE00370                          Mass: 106908   Score: 115    Queries matched: 2
 Sequence 171 from Patent EP1314980 (Fragment).- synthetic construct.
      AAT02528                          Mass: 58935    Score: 115    Queries matched: 2
 AY596277 NID: - Cloning vector pUC-gfp-neo
      AAT02530                          Mass: 61345    Score: 115    Queries matched: 2
 AY596277 NID: - Cloning vector pUC-gfp-neo
      AAB07866                          Mass: 119117   Score: 115    Queries matched: 2
 GREEN FLUORESCENT PROTEIN-GLUCOCORTICOID RECEPTOR CHIMERIC PROTEIN.- Cloning vector pCI-nGFP-C656G.
      CAC08900                          Mass: 129741   Score: 115    Queries matched: 2
 Sequence 7 from Patent WO0023091.- Aequorea victoria (Jellyfish).
      BAB32740                          Mass: 56517    Score: 115    Queries matched: 2
 Red-shift green fluorescent protein-fused neomycin phosphotransferase.- Human parvovirus B19.
      CAH33959                          Mass: 67230    Score: 115    Queries matched: 2
 CQ868376 NID: - synthetic construct
      AAD47137                          Mass: 97135    Score: 115    Queries matched: 2
 Green fluorescent protein-estrogen receptor alpha fusion.- Mammalian expression vector pCI-nGL1-HEG
      AAB66883                          Mass: 56378    Score: 115    Queries matched: 2
 Fluorescent neomycin phosphotransferase fusion protein.- Escherichia coli.
      AAX22059                          Mass: 113647   Score: 114    Queries matched: 2
 AY928551 NID: - synthetic construct
      CAH25978                          Mass: 70957    Score: 114    Queries matched: 2
 CQ860004 NID: - synthetic construct
      CAB69307                          Mass: 83768    Score: 114    Queries matched: 2
 SEQUENCE 70 FROM PATENT WO9845704.- unidentified.
      CAB69327                          Mass: 83915    Score: 114    Queries matched: 2
 SEQUENCE 138 FROM PATENT WO9845704.- unidentified.
      CAE00361                          Mass: 116238   Score: 113    Queries matched: 2
 Sequence 31 from Patent EP1314980.- synthetic construct.
      CAE00362                          Mass: 60592    Score: 113    Queries matched: 2
 Sequence 33 from Patent EP1314980 (Fragment).- synthetic construct.
      CAH04268                          Mass: 82047    Score: 113    Queries matched: 2
 AJ783754 NID: - synthetic construct
      BAC16311                          Mass: 85860    Score: 113    Queries matched: 2
 Raichu-1011X.- Homo sapiens (Human).
      BAC16312                          Mass: 85594    Score: 113    Queries matched: 2
 Raichu-1054X.- Homo sapiens (Human).
      BAD30083                          Mass: 73565    Score: 113    Queries matched: 2
 AB178711 NID: - synthetic construct
      BAD30084                          Mass: 73564    Score: 113    Queries matched: 2
 AB178712 NID: - synthetic construct
      BAD30085                          Mass: 73563    Score: 113    Queries matched: 2
 AB178713 NID: - synthetic construct
      BAD30086                          Mass: 77204    Score: 113    Queries matched: 2
 AB178714 NID: - synthetic construct
      BAD32702                          Mass: 129006   Score: 113    Queries matched: 2
 AB161231 NID: - synthetic construct
      AAR37359                          Mass: 63023    Score: 113    Queries matched: 2
 AY422822 NID: - synthetic construct
      AAL50640                          Mass: 66986    Score: 113    Queries matched: 2
 Src reporter.- synthetic construct.
      AAW56610                          Mass: 67785    Score: 113    Queries matched: 2
 AY862145 NID: - synthetic construct
      BAB61868                          Mass: 85646    Score: 113    Queries matched: 2
 Raichu404X.- Homo sapiens (Human).
      BAB61869                          Mass: 83742    Score: 113    Queries matched: 2
 Rai-chu 101.- Homo sapiens (Human).
      BAB61870                          Mass: 86561    Score: 113    Queries matched: 2
 Rai-chu 101X.- Homo sapiens (Human).
      BAB61871                          Mass: 80313    Score: 113    Queries matched: 2
 Picchu-236.- Homo sapiens (Human).
      BAB61872                          Mass: 83132    Score: 113    Queries matched: 2
 Picchu-236-X.- Homo sapiens (Human).
      BAC99017                          Mass: 87572    Score: 113    Queries matched: 2
 AB074297 NID: - synthetic construct
      CAE00356                          Mass: 172980   Score: 112    Queries matched: 2
 Sequence 21 from Patent EP1314980.- synthetic construct.
      AAL33624                          Mass: 81923    Score: 112    Queries matched: 2
 Protein kinase A activity reporter 1 fusion protein.- synthetic construct.
      CAD35702                          Mass: 71760    Score: 112    Queries matched: 2
 Sequence 38 from Patent EP1199564.- unidentified.
      AAR37358                          Mass: 84029    Score: 112    Queries matched: 2
 AY422821 NID: - synthetic construct
      AAL50639                          Mass: 66255    Score: 112    Queries matched: 2
 EGF-receptor reporter.- synthetic construct.
      AAL50641                          Mass: 87454    Score: 112    Queries matched: 2
 Crk-based reporter.- synthetic construct.
      CAB69291                          Mass: 71663    Score: 112    Queries matched: 2
 SEQUENCE 38 FROM PATENT WO9845704 (fragment).- unidentified.
      AAR37360                          Mass: 63303    Score: 112    Queries matched: 2
 AY422823 NID: - synthetic construct
4.    Q5A5U4_CANAL                      Mass: 21461    Score: 82     Queries matched: 2
 Hypothetical LDG family protein 7.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   615.87   1229.73   1229.65   0.08 0  20  2.1e+002 1  K.TDDSAPITIVAK.F
22   679.94   1357.87   1357.75   0.12 1  62  0.011 1  K.KTDDSAPITIVAK.F

5.    Q9HFS1_CANAL                      Mass: 25603    Score: 42     Queries matched: 1
 Glycosyl-phosphatidylinositol protein.- Candida albicans (Yeast).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
14   618.85   1235.68   1235.59   0.10 0  44  0.82 1  K.IYDQLPECAK.E

 
      Proteins matching the same set of peptides:
      Q9HFZ1_CANAL                      Mass: 24614    Score: 42     Queries matched: 1
 Repressed by TUP1 protein 5.- Candida albicans (Yeast).
      Q59UP6_CANAL                      Mass: 25603    Score: 42     Queries matched: 1
 Potential cell surface antigen.- Candida albicans SC5314.
6.    Q24009_DROME                      Mass: 98187    Score: 32     Queries matched: 1
 BicC protein (CG4824-PA, isoform A) (Cg4824-pb, isoform b).- Drosophila melanogaster (Fruit fly).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
3   463.77   925.53   925.43   0.10 0  34  5.5 1  M.LSCASFNK.L

 
      Proteins matching the same set of peptides:
      EAL33248                          Mass: 102367   Score: 32     Queries matched: 1
 CH379061 NID: - Drosophila pseudoobscura
      S55051                            Mass: 102601   Score: 32     Queries matched: 1
 Bicaudal-C - fruit fly (Drosophila melanogaster)
7.    Q5AJC0_CANAL                      Mass: 52187    Score: 32     Queries matched: 1
 Hypothetical protein UTR2.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
31   803.96   1605.90   1605.78   0.12 0  34  7.7 1  R.IQFSLWPGGDSSNAK.G

8.    Q7SIS7_9RETR                      Score: 32     Queries matched: 1
 Gag protein.- Simian foamy virus-orangutan.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   653.87   1305.72   1305.72   0.00 1  33  9.2 4  R.NPRHLETIGLR.M + Deamidation (NQ)

9.    Q4DWX6_TRYCR                      Score: 31     Queries matched: 1
 Hypothetical protein.- Trypanosoma cruzi.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   653.87   1305.72   1305.59   0.12 0  33  9.3 5  K.ASADITDLENQK.S + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      Q4E4H0_TRYCR                      Score: 31     Queries matched: 1
10.   Q4N8Y7_THEPA                      Score: 31     Queries matched: 1
 Hypothetical protein.- Theileria parva.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   463.77   925.53   925.50   0.03 0  33  7.3 2  R.ISSHIQNK.Q

 
      Proteins matching the same set of peptides:
      Q4UGR2_THEAN                      Score: 31     Queries matched: 1
11.   Q7RQL1_PLAYO                      Score: 31     Queries matched: 1
 Myosin heavy chain.- Plasmodium yoelii yoelii.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   653.87   1305.72   1305.57   0.15 1  34  8 2  K.NNDINKTDENK.R + 2 Deamidation (NQ)

12.   Q7RMJ4_PLAYO                      Score: 30     Queries matched: 1
 Hypothetical protein.- Plasmodium yoelii yoelii.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   653.87   1305.72   1306.48   -0.76 0  32  12 8  K.NNNNNNNIENK.D + 6 Deamidation (NQ)

13.   Q4L860_STAHJ                      Score: 30     Queries matched: 1
 Asp23 protein.- Staphylococcus haemolyticus (strain JCSC1435).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   653.87   1305.72   1306.47   -0.75 0  32  12 9  K.NNNNNNNNSER.S + 4 Deamidation (NQ)

14.   Q55E01_DICDI                      Score: 30     Queries matched: 1
 Hypothetical protein.- Dictyostelium discoideum (Slime mold).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   653.87   1305.72   1306.45   -0.74 0  32  12 9  M.DNNNNNNNNEK.Y + 4 Deamidation (NQ)

15.   Q7F929_ORYSA                      Score: 30     Queries matched: 1
 OSJNBb0061C13.5 protein.- Oryza sativa (japonica cultivar-group).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 22   679.94   1357.87   1357.72   0.15 1  30  17 2  R.KTLSTSATGDLHK.A

16.   Q8ILH9_PLAF7                      Score: 30     Queries matched: 1
 Hypothetical protein.- Plasmodium falciparum (isolate 3D7).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   653.87   1305.72   1306.52   -0.80 0  34  8.6 3  K.NNDNETINDEK.N + 2 Deamidation (NQ)

17.   Q651X6_ORYSA                      Mass: 83190    Score: 30     Queries matched: 1
 Putative cellulose synthase-like protein OsCslE1.- Oryza sativa (japonica cultivar-group).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   410.79   819.56   819.36   0.20 0  30  22 1  K.VSDGDEAK.R

18.   Q7V587_PROMM                      Mass: 26624    Score: 29     Queries matched: 1
 Heme oxygenase (EC 1.14.99.3).- Prochlorococcus marinus (strain MIT 9313).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   531.31   1060.61   1059.57   1.04 0  29  25 1  -.MAVALASQLR.E + Deamidation (NQ)

19.   Q5CV94_CRYPV                      Mass: 73845    Score: 29     Queries matched: 1
 DNAj protein (Fragment).- Cryptosporidium parvum.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   653.87   1305.72   1305.56   0.16 0  34  7.8 1  K.NNDITEELNNK.S + 3 Deamidation (NQ)

20.   Q23807_CRAVI                      Mass: 8901     Score: 29     Queries matched: 1
 Crassostrea virginica engrailed homolog (Fragment).- Crassostrea virginica (Eastern oyster).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
28   787.48   1572.95   1572.81   0.14 1  31  16 1  K.NTLALKLMAQGHYN.-

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   608.36   1214.70   1214.73   -0.03 0  24  71 1  AVPLELGIIYK
32   806.41   1610.80   1611.86   -1.07 0  22  1.1e+002 1  EQEILWAINDIIR
34   817.93   1633.85   1632.81   1.04 1  22  1.3e+002 1  DVEPKINDWNYLK
16   635.89   1269.77   1269.65   0.12 0  22  1.4e+002 1  APPPANTFGGVSR
12   609.84   1217.67   1217.65   0.02 1  21  1.6e+002 1  GSPIIRQYQR + Deamidation (NQ)
24   726.45   1450.88   1450.73   0.15 0  20  1.7e+002 1  SQAELFTISDLAR + Deamidation (NQ)
27   783.95   1565.88   1565.78   0.10 1  20  1.8e+002 1  MEVGMVLKQSDGLK + 2 Oxidation (M)
23   716.92   1431.82   1430.69   1.13 0  19  2.4e+002 1  AELSNENVEALNK + Deamidation (NQ)
15   633.35   1264.68   1264.60   0.08 0  18  2.8e+002 1  GIWETMLTGLE + Oxidation (M)
20   667.36   1332.71   1331.61   1.10 0  17  4.2e+002 1  MYVTGTLASMDK + Oxidation (M)
25   732.93   1463.84   1462.73   1.11 1  17  4.2e+002 1  VNDSAQRFIAWR + Deamidation (NQ)
44   778.80   2333.39   2333.00   0.38 1  16  3.1e+002 1  QAGDEVERLNQQLEDEEEAK + 4 Deamidation (NQ)
19   662.36   1322.71   1322.63   0.08 0  16  5.1e+002 1  SLGMLAFDNQAR + Deamidation (NQ)
17   649.40   1296.79   1295.71   1.08 1  16  4.7e+002 1  IKDHLTGNTALL + Deamidation (NQ)
10   596.84   1191.67   1190.52   1.15 0  14  7.1e+002 1  NADGIEGTGGGSR + Deamidation (NQ)
4   491.79   981.58   982.47   -0.90 0  14  6.2e+002 1  HGNVEEAVK + Deamidation (NQ)
35   822.94   1643.86   1643.84   0.02 1  14  8.3e+002 1  VPEDQEMEKLIGIK + Oxidation (M)
8   540.82   1079.62   1079.53   0.09 0  13  9.7e+002 1  YEVLAVLCN
30   797.95   1593.88   1594.84   -0.96 0  13  9.2e+002 1  VLAVCSEVTVLSYR
40   952.04   1902.07   1901.93   0.15 0  13  8.8e+002 1  AAGFQAELEVAAPTGEWR
41   967.05   1932.09   1931.98   0.10 0  11  1.2e+003 1  EIIVGYLPMPANNSTWK
29   794.42   1586.83   1586.85   -0.02 1  11  1.8e+003 1  LNPLFEKALDHYK
2   454.17   906.33   905.45   0.89 1  10  1.9e+003 1  GAKNAESTK + Deamidation (NQ)
39   931.97   1861.94   1862.88   -0.94 1  10  1.8e+003 1  SQSDSPPLSNSLMTRSR + Deamidation (NQ)
5   512.28   1022.55   1021.51   1.04 0  10  2e+003 1  TEFLNQAAK + Deamidation (NQ)
26   770.42   1538.83   1537.79   1.04 1  8  2.7e+003 1  KTLVSNDINQIYK + 3 Deamidation (NQ)
43   1112.68   2223.35   2223.99   -0.64 0  7  2.2e+003 1  SNPNLNFGNAFQMSPNDIAR + 2 Deamidation (NQ); Oxidation (M)
42   1067.56   2133.10   2133.98   -0.88 1  7  3e+003 1  ARVIGQDQVCEDIAQQMR + 2 Deamidation (NQ); Oxidation (M)
45   1023.90   3068.67   3069.37   -0.69 0  5  3.7e+003 1  THSTKPCVIQMATTGDADSDAGSAVSGFDK + Oxidation (M)

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 45

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 41 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 29.8    0.20   17  Q651X6_ORYSA K.VSDGDEAK.R
 27.6    0.18                    K.VSDGPMSK.T
 27.6    0.16                    R.VSDEKNK.F
 27.1    1.19                    K.GQDLGSDK.R
 26.7    1.11                    K.KGATLSDK.S
 26.5    0.13                    M.VTTGLNSK.L
 26.4    0.23                    R.GQDGQASR.A
 26.2    0.15                    K.VSERSNK.I
 26.2    0.13                    K.VGTTISNK.N
 26.2    0.11                    K.VKMLSDK.M
Top scoring peptide matches to query 2
Score greater than 21 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3    0.89        K.GAKNAESTK.S
  8.4    0.91        R.GYGLPEDR.I
  8.3   -1.04        M.QMSPALTC.-
  7.8   -0.06        K.NVTNSCGR.G
  7.5   -0.15        M.QALLFLMA.-
  7.5   -1.15        K.EGFFLAPK.A
  7.5   -1.15        R.FGEFIAPK.S
  7.5   -1.06        R.KEGLMNAQ.-
  7.5   -1.11        -.MADFLAPK.S
  7.5   -1.18        K.VYAFLAPK.I
Top scoring peptide matches to query 3
Score greater than 35 indicates homology
Score greater than 54 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 34.4    0.10    6  Q24009_DROME M.LSCASFNK.L
 33.1    0.03   10  Q4N8Y7_THEPA R.ISSHIQNK.Q
 21.5    0.01                    K.LSSHEILK.L
 19.4   -0.96                    K.NSSHTLLR.N
 19.1    0.05                    R.ISSTLYNK.K
 19.0    0.01                    K.LSSGLPPQK.A
 18.3   -0.79                    R.NSCCSNGK.E
 17.7    0.13                    K.LSCFDQR.C
 17.4    0.03                    K.IKNYFNK.Q
 17.4    0.03                    K.LKNYFNK.S
Top scoring peptide matches to query 4
Score greater than 23 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.2   -0.90        K.HGNVEEAVK.I
 14.2   -0.87        R.HGVDVDDAR.A
  9.9    1.04        R.GWRAAAPPR.W
  9.5    1.16        R.GQGAEEYAR.I
  9.5    1.15        R.GQGTLNMSR.-
  9.5    1.10        K.GWSLEAYR.A
  9.5    1.10        R.GWTLDFSR.I
  7.5    1.11        K.FTDMQVPK.G
  7.5    1.14        R.MPHEINPQ.-
  7.5    1.12        K.ENINSNYK.L
Top scoring peptide matches to query 5
Score greater than 21 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.6    1.04        R.TEFLNQAAK.I
  9.5    1.06        R.AASSSSSRNR.Q
  7.9    1.07        M.TDEFQINR.N
  7.2    1.06        R.NTRDVFNR.V
  7.2    1.06        R.SQRDVFNR.R
  7.0    1.10        K.DMNIKNNR.R
  7.0    1.07        R.FTELQDGGR.L
  7.0    1.06        K.NFDIRSNR.N
  7.0    1.10        R.NMMLWGGGR.R
  7.0    1.11        K.NNFIENNR.K
Top scoring peptide matches to query 6
Score greater than 41 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 50.7    0.09    3  1BFP2 K.FEGDTLVNR.I
 26.4    0.03             K.FQGNTLKLK.L
 26.0    0.09             K.FEGITDGGVR.E
 25.2    1.16             R.QCPESATQK.I
 23.1    0.09             R.IYGQAEVNR.L
 23.0    0.09             R.FETAAEINR.L
 22.7    0.16             K.MEGDIENAR.S
 22.6    1.13             K.EMPLDTAQK.I
 22.4    1.05             R.KCSLLTAEK.R
 21.6    1.10             R.SNSVTSTPQK.I
Top scoring peptide matches to query 7
Score greater than 41 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 29.1    1.04   18  Q7V587_PROMM -.MAVALASQLR.E
 27.2   -0.89                    R.LESDNSELR.N
 21.1    0.08                    R.QLSNLGCLR.N
 20.9   -0.89                    K.ELSDTGDGLR.T
 20.0    0.11                    K.IQSNNNQLK.E
 17.2   -0.91                    K.ELAMNESIR.Y
 17.0   -0.91                    R.QLSNLGCLR.N
 16.8    1.08                    K.DSVARDEIR.E
 15.5   -0.88                    K.IESNNQNLK.E
 15.1   -0.96                    K.EISSTVASLR.L
Top scoring peptide matches to query 8
Score greater than 23 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.0    0.09        R.YEVLAVLCN.-
 10.1    0.09        K.LSVIEFVNC.-
  9.1    1.04        R.HGPVLSDVQK.S
  8.3    1.09        R.EIGEFLTDR.G
  8.3    1.09        K.ELGEFLSQR.R
  8.1   -0.90        R.YEVLAVLCN.-
  7.6   -0.88        R.YCSLFTYK.D
  7.3    0.07        K.DYLISNVEK.N
  7.3    0.16        K.NSLPQFVNC.-
  6.8    0.07        K.YEVSLNNIK.D
Top scoring peptide matches to query 9
Score greater than 29 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 21.9    0.10    2  Q5AFA2_CANAL R.YDQAQDDIK.K
 15.3    0.05                    K.YNKNLSNNK.K
 15.0    0.01                    R.FMKSNLDIK.Y
 13.1    1.08                    CGRISNQMK
 12.8    0.01                    K.YRSNSIINK.N
 12.1    0.01                    K.YDKALNLMK.A
 12.0    0.05                    YSRANQINK
 12.0    0.05                    YSRANQINK
 11.9    0.02                    K.SLSSDQALFK.K
 10.9    1.09                    R.NQTNNIKMK.I
Top scoring peptide matches to query 10
Score greater than 24 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.4    1.15        R.NADGIEGTGGGSR.H
 10.6    0.10        R.AATRSSLGESDV.-
 10.1    0.98        K.TLLMVLEKTK.F
  8.7    1.00        R.LGGIIESFLSR.D
  8.4    1.04        K.NIFFITNPPK.S
  8.4    1.04        K.NLFFITNPPK.S
  8.2    1.04        K.LLNEAKMTQK.K
  8.2    0.05        K.LLNEAKMTQK.K
  7.9    1.16        K.MLNYFMNDK.D
  7.9    0.18        K.MLNYFMNDK.D
Top scoring peptide matches to query 11
Score greater than 35 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.4   -0.03        R.AVPLELGIIYK.K
 22.0    0.12        R.MRNFDEIYK.I
 21.2    0.07        R.GITHLQSPSFK.T
 21.2    0.03        R.GIALSHLNVYK.Q
 20.5    0.11        K.TSKMEQALYK.L
 20.3    0.08        K.TAFKTNELYK.K
 20.1    0.09        R.GAGHNEGLGLYK.N
 20.1    0.10        R.GLTNGATYQYK.V
 19.6    0.03        K.GILQHKEVYK.V
 19.4    0.12        K.KYGNAEQLYK.Q
Top scoring peptide matches to query 12
Score greater than 33 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.2    0.02        K.GSPIIRQYQR.I
 19.7    0.04        K.ALGESGITVSER.L
 15.2    0.10        K.DKQTGQQQER.T
 15.0   -0.94        K.QLDESTLQASK.A
 14.7    0.09        K.QIINMWQEVG.-
 14.7    0.09        K.QILNMWQEVG.-
 14.7    0.04        R.QILSSEEKER.L
 14.7    0.08        R.QILSSEEQER.L
 14.4    0.03        R.LAGIPGKNYER.I
 14.1   -0.01        K.KLLSMIGGVER.K
Top scoring peptide matches to query 13
Score greater than 29 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 19.8    0.08    4  Q5A5U4_CANAL K.TDDSAPITIVAK.F
 19.8    0.18                    R.TNDSASAXVPPR.T
 19.8    0.18                    R.TNDSASAXVPPR.T
 15.5    0.19                    K.TNNPCYFGKK.I
 11.9    0.13                    R.DTNRRPQDVK.F
 11.9    0.13                    R.NTDRRPQDVK.F
 11.9    0.13                    R.NTNRRPEDVK.F
 11.9    0.13                    NTNRRPQDVK
 11.9    0.13                    R.NTNXRPQDVK.F
 10.2    0.08                    K.TNDLLALDVQK.L
Top scoring peptide matches to query 14
Score greater than 39 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 43.7    0.10    5  Q9HFS1_CANAL IYDQLPECAK
 25.7   -0.89    5  Q9HFS1_CANAL IYDQLPECAK
 24.4    0.03                    M.IYNKISNLNR.Y
 22.8    0.15                    K.LYNNPDNQQK.L
 22.5    0.01                    K.LYDKLTENLK.G
 22.2    0.04                    K.LYQGGINETIK.N
 22.1    0.03                    M.IYNKISNLNR.Y
 22.1    0.08                    K.EMKDIETLNK.N
 22.0    0.04                    R.LYQNLCRLR.Y
 22.0    0.04                    R.LYQNLCRLR.Y
Top scoring peptide matches to query 15
Score greater than 27 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.4    0.08        R.GIWETMLTGLE.-
 13.7    1.07        K.NEINDFIDKR.I
 13.7    1.03        R.FWDGEVLATVK.C
 13.2    0.02        K.AFIDTSVIASNK.E
 12.6   -0.02        R.FLEKLSSLSNK.L
 12.5   -0.93        K.DKLDFDLADSK.F
 12.4   -0.91        -.MQTQVKPSSSR.Q
 12.2    0.03        R.FLELNVMSANK.V
 12.1    0.96        K.MLTPFLKASLK.A
 11.5    0.09        K.MLSALESQVDR.V
Top scoring peptide matches to query 16
Score greater than 33 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.8    0.12        K.APPPANTFGGVSR.D
 20.0    0.18        K.APEKAPEEXQR.E
 20.0    0.18        K.APEKAPEEXQR.E
 17.5    0.11        R.APEAIKLDNGGGK.V
 17.3    0.11        K.APQAEKVQEAAK.I
 14.5    0.30        K.APMGAGGMMPGMM.-
 14.3    0.11        K.APPTTSNVDLVR.F
 13.9    0.14        R.APGAGQGNANATIK.N
 13.7    0.13        R.APPRASAPSSSSR.S
 13.3    0.11        K.AAATAPVTGESPAK.A
Top scoring peptide matches to query 17
Score greater than 28 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.8    1.08        K.IKDHLTGNTALL.-
 14.3    0.03        R.MLLAPIIQNRK.G
 14.0   -0.89        K.NWGPALATSRPK.G
 13.5    0.10        K.NWGPALATSRPK.G
 10.4   -0.88        K.LPMADNLAPAIR.Y
  8.2   -0.01        K.IIIDALEIKAAK.W
  8.1    1.03        K.ISPKVLNQLER.R
  8.1    1.03        K.LPNSLINKIER.S
  8.0   -0.86        K.AGGAGRAAGAAQSRP.-
  8.0   -0.73        M.NNKQNXDWYR.K
Top scoring peptide matches to query 18
Score greater than 46 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 34.1    0.16   19  Q5CV94_CRYPV K.NNDITEELNNK.S
 34.1    0.15   11  Q7RQL1_PLAYO K.NNDINKTDENK.R
 33.7   -0.80   16  Q8ILH9_PLAF7 K.NNDNETINDEK.N
 33.5    0.00    8  Q7SIS7_9RETR R.NPRHLETIGLR.M
 33.4    0.12    9  Q4DWX6_TRYCR K.ASADITDLENQK.S
 33.3    0.16   19  Q5CV94_CRYPV K.NNDITEELNNK.S
 33.0    0.15   11  Q7RQL1_PLAYO K.NNDINKTDENK.R
 32.4   -0.76   12  Q7RMJ4_PLAYO K.NNNNNNNIENK.D
 32.1   -0.74   14  Q55E01_DICDI M.DNNNNNNNNEK.Y
 32.1   -0.75   13  Q4L860_STAHJ K.NNNNNNNNSER.S
Top scoring peptide matches to query 19
Score greater than 24 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.9    0.08        R.SLGMLAFDNQAR.V
 15.9    0.08        R.SLGMLAFDNQAR.V
 10.5    1.04        K.DFHTAEIYAKK.L
  9.8    0.08        R.SEVWAGGLYADR.S
  9.3    0.01        R.SIDGRITGVYSR.S
  8.6    0.15        K.AQAACESARNASS.-
  8.5   -0.02        R.SSSPVDLPLRPR.K
  8.2    0.04        -.SGMXGTALSMLIR.A
  7.2   -0.01        K.SSTAVIYIGQKR.Y
  5.8   -0.01        K.SLASTLVKSFNR.S
Top scoring peptide matches to query 20
Score greater than 29 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.9    1.10        K.MYVTGTLASMDK.E
 15.7    0.97        K.NLGLLTLLTMNK.I
 15.2    1.07        K.FDKATYLTMNK.K
 14.4    1.10        R.KYNLGFDTMDK.L
 14.3    1.13        K.ERNYQFTMNK.S
 14.3    1.13        K.ERNYQFTMNK.S
 12.0    1.11        K.KHDMTNVNMNK.N
 11.8    1.08        -.MSAMFNKFLNK.T
 11.3    1.17        K.MNSSVLDYCNK.K
 11.1    1.07        K.SLGGIDVSPNMDK.L
Top scoring peptide matches to query 21
Score greater than 43 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 70.1    0.12    3  1BFP2 TIFFKDDGNYK
 27.0    0.17             K.TIFDCALCGYK.N
 17.0   -0.00             K.TLFFVHNKITK.I
 16.3    0.05             R.TIMYSLISLYK.L
 16.2    0.01             R.TIFNLLIGGDRK.L
 14.7    0.12             K.TLFVYSEQGFR.D
 14.6    0.06             K.TIFQKEPLENK.T
 13.9    0.14             -.TLCNFWKSYK.T
 13.5    0.13             R.TFLFDIGNQYK.V
 12.8    0.04             R.TLFQRLAQDVR.E
Top scoring peptide matches to query 22
Score greater than 46 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 62.2    0.12    4  Q5A5U4_CANAL K.KTDDSAPITIVAK.F
 30.1    0.15   15  Q7F929_ORYSA R.KTLSTSATGDLHK.A
 27.5    0.07                    R.KTLSSTAVVPVTR.A
 27.3    0.17                    R.QTSLDVSRPQAR.V
 26.4    0.10                    M.QSTLRQAVSAVAK.T
 23.4    0.16                    R.QQVVVQETEVAK.L
 23.1    0.16                    K.QNTELGDLGLVAK.G
 22.4   -0.89                    M.QSTLRQAVSAVAK.T
 19.7   -0.84                    R.FAVIQNPELQAK.L
 19.7   -0.84                    R.FAVIQNPELQAK.L
Top scoring peptide matches to query 23
Score greater than 28 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.9    1.13        K.AELSNENVEALNK.G
 18.9    1.13        K.AELSNENVEALNK.G
 18.8    1.19        R.CRGQAVNHMWR.N
 18.6    0.15        K.AELSNENVEALNK.G
 18.6    0.15        K.AELSNENVEALNK.G
 14.8    0.17        R.GNTQNNLNAEQVK.G
 14.7   -0.92        R.EMVSLVEERGIR.F
 14.6   -0.92        K.MQVTVVDLARER.G
 14.3    0.26        R.CVDEADRCHNR.W
 13.9    0.05        R.MALGLGAEVTVLDK.S
Top scoring peptide matches to query 24
Score greater than 30 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.2    0.15        M.SQAELFTISDLAR.E
 16.8    1.14        K.NNLESLTIGAFAKA.-
 13.3    0.25        R.ADSNMGSVISDPDK.T
 12.9    0.19        R.SQGLSTLMQVQQK.L
 12.6    0.11        K.TLEVSFTLSNVNK.I
 12.6   -0.87        K.TLEVSFTLSNVNK.I
 12.6   -0.87        K.TLEVSFTLSNVNK.I
 12.4   -0.83        K.SAQTSSIHQFFAK.F
 11.7   -0.87        R.SIFVQVTDSSQLK.G
 10.6    0.23        K.NTGLSEQDIVDMK.K
Top scoring peptide matches to query 25
Score greater than 25 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.6    1.11        R.VNDSAQRFIAWR.K
 11.5    1.09        K.CAEMVVSSIKNLL.-
 10.6    1.18        R.TRDEWCALAEGR.E
 10.4    1.11        SSGSLIPPSFNQTK
  9.9    1.17        R.CASTQTGAGAAAATPK.S
  9.7    1.15        R.NRCLYDGPALQR.A
  9.3   -0.89        QSSIQTHHIATDK
  9.1    0.03        K.APYTIDGIFALKR.E
  8.9   -0.96        K.RILNHNAVIAQSK.K
  8.9   -0.96        K.RILNHNAVIAQSK.K
Top scoring peptide matches to query 26
Score greater than 18 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.2    1.04        K.KTLVSNDINQIYK.C
  8.2    1.19        R.HGQVEDWNHMER.F
  5.2   -0.93        K.QLMEVARSLGYEK.L
  4.5   -0.95        R.VIAVLFYDNNDKK.S
  4.2   -0.93        K.MPPLGTPSPDSSLGGK.M
  4.1    0.99        K.IIPDRNYLHELR.E
  4.0    0.09        R.ARPHRDEDLSESK.G
  3.5    1.01        K.HQGMIHALRAIYK.D
  3.4    1.12        K.HQGRYQCNALYK.N
  3.4    1.07        K.GHQVQYMAKIYAK.A
Top scoring peptide matches to query 27
Score greater than 32 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.9    0.10        -.MEVGMVLKQSDGLK.T
 18.9    1.05        R.VFSILERMGGTVEK.I
 18.7    1.14        K.QIYEQLNENREK.V
 18.7    1.14        K.QIYEQLNENREK.V
 18.3    1.18        K.KNLCENNSDIVEK.M
 18.0    1.06        M.QFGAKPLFENVSVK.F
 17.4    0.12        M.FEDRLTISAEQQK.L
 16.8    1.12        R.CMAGISLKEQGVEK.E
 16.7    0.12        R.LYRNSLQQQLGNK.Y
 16.5    1.04        R.SFGRAFNAALVGVQK.C
Top scoring peptide matches to query 28
Score greater than 36 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 30.5    0.14   20  Q23807_CRAVI K.NTLALKLMAQGXYN.-
 27.6   -0.85   20  Q23807_CRAVI K.NTLALKLMAQGXYN.-
 22.5    0.16                    K.NHFIKLNSNLSER.F
 22.3    1.14                    K.NHFIKLNSNLSER.F
 20.6    0.07                    K.SQIALKLGVTSNDVK.N
 20.2    0.07                    K.LANTKLLSNVSGVEK.V
 20.1    0.09                    K.ISQALQIAVMNKQK.D
 19.1   -0.85                    K.TEVPQSLSNTQNKK.R
 18.2   -0.91                    K.SQIALKLGVTSNDVK.N
 17.9   -0.92                    R.DYSENIPLKLLLR.R
Top scoring peptide matches to query 29
Score greater than 23 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.5   -0.02        LNPLFEKALDHYK
 10.5   -1.00        LNPLFEKALDHYK
  9.7    0.99        K.LIPVSGQLEKNMEK.V
  8.6    0.98        K.GAAFTVVLPLGGEAQR.Q
  7.8   -0.83        R.LPNGVQNDEEDAQR.A
  6.7    0.06        K.MHSTLSQAIEQGRK.M
  6.6    1.00        K.QLKSLDLGNNALGDK.G
  6.5    1.06        K.YCEEIFGDLLLSK.A
  6.4    0.92        R.LIPSPQGFLPLLYK.D
  6.3   -0.93        K.NEQFQXTGTFVIR.R
Top scoring peptide matches to query 30
Score greater than 25 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.9   -0.96        R.VLAVCSEVTVLSYR.G
 12.9    0.09        R.LMYLAEVDLPESAK.T
 11.9   -1.03        R.VVSERVTSVTLHLR.T
 11.8   -1.06        K.VLIVLTEPSDVVRR.S
 11.7   -0.94        R.DTYTGTVVEVVAVSR.D
 11.4    1.07        R.ENQYTVVSQIRVR.R
 11.4    1.07        R.ENQYTVVSQIRVR.R
 10.9   -0.91        R.RDLGTGEEVTLSYR.V
 10.9    1.02        R.CVYLQAVIKETLR.L
 10.7    0.12        K.AQEMAGRLTVSDSTK.V
Top scoring peptide matches to query 31
Score greater than 29 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 33.9    0.12    7  Q5AJC0_CANAL R.IQFSLWPGGDSSNAK.G
 26.7   -0.86    7  Q5AJC0_CANAL R.IQFSLWPGGDSSNAK.G
 14.8    0.13                    R.GENSSLIAVQLDSGSK.S
 13.4   -0.05                    R.GAIYAIVLAAVFASLK.K
 12.6    0.11                    R.MGLKSAQNALDSLQK.A
 11.7    1.10                    R.KSTPFAAQNALADAAK.K
 11.2    0.20                    R.GDESTVWREEDQR.Q
 10.2    0.15                    K.GCNIVTETVENAGLK.T
  9.2    0.07                    R.LQISAGNFVTXSNVR.D
  8.8   -0.90                    R.QIKFEEGWSNIQK.G
Top scoring peptide matches to query 32
Score greater than 34 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.0   -1.07        R.EQEILWAINDIIR.N
 20.9   -0.06        R.TKVADDIPVAPSNVGK.A
 17.7   -0.10        R.QDRLTTPGMVIRPK.A
 17.2   -0.11        K.AAFLKVISSYNIASK.E
 17.0    0.01        K.NSTPTEVTFYVQPK.D
 16.4   -0.08        K.NDVALLQIIPQVSAK.I
 16.3    0.01        R.QTDAVPEQPLDNKR.L
 16.3   -1.05        R.NKLTGNEGAIDPLLR.G
 16.0   -0.13        R.QITGVLLDAALDLLR.R
 15.4   -0.00        R.VETGKDLGNGMFSIK.V
Top scoring peptide matches to query 33
Score greater than 39 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
103.3   -0.85    1  Q5AFN8_CANAL K.CSGLNDLSCICTTK.N
103.0    0.13    1  Q5AFN8_CANAL K.CSGLNDLSCICTTK.N
 20.3   -0.01                    K.QSAVTSPGAVTPDLGTK.R
 19.6    1.03                    R.VFGAQAAISRNNYSK.V
 19.6    1.03                    R.VFGAQAAISRNNYSK.V
 18.0    0.01                    K.RFIDLSTVGSTMASK.I
 16.8   -0.92                    R.CMQLNLTSNGKYAK.G
 16.5    0.15                    R.SCSQLSTSMDNIQR.N
 15.9   -1.00                    R.ICAPPFPSLNRAGTK.G
 15.4   -0.88                    R.RVYNNNGSCFANGR.S
Top scoring peptide matches to query 34
Score greater than 33 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.8    1.04        R.DVEPKINDWNYLK.K
 19.9   -1.03        R.LNVPFVQYSGRDLK.A
 19.6   -0.92        R.FLMYINMIESNTK.T
 18.4   -0.09        K.NNILDLNTHLLLIK.S
 18.4   -1.07        K.NNILDLNTHLLLIK.S
 18.4   -1.07        K.NNILDLNTHLLLIK.S
 17.2    0.98        K.VADGLLMGWWKTLK.W
 17.1    1.07        K.FEQYRAALEYSQK.A
 17.1   -0.84        -.MLYFQNYNYSYK.Y
 16.9    1.04        R.QHSIDITDGTPAHLK.L
Top scoring peptide matches to query 35
Score greater than 25 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.5    0.02        K.VPEDQEMEKLIGIK.V
 12.0    0.01        K.IGHMSFRVSPSGVVR.G
 11.4    0.05        K.VPESRFEEAGIDAPK.N
  9.0   -1.01        K.QIFVLTHNVYFHK.E
  8.7    0.05        K.QNAVVPAGTVETSSQR.V
  8.5   -0.99        -.MAVLLLDPAAPDFTR.R
  8.4   -0.04        R.TNQLQLMVNRIIGK.Y
  8.4   -1.03        R.FLGLLNYISAYFPK.I
  8.3   -0.00        -.MSANRIQTPSLPVSK.L
  8.1    0.15        K.SGGGGGGGGGPDGQAVSQNK.Q
Top scoring peptide matches to query 36
Score greater than 35 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 51.6    1.14    1  Q5AFN8_CANAL K.EICPNGDADTAISAFK.S
 19.8    0.18                    R.LQCPQCVFGTNCPK.T
 14.1    0.17                    R.QNEGADYWDINTQR.L
 13.8   -0.97                    R.KLYGGSINQFTHAFK.S
 13.8   -0.97                    R.KLYGGSINQFTHAFK.S
 13.3    0.18                    R.LQCPQCVFGTNCPK.T
 13.2    1.07                    K.NASQYKLGVDNAWLK.R
 12.3    0.15                    K.EICPSISGESDELMK.T
 11.0   -0.94                    K.ENASPRSGVPITEEPK.E
 10.9   -0.80                    R.LQCPQCVFGTNCPK.T
Top scoring peptide matches to query 37
Score greater than 26 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 47.8    0.15    2  Q5AFA2_CANAL K.QYSYSDQSGSWESIK.A
 44.7   -0.83    2  Q5AFA2_CANAL K.QYSYSDQSGSWESIK.A
 22.7   -0.83    2  Q5AFA2_CANAL K.QYSYSDQSGSWESIK.A
 10.7   -0.85                    K.QPMNAADGAAMSLAGAEK.N
  9.5   -0.00                    K.QYSIHVSGNNIPPPLK.S
  9.5   -0.00                    K.QYSIHVSGNNIPPPLK.S
  9.2    1.18                    K.NNMYDDKNNIYVDK.N
  9.0    0.02                    K.YSKNPSDIDQIIVGSK.K
  8.3    1.08                    K.FVMYPIAVSGDHANNK.F
  8.3   -0.05                    R.TTNLKANLAVVDYLTK.Y
Top scoring peptide matches to query 38
Score greater than 43 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 72.0    0.15    2  Q5AFA2_CANAL K.SSDCSPVPALGSSFLEK.F
 26.5    0.14                    K.TPQLHEHGMVTSTPTK.T
 17.1    1.13                    K.TPQLHEHGMVTSTPTK.T
 15.5    0.17                    K.MQLAEQIAMVDTENR.Q
 15.2   -0.82                    K.CQCVLAADEVVFNQK.E
 13.0    1.19                    R.NDRNETSPPAYSEIGK.-
 11.8    0.14                    K.NDGTLQRLDQTTSTTK.F
 11.6    0.13                    -.MANVSPVHGGLSEPVNR.V
 11.4   -0.85                    K.EQFMATQVIVCTPEK.Y
 10.8    0.16                    R.KFGDWVLNINGDMDR.A
Top scoring peptide matches to query 39
Score greater than 22 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.1   -0.94        K.SQSDSPPLSNSLMTRSR.S
  9.2   -0.97        R.GEVSDQILGVESRTMNK.E
  8.4   -0.99        R.SVSASAQAVPSPIKMSMR.R
  7.1    0.87        K.ANIKPGLVSNGLPPNLKK.L
  7.1   -0.99        K.SAVSASQNAIETAQGTAKK.A
  5.8    0.95        R.DQMIDIFHTPFKLLK.K
  5.6    0.95        R.TLYSNAPAFIAPLRDGR.R
  5.5    0.20        R.WESTGDGSYSIEECDK.E
  5.3    1.02        R.TVNIGLRAEGGSGGGAAAMR.R
  5.3    0.97        K.TAFALNIAQNIGTKQDR.T
Top scoring peptide matches to query 40
Score greater than 22 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.7    0.15        R.AAGFQAELEVAAPTGEWR.A
  8.8   -0.01        K.AAYSVLANKVPLQSLSIK.L
  7.9    0.07        R.AACSGNVGLVGKLIATQSR.H
  7.5    0.12        R.AXEEIVIRSENLTDNVK.T
  6.8   -0.87        R.DPRLNEILYPYANPAR.A
  6.1    0.05        K.LARGEILPHHTFAVDAR.R
  5.6    0.10        K.AAQAMRPSATFNQVLNAL.-
  4.7    0.09        K.AAWDYGPLGVELKENIK.R
  4.7    0.09        R.AAWDYGPLGVELKENLK.R
  4.1    0.16        R.AAKDNDPAVICSLSGLDR.K
Top scoring peptide matches to query 41
Score greater than 23 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.3    0.10        K.EIIVGYLPMPANNSTWK.D
 11.2    0.09        K.VHSQGKPIAPDADLDGLAK.R
 10.2    0.18        R.GWCEVVDAVPAGVTWMR.G
  9.7    0.29        K.VCMDQNAPDYYIEDAK.D
  5.7    0.14        -.MSRVDNLTVAPGSPDVMK.A
  4.7    0.10        K.GAALNSVQIAEELINNYL.-
  4.6    0.08        R.VGYSASSPQIADVLNRVR.Q
  4.2    0.09        R.LLEPGDIIHVPRNDSQK.V
  4.2    0.09        R.LLQPGDIIHVPRNDSQK.V
  4.2   -0.93        R.VVTNEVIRGNTVLTGLMT.-
Top scoring peptide matches to query 42
Score greater than 19 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.3   -0.88        R.ARVIGQDQVCEDIAQQMR.R
  7.3   -0.88        R.ARVIGQDQVCEDIAQQMR.R
  7.3   -0.88        R.ARVIGQDQVCEDIAQQMR.R
  7.3   -0.88        R.ARVIGQDQVCEDIAQQMR.R
  6.4    1.06        R.LPLPAGVVHGQDADEAECVR.R
  5.9    0.13        R.AAETLYQEASFAVSDGDFGR.A
  5.1   -0.81        R.SSMILPMSMISQMTDNGSR.L
  4.3   -0.02        R.MRFTIESIGQLHASQIFR.Y
  3.8    1.11        K.TNCCTKVNVLGVHIDGGMR.E
  3.7   -0.82        K.DGQEGYGFTSNLEVDFNNK.K
Top scoring peptide matches to query 43
Score greater than 20 indicates homology
Score greater than 53 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.4   -0.64        R.SNPNLNFGNAFQMSPNDIAR.V
  7.4   -0.64        R.SNPNLNFGNAFQMSPNDIAR.V
  6.7    0.26        R.ARNMLEAILWHGGEAQAAQR.R
  6.3    0.28        M.ADDKSPSPNQGLVVETQSPPR.E
  6.3    0.28        M.ADDKSPSPNQGLVVETQSPPR.E
  6.3    1.11        R.LVGKPQLAELNARIVQWASK.V
  5.7   -0.87        R.IALASGNEVRVIDVSGGIEIGR.F
  5.7   -0.93        R.YPADKVVVLLLLEANIDALR.S
  5.2   -0.67        R.IRFGPDGMLYVGTGDGGQPDR.A
  5.1    0.29        K.FFPNSNLILTKTCYNDFK.L
Top scoring peptide matches to query 44
Score greater than 27 indicates homology
Score greater than 53 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.9    0.38        K.QAGDEVERLNQQLEDEEEAK.A
 13.5    0.38        R.EAQGQFWLNNVDGGVYYNQK.Y
 10.3   -0.66        R.AENGVFEDVDGDDDAVILDGLR.K
  9.8   -0.84        K.QQIKEATEIASGIVNYQLSLK.D
  9.0    0.40        K.QTIILDGDDDGGGGGDENEDGRK.Q
  8.7   -0.88        K.AELSNILHTSLIEVLQISPEK.R
  8.3    0.22        R.ISEIEQFNISEIKPLNGASDK.E
  7.6    0.27        K.VTNANANINPMALALQGGGSAFAK.S
  7.6    0.27        K.VTNANANINPMALALQGGGSAFAK.S
  7.4    0.09        R.ISGNSVATTSILGIGIDILHVPR.L
Top scoring peptide matches to query 45
Score greater than 15 indicates homology
Score greater than 53 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8   -0.69        K.THSTKPCVIQMATTGDADSDAGSAVSGFDK.A
  2.7    0.20        K.GNNVTVIISGKCNNIFNENNVNYVQLK.V