Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0301_q1.pkl
Database        : MSDB 20052909 (2344227 sequences; 779380795 residues)
Timestamp       : 10 Nov 2006 at 15:03:27 GMT
Significant hits: 1C4FA         green fluorescent protein mutant 65 67 REPLACED BY CRO, S65T SUBSTITUTION, Q80R substitution - jell
                  Q5AFA2_CANAL  Potential cell wall glycosidase.- Candida albicans SC5314.
                  Q5AFN8_CANAL  Hypothetical protein CCW14.- Candida albicans SC5314.
                  AAP69597      AY233272 NID:  - synthetic construct
                  TRBOTR        trypsin (EC 3.4.21.4) precursor - bovine
                  Q5A5U4_CANAL  Hypothetical LDG family protein 7.- Candida albicans SC5314.
                  Q55E01_DICDI  Hypothetical protein.- Dictyostelium discoideum (Slime mold).

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 55 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    1C4FA                             Mass: 25412    Score: 310    Queries matched: 4
 green fluorescent protein mutant 65 67 REPLACED BY CRO, S65T SUBSTITUTION, Q80R substitution - jell
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   525.80   1049.59   1049.51   0.08 0  42  1.2 1  K.FEGDTLVNR.I
23   674.38   1346.75   1346.65   0.10 1  48  0.33 1  R.TIFFKDDGNYK.T
34   752.40   1502.78   1502.65   0.13 0  92  1.3e-005 1  K.FSVSGEGEGDATYGK.L
61   813.48   2437.43   2437.24   0.19 0  134  4.1e-010 1  K.GEELFTGVVPILVELDGDVNGHK.F + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      1EMGA                             Mass: 25499    Score: 310    Queries matched: 4
 green fluorescent protein mutant 65 67 REPLACED BY CRO, S65T SUBSTITUTION, Q80R substitution - jell
      1GFLA                             Mass: 25978    Score: 310    Queries matched: 4
 green fluorescent protein mutant Q80R, chain A - Aequorea victoria
      1YFPA                             Mass: 25472    Score: 310    Queries matched: 4
 yellow fluorescent protein mutant S65G, V68L, S72A, Q80R, H148G, T203Y, chain A - jellyfish (fragme
      2YFPA                             Mass: 25479    Score: 310    Queries matched: 4
 green fluorescent protein mutant YES - jellyfish (fragments)
      Q8GHE2_AZOVI                      Mass: 27011    Score: 310    Queries matched: 4
 Green fluorescence protein.- Azotobacter vinelandii.
      Q8GHE3_AZOVI                      Mass: 26984    Score: 310    Queries matched: 4
 Green fluorescence protein.- Azotobacter vinelandii.
      Q71RY9_AZOVI                      Mass: 26983    Score: 310    Queries matched: 4
 Green fluorescence protein.- Azotobacter vinelandii.
      CAE00346                          Mass: 32261    Score: 310    Queries matched: 4
 Sequence 1 from Patent EP1314980.- synthetic construct.
      CAE00349                          Mass: 32222    Score: 310    Queries matched: 4
 Sequence 7 from Patent EP1314980.- synthetic construct.
      CAE00350                          Mass: 32674    Score: 310    Queries matched: 4
 Sequence 9 from Patent EP1314980.- synthetic construct.
      CAE00351                          Mass: 33483    Score: 310    Queries matched: 4
 Sequence 11 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00352                          Mass: 31938    Score: 310    Queries matched: 4
 Sequence 13 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00353                          Mass: 32911    Score: 310    Queries matched: 4
 Sequence 15 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00354                          Mass: 33614    Score: 310    Queries matched: 4
 Sequence 17 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00355                          Mass: 32961    Score: 310    Queries matched: 4
 Sequence 19 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00357                          Mass: 36435    Score: 310    Queries matched: 4
 Sequence 23 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00358                          Mass: 35857    Score: 310    Queries matched: 4
 Sequence 25 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00359                          Mass: 39447    Score: 310    Queries matched: 4
 Sequence 27 from Patent EP1314980.- synthetic construct.
      CAE00360                          Mass: 39675    Score: 310    Queries matched: 4
 Sequence 29 from Patent EP1314980.- synthetic construct.
      CAE00365                          Mass: 26997    Score: 310    Queries matched: 4
 Sequence 47 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00366                          Mass: 27003    Score: 310    Queries matched: 4
 Sequence 49 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00367                          Mass: 27095    Score: 310    Queries matched: 4
 Sequence 51 from Patent EP1314980.- synthetic construct.
      CAE00371                          Mass: 98603    Score: 310    Queries matched: 4
 Sequence 173 from Patent EP1314980.- synthetic construct.
      CAE00372                          Mass: 86044    Score: 310    Queries matched: 4
 Sequence 175 from Patent EP1314980.- synthetic construct.
      CAE00374                          Mass: 63244    Score: 310    Queries matched: 4
 Sequence 179 from Patent EP1314980.- synthetic construct.
      AAB02576                          Mass: 29467    Score: 310    Queries matched: 4
 ENHANCED GREEN FLUORESCENT PROTEIN.- Cloning vector pEGFP-C1.
      AAT02644                          Mass: 27084    Score: 310    Queries matched: 4
 AY589050 NID: - Cloning vector pHyVec3
      CAA03418                          Mass: 29820    Score: 310    Queries matched: 4
 SEQUENCE 10 FROM PATENT WO9627675.- unidentified.
      AAF04100                          Mass: 26959    Score: 310    Queries matched: 4
 Green fluorescent protein.- synthetic construct.
      AAU04872                          Mass: 26879    Score: 310    Queries matched: 4
 AY672109 NID: - Bursa aurealis delivery vector pBursa
      CAH05668                          Mass: 35566    Score: 310    Queries matched: 4
 CQ834934 NID: - synthetic construct
      AAX07425                          Mass: 28391    Score: 310    Queries matched: 4
 AY902485 NID: - Expression vector pLuxR-wt
      AAB08058                          Mass: 30061    Score: 310    Queries matched: 4
 ENHANCED GREEN FLUORESCENT PROTEIN.- Cloning vector pEGFP-C2.
      AAK08507                          Mass: 26961    Score: 310    Queries matched: 4
 GFP.- Plant DNA excision vector pX6-GFP.
      CAC08897                          Mass: 105812   Score: 310    Queries matched: 4
 Sequence 1 from Patent WO0023091.- synthetic construct.
      CAC08899                          Mass: 113826   Score: 310    Queries matched: 4
 Sequence 5 from Patent WO0023091.- synthetic construct.
      CAC08902                          Mass: 89824    Score: 310    Queries matched: 4
 Sequence 11 from Patent WO0023091.- synthetic construct.
      CAC09301                          Mass: 26982    Score: 310    Queries matched: 4
 Sequence 11 from Patent WO9902694.- synthetic construct.
      CAE11751                          Mass: 53651    Score: 310    Queries matched: 4
 Sequence 1 from Patent WO03029827.- Aequorea victoria (Jellyfish).
      CAE11753                          Mass: 40640    Score: 310    Queries matched: 4
 Sequence 5 from Patent WO03029827.- Aequorea victoria (Jellyfish).
      BAB11884                          Mass: 27065    Score: 310    Queries matched: 4
 Enhanced cyan-green fluorescent protein.- synthetic construct.
      CAD12121                          Mass: 100534   Score: 310    Queries matched: 4
 Sequence 1 from Patent WO0179526.- synthetic construct.
      CAD12122                          Mass: 126496   Score: 310    Queries matched: 4
 Sequence 3 from Patent WO0179526.- synthetic construct.
      CAD12124                          Mass: 126472   Score: 310    Queries matched: 4
 Sequence 7 from Patent WO0179526.- synthetic construct.
      CAD12125                          Mass: 116223   Score: 310    Queries matched: 4
 Sequence 23 from Patent WO0179526.- synthetic construct.
      CAD12126                          Mass: 105810   Score: 310    Queries matched: 4
 Sequence 25 from Patent WO0179526.- synthetic construct.
      CAD12127                          Mass: 100448   Score: 310    Queries matched: 4
 Sequence 29 from Patent WO0179526.- synthetic construct.
      CAD12128                          Mass: 126409   Score: 310    Queries matched: 4
 Sequence 31 from Patent WO0179526.- synthetic construct.
      AAP13536                          Mass: 80190    Score: 310    Queries matched: 4
 Avermectin-sensitive chloride channel GluCl alpha/yellow fluorescent protein fusion.- synthetic con
      AAP13537                          Mass: 77356    Score: 310    Queries matched: 4
 Avermectin-sensitive chloride channel GluCl beta/cyan fluorescent protein fusion.- synthetic constr
      AAR13802                          Mass: 78682    Score: 310    Queries matched: 4
 AY438650 NID: - Cloning vector pMACSiBac
      AAX13969                          Mass: 55882    Score: 310    Queries matched: 4
 AY916793 NID: - Dual fluorescent protein cloning vector pGRFP
      AAX14065                          Mass: 27006    Score: 310    Queries matched: 4
 AY894753 NID: - Reporter vector pUS23
      AAO16875                          Mass: 60315    Score: 310    Queries matched: 4
 PAP2A-GFP fusion protein.- Mus musculus (Mouse).
      AAO16876                          Mass: 62319    Score: 310    Queries matched: 4
 Wunen-nonfunctional GFP fusion protein.- Drosophila melanogaster (Fruit fly).
      AAG16959                          Mass: 27082    Score: 310    Queries matched: 4
 GFPS.- synthetic construct.
      AAY17031                          Mass: 66145    Score: 310    Queries matched: 4
 DQ000653 NID: - synthetic construct
      AAL17988                          Mass: 26997    Score: 310    Queries matched: 4
 Green fluorescent protein.- Expression vector pNUS-GFPcH.
      CAD20729                          Mass: 27025    Score: 310    Queries matched: 4
 Sequence 1 from Patent WO0198338.- Aequorea victoria (Jellyfish).
      CAD20730                          Mass: 26952    Score: 310    Queries matched: 4
 Sequence 3 from Patent WO0198338.- Aequorea victoria (Jellyfish).
      CAC22448                          Mass: 27068    Score: 310    Queries matched: 4
 Sequence 39 from Patent WO0075324.- Cloning vector pINT1.
      CAD23750                          Mass: 27039    Score: 310    Queries matched: 4
 Sequence 1 from Patent EP1178109.- Aequorea victoria (Jellyfish).
      CAH25979                          Mass: 32640    Score: 310    Queries matched: 4
 CQ860012 NID: - synthetic construct
      CAH25982                          Mass: 41981    Score: 310    Queries matched: 4
 CQ860095 NID: - synthetic construct
      CAH25988                          Mass: 42664    Score: 310    Queries matched: 4
 CQ860107 NID: - synthetic construct
      AAG26343                          Mass: 39943    Score: 310    Queries matched: 4
 Cox8atp6gfp fusion protein.- Cloning vector pINT1.
      AAG26344                          Mass: 35725    Score: 310    Queries matched: 4
 Cox8ND6gfp fusion protein.- Cloning vector pINT1.
      AAV27315                          Mass: 27892    Score: 310    Queries matched: 4
 AY741665 NID: - Cloning vector p713-909
      AAW28902                          Mass: 41422    Score: 310    Queries matched: 4
 AY841887 NID: - Trafficking reporter vector pIN-G
      AAG29454                          Mass: 26991    Score: 310    Queries matched: 4
 GFP.- Promoter probe vector pPROBE-NT.
      AAG29470                          Mass: 28334    Score: 310    Queries matched: 4
 GFP[AAV].- Promoter probe vector pPROBE-gfp[AAV].
      AAG29478                          Mass: 28350    Score: 310    Queries matched: 4
 GFP[ASV].- Promoter probe vector pPROBE-gfp[ASV].
      AAG29486                          Mass: 28376    Score: 310    Queries matched: 4
 GFP[LVA].- Promoter probe vector pPROBE-gfp[LVA].
      AAG34036                          Mass: 27041    Score: 310    Queries matched: 4
 Yellow fluorescent protein yfp.- yfp marker plasmid pWM1008.
      AAG34040                          Mass: 26927    Score: 310    Queries matched: 4
 Cyan fluorescent protein cfp.- cfp marker plasmid pWM1009.
      AAG34521                          Mass: 29800    Score: 310    Queries matched: 4
 Enhanced green fluorescent protein 3.- N-terminal GFP fusion vector pUG34.
      AAT34984                          Mass: 51144    Score: 310    Queries matched: 4
 AY598429 NID: - Expression vector pMF280
      AAT34986                          Mass: 77618    Score: 310    Queries matched: 4
 AY598430 NID: - Expression vector pMF309
      CAD37450                          Mass: 26939    Score: 310    Queries matched: 4
 Sequence 1 from Patent EP1209167.- Aequorea victoria (Jellyfish).
      CAD37453                          Mass: 46753    Score: 310    Queries matched: 4
 Sequence 4 from Patent EP1209167.- synthetic construct.
      CAC37686                          Mass: 27794    Score: 310    Queries matched: 4
 Green fluorescent protein.- Integration vector pSMRG2+.
      CAC38925                          Mass: 37940    Score: 310    Queries matched: 4
 Sequence 5 from Patent WO0132900 (Fragment).- synthetic construct.
      CAC39546                          Mass: 28624    Score: 310    Queries matched: 4
 Sequence 7 from Patent WO0132852 (Fragment).- synthetic construct.
      CAC39554                          Mass: 28566    Score: 310    Queries matched: 4
 Sequence 11 from Patent WO0132684 (Fragment).- synthetic construct.
      AAC40225                          Mass: 27018    Score: 310    Queries matched: 4
 RATIOMETRIC PHLUORIN.- synthetic construct.
      AAC40226                          Mass: 27058    Score: 310    Queries matched: 4
 ECLIPTIC PHLUORIN.- synthetic construct.
      AAS45194                          Mass: 28406    Score: 310    Queries matched: 4
 AY523997 NID: - Expression vector pTH6nGFPc
      AAS45196                          Mass: 28446    Score: 310    Queries matched: 4
 AY523998 NID: - Expression vector pTH6cGFPn
      AAB47853                          Mass: 29890    Score: 310    Queries matched: 4
 Modified green fluorescent protein GFP-ER.- synthetic construct.
      AAB47998                          Mass: 26941    Score: 310    Queries matched: 4
 MODIFIED GREEN FLUORESCENT PROTEIN GFP5.- synthetic construct.
      AAO48591                          Mass: 27445    Score: 310    Queries matched: 4
 Yellow fluorescent protein.- Expression vector pBS-35S-YFP.
      AAO48597                          Mass: 28595    Score: 310    Queries matched: 4
 Yellow fluorescent protein.- Expression vector pBS-35S-Ala-YFP.
      AAO48599                          Mass: 28268    Score: 310    Queries matched: 4
 Yellow fluorescent protein.- Expression vector pBS-35S-YFP-Ala.
      AAG49142                          Mass: 52483    Score: 310    Queries matched: 4
 SooQI-507GFP fusion protein.- Cloning vector pINT1.
      AAG49427                          Mass: 31992    Score: 310    Queries matched: 4
 Nuclear eGFP.- Stinger GFP transformation vector.
      AAB51347                          Mass: 28122    Score: 310    Queries matched: 4
 Green fluorescent protein.- synthetic construct.
      AAB51348                          Mass: 28076    Score: 310    Queries matched: 4
 Green fluorescent protein.- synthetic construct.
      CAD53293                          Mass: 29400    Score: 310    Queries matched: 4
 Cyan fluorescent protein.- Cloning vector pDXA-CFP-MCS.
      CAD53296                          Mass: 29485    Score: 310    Queries matched: 4
 Yellow fluorescent protein.- Cloning vector pDXA-YFP-MCS.
      CAD53299                          Mass: 29769    Score: 310    Queries matched: 4
 Yellow fluorescent protein.- Cloning vector pDXA-YFP-NotI.
      CAD53302                          Mass: 29298    Score: 310    Queries matched: 4
 Yellow fluorescent protein.- Cloning vector pDXA-MCS-YFP.
      CAD53309                          Mass: 28366    Score: 310    Queries matched: 4
 Cyan fluorescent protein.- Cloning vector pDXA-CFP.
      CAD53312                          Mass: 28452    Score: 310    Queries matched: 4
 Yellow fluorescent protein.- Cloning vector pDXA-yFP.
      AAC53659                          Mass: 27073    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN, S65T VARIANT.- Cloning vector phGFP-S65T.
      AAC53684                          Mass: 26759    Score: 310    Queries matched: 4
 GFP PROTEIN (FRAGMENT).- Cloning vector pFW_GFP.
      AAK54502                          Mass: 46315    Score: 310    Queries matched: 4
 45 kDa SIGFI-GFP fusion protein.- synthetic construct.
      AAK54682                          Mass: 61083    Score: 310    Queries matched: 4
 Secretory IgCEPUS-GFP fusion protein.- synthetic construct.
      AAD55053                          Mass: 26955    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN.- Expression vector FRMwg.
      AAO61297                          Mass: 27944    Score: 310    Queries matched: 4
 EGFP.- BAC cloning vector pEBAC190G.
      CAB61435                          Mass: 30952    Score: 310    Queries matched: 4
 Green flourescent protein.- Schizosaccharomyces pombe (Fission yeast).
      AAF62891                          Mass: 29352    Score: 310    Queries matched: 4
 Enhanced GFP variant.- Cloning vector pEGAD.
      AAY63958                          Mass: 64830    Score: 310    Queries matched: 4
 DQ022572 NID: - Expression vector pEGFP-Pax9
      CAH64883                          Mass: 27035    Score: 310    Queries matched: 4
 AJ851278 NID: - Cloning vector pRU1097
      CAH64884                          Mass: 28138    Score: 310    Queries matched: 4
 AJ851279 NID: - Cloning vector pRU1098
      CAH64885                          Mass: 28124    Score: 310    Queries matched: 4
 AJ851280 NID: - Cloning vector pRU1099
      CAH64886                          Mass: 28166    Score: 310    Queries matched: 4
 AJ851281 NID: - Cloning vector pRU1100
      CAH64887                          Mass: 28140    Score: 310    Queries matched: 4
 AJ851282 NID: - Cloning vector pRU1101
      CAA65278                          Mass: 26981    Score: 310    Queries matched: 4
 UNGFPJELL NID: - unidentified
      AAF65344                          Mass: 28449    Score: 310    Queries matched: 4
 MGFP5*, hexaHis tagged.- Binary vector pCAMBIA-1302.
      AAF65347                          Mass: 97388    Score: 310    Queries matched: 4
 GUSA (N358Q)/MGFP5 fusion, hexaHis tagged.- Binary vector pCAMBIA-1303.
      AAF65352                          Mass: 97388    Score: 310    Queries matched: 4
 MGFP5-GUSA fusion protein.- Binary vector pCAMBIA-1304.
      AAF65454                          Mass: 30817    Score: 310    Queries matched: 4
 PBP interaction domain-EYFP fusion protein.- Mus musculus (Mouse).
      AAF65455                          Mass: 27089    Score: 310    Queries matched: 4
 SRC1 interaction domain-EYFP fusion protein.- Homo sapiens (Human).
      AAS66682                          Mass: 27038    Score: 310    Queries matched: 4
 AY533296 NID: - synthetic construct
      AAK67297                          Mass: 58771    Score: 310    Queries matched: 4
 IGFII-GFP fusion protein.- synthetic construct.
      BAB68313                          Mass: 27357    Score: 310    Queries matched: 4
 Codon-optimized GFPmut1.- Expression vector pTub-tel3 GFP3.
      CAB69249                          Mass: 30044    Score: 310    Queries matched: 4
 SEQUENCE 1 FROM PATENT WO9855873.- unidentified.
      CAB69293                          Mass: 97035    Score: 310    Queries matched: 4
 SEQUENCE 42 FROM PATENT WO9845704.- unidentified.
      CAB69294                          Mass: 72745    Score: 310    Queries matched: 4
 SEQUENCE 44 FROM PATENT WO9845704.- unidentified.
      CAB69295                          Mass: 69357    Score: 310    Queries matched: 4
 SEQUENCE 46 FROM PATENT WO9845704.- unidentified.
      CAB69296                          Mass: 111408   Score: 310    Queries matched: 4
 SEQUENCE 48 FROM PATENT WO9845704.- unidentified.
      CAB69297                          Mass: 81521    Score: 310    Queries matched: 4
 SEQUENCE 50 FROM PATENT WO9845704.- unidentified.
      CAB69298                          Mass: 89736    Score: 310    Queries matched: 4
 SEQUENCE 52 FROM PATENT WO9845704.- unidentified.
      CAB69302                          Mass: 96470    Score: 310    Queries matched: 4
 SEQUENCE 60 FROM PATENT WO9845704.- unidentified.
      CAB69303                          Mass: 72444    Score: 310    Queries matched: 4
 SEQUENCE 62 FROM PATENT WO9845704.- unidentified.
      CAB69304                          Mass: 69225    Score: 310    Queries matched: 4
 SEQUENCE 64 FROM PATENT WO9845704.- unidentified.
      CAB69305                          Mass: 111617   Score: 310    Queries matched: 4
 SEQUENCE 66 FROM PATENT WO9845704.- unidentified.
      CAB69309                          Mass: 81551    Score: 310    Queries matched: 4
 SEQUENCE 74 FROM PATENT WO9845704.- unidentified.
      CAB69310                          Mass: 88986    Score: 310    Queries matched: 4
 SEQUENCE 76 FROM PATENT WO9845704.- unidentified.
      CAB69312                          Mass: 99103    Score: 310    Queries matched: 4
 SEQUENCE 108 FROM PATENT WO9845704.- unidentified.
      CAB69313                          Mass: 98583    Score: 310    Queries matched: 4
 SEQUENCE 110 FROM PATENT WO9845704.- unidentified.
      CAB69314                          Mass: 61793    Score: 310    Queries matched: 4
 SEQUENCE 112 FROM PATENT WO9845704.- unidentified.
      CAB69315                          Mass: 61754    Score: 310    Queries matched: 4
 SEQUENCE 114 FROM PATENT WO9845704.- unidentified.
      CAB69316                          Mass: 95882    Score: 310    Queries matched: 4
 SEQUENCE 116 FROM PATENT WO9845704.- unidentified.
      CAB69317                          Mass: 96955    Score: 310    Queries matched: 4
 SEQUENCE 118 FROM PATENT WO9845704.- unidentified.
      CAB69320                          Mass: 68671    Score: 310    Queries matched: 4
 SEQUENCE 124 FROM PATENT WO9845704.- unidentified.
      CAB69321                          Mass: 50130    Score: 310    Queries matched: 4
 SEQUENCE 126 FROM PATENT WO9845704.- unidentified.
      CAB69322                          Mass: 43220    Score: 310    Queries matched: 4
 SEQUENCE 128 FROM PATENT WO9845704.- unidentified.
      CAB69328                          Mass: 88418    Score: 310    Queries matched: 4
 SEQUENCE 140 FROM PATENT WO9845704.- unidentified.
      CAB69329                          Mass: 88453    Score: 310    Queries matched: 4
 SEQUENCE 142 FROM PATENT WO9845704.- unidentified.
      AAA69542                          Mass: 27357    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-1.
      AAA69546                          Mass: 29987    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-C3.
      AAA69550                          Mass: 29410    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-C1.
      AAA69552                          Mass: 30004    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN.- Cloning vector pGFP-C2.
      AAQ74414                          Mass: 85222    Score: 310    Queries matched: 4
 AY299332 NID: - synthetic construct
      AAT76174                          Mass: 28340    Score: 310    Queries matched: 4
 AY653731 NID: - Cloning vector pICFP
      AAT76175                          Mass: 28426    Score: 310    Queries matched: 4
 AY653732 NID: - Cloning vector pIYFP
      AAS76482                          Mass: 28666    Score: 310    Queries matched: 4
 AY561434 NID: - Cloning vector pHyVec1
      AAA79304                          Mass: 29349    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN, RSGFP4 VARIANT.- Cloning vector pRSGFP-C1.
      AAA79306                          Mass: 29424    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN, S65T VARIANT.- Cloning vector pS65T-C1.
      CAD80175                          Mass: 16870    Score: 310    Queries matched: 4
 N'-EGFP (Fragment).- synthetic construct.
      AAY81662                          Mass: 99358    Score: 310    Queries matched: 4
 AY739899 NID: - Cloning vector pRGK337
      AAX83124                          Mass: 27010    Score: 310    Queries matched: 4
 AY952326 NID: - synthetic construct
      BAD84181                          Mass: 27213    Score: 310    Queries matched: 4
 AB195239 NID: - Paramecium synthetic construct
      CAC88661                          Mass: 48770    Score: 310    Queries matched: 4
 Sequence 47 from Patent WO0166565.- Synechocystis sp. (strain PCC 6803).
      CAD90235                          Mass: 61325    Score: 310    Queries matched: 4
 Sequence 13 from Patent WO03025172.- synthetic construct.
      BAD91039                          Mass: 53625    Score: 310    Queries matched: 4
 AB205477 NID: - synthetic construct
      BAD91040                          Mass: 51415    Score: 310    Queries matched: 4
 AB205478 NID: - synthetic construct
      BAD91041                          Mass: 53996    Score: 310    Queries matched: 4
 AB205481 NID: - synthetic construct
      BAD91042                          Mass: 51786    Score: 310    Queries matched: 4
 AB205482 NID: - synthetic construct
      AAB92477                          Mass: 27096    Score: 310    Queries matched: 4
 GREEN FLUORESCENT PROTEIN GFP+.- synthetic construct.
      Q93125_AEQVI                      Mass: 26937    Score: 310    Queries matched: 4
 Green fluorescent protein mutant 3.- Aequorea victoria (Jellyfish).
      AAQ93355                          Mass: 27990    Score: 310    Queries matched: 4
 AY391252 NID: - Yellow H-Pelican YFP transformation vector
      AAQ96626                          Mass: 27361    Score: 310    Queries matched: 4
 AY303166 NID: - CFP Integration vector pSMUC2+
      AAQ96629                          Mass: 27447    Score: 310    Queries matched: 4
 AY303167 NID: - YFP Integration vector pSMUY2+
      AAX97736                          Mass: 28638    Score: 310    Queries matched: 4
 AY995137 NID: - Cloning vector pBS 35S YFP-attR
      AAV97899                          Mass: 27092    Score: 310    Queries matched: 4
 AY818369 NID: - Cloning vector pSAT6-Citrine-N1
      CAC08898                          Mass: 120509   Score: 309    Queries matched: 4
 Sequence 3 from Patent WO0023091.- synthetic construct.
      AAQ55067                          Mass: 68221    Score: 309    Queries matched: 4
 AY292281 NID: - synthetic construct
      CAB69292                          Mass: 69525    Score: 309    Queries matched: 4
 SEQUENCE 40 FROM PATENT WO9845704.- unidentified.
      CAB69301                          Mass: 69380    Score: 309    Queries matched: 4
 SEQUENCE 58 FROM PATENT WO9845704.- unidentified.
      AAK85195                          Mass: 30077    Score: 309    Queries matched: 4
 MCS-GFP309-His tag fusion.- Expression vector pBGH.
      Q8GHE4_9GAMM                      Mass: 26999    Score: 309    Queries matched: 4
 Green fluorescence protein.- Azomonas agilis.
      CAB69323                          Mass: 128761   Score: 309    Queries matched: 4
 SEQUENCE 130 FROM PATENT WO9845704.- unidentified.
      CAB69324                          Mass: 129892   Score: 309    Queries matched: 4
 SEQUENCE 132 FROM PATENT WO9845704.- unidentified.
      CAE00347                          Mass: 88566    Score: 309    Queries matched: 4
 Sequence 3 from Patent EP1314980.- synthetic construct.
      CAE00348                          Mass: 88636    Score: 309    Queries matched: 4
 Sequence 5 from Patent EP1314980.- synthetic construct.
      CAE00370                          Mass: 106908   Score: 309    Queries matched: 4
 Sequence 171 from Patent EP1314980 (Fragment).- synthetic construct.
      CAE00373                          Mass: 89432    Score: 309    Queries matched: 4
 Sequence 177 from Patent EP1314980 (Fragment).- synthetic construct.
      AAG00925                          Mass: 31019    Score: 309    Queries matched: 4
 Green fluorescent protein.- Cloning vector pDXA-GFP2.
      AAB07866                          Mass: 119117   Score: 309    Queries matched: 4
 GREEN FLUORESCENT PROTEIN-GLUCOCORTICOID RECEPTOR CHIMERIC PROTEIN.- Cloning vector pCI-nGFP-C656G.
      CAD12123                          Mass: 125606   Score: 309    Queries matched: 4
 Sequence 5 from Patent WO0179526.- synthetic construct.
      AAK13447                          Mass: 29514    Score: 309    Queries matched: 4
 LacZ-GFP fusion protein.- Cloning vector pFH2191.
      AAD25336                          Mass: 26965    Score: 309    Queries matched: 4
 GREEN FLUORESCENT PROTEIN.- Cloning vector pLM10.
      CAH25985                          Mass: 133764   Score: 309    Queries matched: 4
 CQ860101 NID: - synthetic construct
      CAC39555                          Mass: 31621    Score: 309    Queries matched: 4
 Sequence 13 from Patent WO0132684 (Fragment).- synthetic construct.
      AAW55663                          Mass: 34860    Score: 309    Queries matched: 4
 AY860671 NID: - Expression vector pTGPI-GFP
      AAC78774                          Mass: 26993    Score: 309    Queries matched: 4
 GREEN FLUORESCENT PROTEIN (FRAGMENT).- Expression vector pYZ3N-GFP.
      AAT02528                          Mass: 58935    Score: 309    Queries matched: 4
 AY596277 NID: - Cloning vector pUC-gfp-neo
      AAT02530                          Mass: 61345    Score: 309    Queries matched: 4
 AY596277 NID: - Cloning vector pUC-gfp-neo
      CAC08900                          Mass: 129741   Score: 309    Queries matched: 4
 Sequence 7 from Patent WO0023091.- Aequorea victoria (Jellyfish).
      BAB32740                          Mass: 56517    Score: 309    Queries matched: 4
 Red-shift green fluorescent protein-fused neomycin phosphotransferase.- Human parvovirus B19.
      AAB66883                          Mass: 56378    Score: 309    Queries matched: 4
 Fluorescent neomycin phosphotransferase fusion protein.- Escherichia coli.
      CAH25978                          Mass: 70957    Score: 308    Queries matched: 4
 CQ860004 NID: - synthetic construct
      AAD47137                          Mass: 97135    Score: 308    Queries matched: 4
 Green fluorescent protein-estrogen receptor alpha fusion.- Mammalian expression vector pCI-nGL1-HEG
      CAH33959                          Mass: 67230    Score: 307    Queries matched: 4
 CQ868376 NID: - synthetic construct
      CAE00369                          Mass: 51333    Score: 307    Queries matched: 4
 Sequence 169 from Patent EP1314980.- synthetic construct.
      AAK67296                          Mass: 59462    Score: 307    Queries matched: 4
 SIGF1-GFP fusion protein.- synthetic construct.
      AAN76202                          Mass: 65195    Score: 307    Queries matched: 4
 Lysosomal cysteine proteinase cathepsin B/green fluorescent protein EGFP fusion protein (EC 3.4.22.
      CAI75176                          Mass: 76606    Score: 307    Queries matched: 4
 CS055383 NID: - synthetic construct
      CAB69299                          Mass: 118782   Score: 306    Queries matched: 4
 SEQUENCE 54 FROM PATENT WO9845704.- unidentified.
      CAB69311                          Mass: 119527   Score: 306    Queries matched: 4
 SEQUENCE 78 FROM PATENT WO9845704.- unidentified.
      CAB69318                          Mass: 114004   Score: 306    Queries matched: 4
 SEQUENCE 120 FROM PATENT WO9845704.- unidentified.
      CAB69319                          Mass: 114034   Score: 306    Queries matched: 4
 SEQUENCE 122 FROM PATENT WO9845704.- unidentified.
      CAB69325                          Mass: 106146   Score: 306    Queries matched: 4
 SEQUENCE 134 FROM PATENT WO9845704.- unidentified.
      CAB69326                          Mass: 106013   Score: 306    Queries matched: 4
 SEQUENCE 136 FROM PATENT WO9845704.- unidentified.
      CAD35702                          Mass: 71760    Score: 306    Queries matched: 4
 Sequence 38 from Patent EP1199564.- unidentified.
      CAB69291                          Mass: 71663    Score: 306    Queries matched: 4
 SEQUENCE 38 FROM PATENT WO9845704 (fragment).- unidentified.
      CAC08901                          Mass: 115901   Score: 305    Queries matched: 4
 Sequence 9 from Patent WO0023091.- synthetic construct.
      CAC08903                          Mass: 115645   Score: 305    Queries matched: 4
 Sequence 13 from Patent WO0023091.- synthetic construct.
      CAC08904                          Mass: 63083    Score: 305    Queries matched: 4
 Sequence 15 from Patent WO0023091.- synthetic construct.
      CAH25994                          Mass: 73949    Score: 305    Queries matched: 4
 CQ866776 NID: - synthetic construct
      CAB69307                          Mass: 83768    Score: 305    Queries matched: 4
 SEQUENCE 70 FROM PATENT WO9845704.- unidentified.
      CAB69327                          Mass: 83915    Score: 305    Queries matched: 4
 SEQUENCE 138 FROM PATENT WO9845704.- unidentified.
      BAD30083                          Mass: 73565    Score: 305    Queries matched: 4
 AB178711 NID: - synthetic construct
      BAD30084                          Mass: 73564    Score: 305    Queries matched: 4
 AB178712 NID: - synthetic construct
      BAD30085                          Mass: 73563    Score: 305    Queries matched: 4
 AB178713 NID: - synthetic construct
      BAD30086                          Mass: 77204    Score: 305    Queries matched: 4
 AB178714 NID: - synthetic construct
      AAR37359                          Mass: 63023    Score: 305    Queries matched: 4
 AY422822 NID: - synthetic construct
      AAL50640                          Mass: 66986    Score: 305    Queries matched: 4
 Src reporter.- synthetic construct.
      AAW56610                          Mass: 67785    Score: 305    Queries matched: 4
 AY862145 NID: - synthetic construct
      BAC99017                          Mass: 87572    Score: 305    Queries matched: 4
 AB074297 NID: - synthetic construct
      AAX22059                          Mass: 113647   Score: 304    Queries matched: 4
 AY928551 NID: - synthetic construct
      AAL33624                          Mass: 81923    Score: 304    Queries matched: 4
 Protein kinase A activity reporter 1 fusion protein.- synthetic construct.
      AAR37358                          Mass: 84029    Score: 304    Queries matched: 4
 AY422821 NID: - synthetic construct
      AAL50639                          Mass: 66255    Score: 304    Queries matched: 4
 EGF-receptor reporter.- synthetic construct.
      AAL50641                          Mass: 87454    Score: 304    Queries matched: 4
 Crk-based reporter.- synthetic construct.
      AAR37360                          Mass: 63303    Score: 303    Queries matched: 4
 AY422823 NID: - synthetic construct
      CAE00362                          Mass: 60592    Score: 303    Queries matched: 4
 Sequence 33 from Patent EP1314980 (Fragment).- synthetic construct.
      CAH04268                          Mass: 82047    Score: 303    Queries matched: 4
 AJ783754 NID: - synthetic construct
      BAC16312                          Mass: 85594    Score: 303    Queries matched: 4
 Raichu-1054X.- Homo sapiens (Human).
      BAD32702                          Mass: 129006   Score: 303    Queries matched: 4
 AB161231 NID: - synthetic construct
      BAB61869                          Mass: 83742    Score: 303    Queries matched: 4
 Rai-chu 101.- Homo sapiens (Human).
      BAB61870                          Mass: 86561    Score: 303    Queries matched: 4
 Rai-chu 101X.- Homo sapiens (Human).
      BAB61871                          Mass: 80313    Score: 303    Queries matched: 4
 Picchu-236.- Homo sapiens (Human).
      BAB61872                          Mass: 83132    Score: 303    Queries matched: 4
 Picchu-236-X.- Homo sapiens (Human).
      CAE00361                          Mass: 116238   Score: 301    Queries matched: 4
 Sequence 31 from Patent EP1314980.- synthetic construct.
      BAB61868                          Mass: 85646    Score: 301    Queries matched: 4
 Raichu404X.- Homo sapiens (Human).
      CAE00356                          Mass: 172980   Score: 301    Queries matched: 4
 Sequence 21 from Patent EP1314980.- synthetic construct.
      BAC16311                          Mass: 85860    Score: 301    Queries matched: 4
 Raichu-1011X.- Homo sapiens (Human).

2.    Q5AFA2_CANAL                      Mass: 46818    Score: 309    Queries matched: 5
 Potential cell wall glycosidase.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   427.74   853.47   853.40   0.08 0  44  0.57 1  R.FDNPSFK.S
4   505.80   1009.58   1009.50   0.08 1  38  2.6 1  K.RFDNPSFK.S
27   702.91   1403.80   1403.70   0.10 0  42  1.2 1  K.DAVTWSVDGSVIR.T
49   882.96   1763.90   1763.76   0.14 0  125  5.1e-009 1  K.QYSYSDQSGSWESIK.A
50   890.99   1779.97   1779.83   0.14 0  66  0.0047 1  K.SSDCSPVPALGSSFLEK.F

3.    Q5AFN8_CANAL                      Mass: 22993    Score: 173    Queries matched: 2
 Hypothetical protein CCW14.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   814.92   1627.82   1627.70   0.12 0  107  3.5e-007 1  K.CSGLNDLSCICTTK.N
47   855.95   1709.88   1708.76   1.12 0  68  0.003 1  K.EICPNGDADTAISAFK.S + Deamidation (NQ)

4.    AAP69597                          Mass: 26872    Score: 160    Queries matched: 3
 AY233272 NID: - synthetic construct
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   525.80   1049.59   1049.51   0.08 0  42  1.2 1  K.FEGDTLVNR.I
 23   674.38   1346.75   1347.60   -0.85 0  28  34 2  R.TIFFEDDGNYK.S
 34   752.40   1502.78   1502.65   0.13 0  92  1.3e-005 1  K.FSVSGEGEGDATYGK.L

5.    TRBOTR                            Mass: 24662    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4) precursor - bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   577.37   1152.73   1152.57   0.16 0  25  52 1  K.SSGTSYPDVLK.C
31   745.93   1489.84   1489.73   0.11 0  47  0.37 1  K.LQGIVSWGSGCAQK.N

 
      Proteins matching the same set of peptides:
      1AUJ                              Mass: 23975    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4) - bovine
      1MCUE                             Mass: 23888    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4), chain E - bovine
      1NTP                              Mass: 23978    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4) (isopropylphosphorylated) - bovine
      1TAWA                             Mass: 23961    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4), chain A - bovine
      1TGSZ                             Mass: 24218    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4) precursor (with pancreatic secretory trypsin inhibitor), chain Z - bovine
      2TGD                              Mass: 23861    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4) precursor (diisopropylphosphorylated) - bovine
      2TPIZ                             Mass: 23705    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4) precursor (with basic proteinase inhibitor, Ile-Val, 2.4 M magnesium sulfate)
      3BTDE                             Mass: 23861    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4), chain E - bovine (fragments)
      3BTEE                             Mass: 23774    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4), chain E - bovine (fragments)
      3BTGE                             Mass: 23888    Score: 70     Queries matched: 2
 trypsin (EC 3.4.21.4), chain E - bovine (fragments)
      5PTP                              Mass: 23999    Score: 70     Queries matched: 2
 beta trypsin (EC 3.4.21.4) - bovine
      BAA07516                          Mass: 26093    Score: 70     Queries matched: 2
 BOVPCP NID: - Bos taurus
      CAI93196                          Mass: 24940    Score: 70     Queries matched: 2
 CS070272 NID: - Homo sapiens
6.    Q5A5U4_CANAL                      Mass: 21461    Score: 58     Queries matched: 2
 Hypothetical LDG family protein 7.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   615.88   1229.75   1229.65   0.10 0  35  6.7 1  K.TDDSAPITIVAK.F
18   638.84   1275.67   1275.56   0.11 0  25  65 1  R.YSESEYAVSNK.K

7.    Q55E01_DICDI                      Mass: 116203   Score: 57     Queries matched: 1
 Hypothetical protein.- Dictyostelium discoideum (Slime mold).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
20   653.86   1305.71   1306.45   -0.75 0  59  0.025 1  M.DNNNNNNNNEK.Y + 4 Deamidation (NQ)

8.    Q5XQN5_BOVIN                      Mass: 63069    Score: 53     Queries matched: 1
 Keratin 5.- Bos taurus (Bovine).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   651.91   1301.81   1301.71   0.10 0  53  0.099 1  R.SLDLDSIIAEVK.A

 
      Proteins matching the same set of peptides:
      Q6IFZ4_RAT                        Mass: 57916    Score: 53     Queries matched: 1
 Type II keratin Kb15.- Rattus norvegicus (Rat).
      Q6IG05_RAT                        Mass: 62472    Score: 53     Queries matched: 1
 Type II keratin Kb18.- Rattus norvegicus (Rat).
      Q6P6Q2_RAT                        Mass: 61959    Score: 53     Queries matched: 1
 Keratin 5 (Epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber- Cockayne types).- Rattus norv
      Q7TN97_RAT                        Mass: 62060    Score: 53     Queries matched: 1
 Keratin 5.- Rattus norvegicus (Rat).
      Q8BGZ7_MOUSE                      Mass: 59932    Score: 53     Queries matched: 1
 Mus musculus 10 days neonate skin cDNA, RIKEN full-length enriched library, clone:4732475I03 produc
      Q9I9P5_RANCA                      Mass: 56584    Score: 53     Queries matched: 1
 Inner-ear cytokeratin.- Rana catesbeiana (Bull frog).
      Q99MH7_MOUSE                      Mass: 42471    Score: 53     Queries matched: 1
 Cytokeratin KRT2-6HF (Fragment).- Mus musculus (Mouse).
      Q920F2_MOUSE                      Mass: 61971    Score: 53     Queries matched: 1
 Type II keratin 5.- Mus musculus (Mouse).
      Q922U2_MOUSE                      Mass: 61957    Score: 53     Queries matched: 1
 Keratin complex 2, basic, gene 5.- Mus musculus (Mouse).
      Q63280_RAT                        Mass: 9390     Score: 53     Queries matched: 1
 Keratin K5 (Fragment).- Rattus norvegicus (Rat).
      K2C6A_MOUSE                       Mass: 59510    Score: 51     Queries matched: 1
 Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) (Keratin 6 alpha) (mK6-alph
      K2C6B_MOUSE                       Mass: 60496    Score: 51     Queries matched: 1
 Keratin, type II cytoskeletal 6B (Cytokeratin 6B) (CK 6B) (K6b keratin) (Keratin 6 beta) (mK6-beta)
      Q4FZU2_RAT                        Mass: 59555    Score: 51     Queries matched: 1
 Hypothetical protein.- Rattus norvegicus (Rat).
      Q9CV72_MOUSE                      Mass: 30107    Score: 51     Queries matched: 1
 Mus musculus adult male tongue cDNA, RIKEN full-length enriched library, clone:2310008N03 product:k
      Q80VP7_MOUSE                      Mass: 35315    Score: 51     Queries matched: 1
 Hypothetical protein MGC54654.- Mus musculus (Mouse).
      BAA34179                          Mass: 60627    Score: 51     Queries matched: 1
 AB012042 NID: - Mus musculus
      AAH80820                          Mass: 59641    Score: 51     Queries matched: 1
 BC080820 NID: - Mus musculus
      K2C1_HUMAN                        Mass: 66018    Score: 49     Queries matched: 1
 Keratin, type II cytoskeletal 1 (Cytokeratin 1) (K1) (CK 1) (67 kDa cytokeratin) (Hair alpha protei
      Q6GSJ0_HUMAN                      Mass: 66198    Score: 49     Queries matched: 1
 Keratin 1.- Homo sapiens (Human).
      AAF60327                          Mass: 66149    Score: 49     Queries matched: 1
 AF237621 NID: - Homo sapiens
9.    Q5AJC0_CANAL                      Mass: 52187    Score: 52     Queries matched: 1
 Hypothetical protein UTR2.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
40   803.95   1605.89   1605.78   0.11 0  54  0.069 1  R.IQFSLWPGGDSSNAK.G

10.   Q6PVZ5_CHICK                      Score: 51     Queries matched: 1
 Type II alpha-keratin IIA.- Gallus gallus (Chicken).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   651.91   1301.81   1301.71   0.10 0  53  0.099 1  R.SLDLNSIIAEVK.A + Deamidation (NQ)

11.   Q8BIS2_MOUSE                      Score: 51     Queries matched: 1
 Mus musculus 10 days neonate skin cDNA, RIKEN full-length enriched library, clone:4732456N10 product:similar to KERATIN, TYPE II CYTOSKELETAL 6D (CYTOKERATIN 6D) (CK 6D) (K6D KERATIN).- Mus musculus (Mouse).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 19   651.91   1301.81   1301.71   0.10 0  53  0.099 1  R.SLNLDSIIAEVK.A + Deamidation (NQ)

12.   Q7RDW0_PLAYO                      Score: 49     Queries matched: 1
 Hypothetical protein (Fragment).- Plasmodium yoelii yoelii.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   653.86   1305.71   1304.56   1.14 0  49  0.23 2  K.INNIDINNNEK.F + 5 Deamidation (NQ)

13.   Q59Y31_CANAL                      Mass: 54872    Score: 48     Queries matched: 2
 Potential yeast form cell wall protein.- Candida albicans SC5314.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 15   424.25   1269.73   1269.64   0.09 0  (7) 3.9e+003 4  K.VITVVACDEHK.C
16   635.88   1269.75   1269.64   0.11 0  48  0.31 1  K.VITVVACDEHK.C

14.   Q9HFS1_CANAL                      Mass: 25603    Score: 46     Queries matched: 1
 Glycosyl-phosphatidylinositol protein.- Candida albicans (Yeast).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   618.84   1235.67   1235.59   0.08 0  48  0.32 1  K.IYDQLPECAK.E

 
      Proteins matching the same set of peptides:
      Q9HFZ1_CANAL                      Mass: 24614    Score: 46     Queries matched: 1
 Repressed by TUP1 protein 5.- Candida albicans (Yeast).
      Q59UP6_CANAL                      Mass: 25603    Score: 46     Queries matched: 1
 Potential cell surface antigen.- Candida albicans SC5314.
15.   Q7RQL1_PLAYO                      Score: 43     Queries matched: 1
 Myosin heavy chain.- Plasmodium yoelii yoelii.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   653.86   1305.71   1305.57   0.14 1  46  0.47 5  K.NNDINKTDENK.R + 2 Deamidation (NQ)

16.   Q551G6_DICDI                      Score: 43     Queries matched: 1
 Hypothetical protein.- Dictyostelium discoideum (Slime mold).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   653.86   1305.71   1304.51   1.19 0  47  0.43 3  R.INNNNNNNNEK.Q + 4 Deamidation (NQ)

17.   Q4DWX6_TRYCR                      Score: 42     Queries matched: 1
 Hypothetical protein.- Trypanosoma cruzi.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   653.86   1305.71   1305.59   0.11 0  44  0.77 8  K.ASADITDLENQK.S + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      Q4E4H0_TRYCR                      Score: 42     Queries matched: 1
18.   Q6PQQ5_ARATH                      Score: 42     Queries matched: 1
 AP2/EREBP transcription factor.- Arabidopsis thaliana (Mouse-ear cress).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   653.86   1305.71   1304.51   1.19 0  47  0.43 3  R.INNNNNNDNEK.T + 3 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      Q52QU2_ARATH                      Score: 42     Queries matched: 1
      T49988                            Score: 42     Queries matched: 1
19.   Q8ILH9_PLAF7                      Score: 40     Queries matched: 1
 Hypothetical protein.- Plasmodium falciparum (isolate 3D7).
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   653.86   1305.71   1306.52   -0.81 0  44  0.83 10  K.NNDNETINDEK.N + 2 Deamidation (NQ)

20.   Q5CV94_CRYPV                      Score: 39     Queries matched: 1
 DNAj protein (Fragment).- Cryptosporidium parvum.
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 20   653.86   1305.71   1305.56   0.15 0  44  0.74 6  K.NNDITEELNNK.S + 3 Deamidation (NQ)

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
60   1112.68   2223.36   2223.18   0.18 1  36  2.7 1  IVGGQVLYYREDGSVVDLLK + Deamidation (NQ)
1   410.79   819.56   819.49   0.07 0  36  5.1 1  VSFGGIIK
46   851.96   1701.91   1701.78   0.13 1  34  6.7 1  QTNHDSSISNKDNLK + 2 Deamidation (NQ)
10   608.35   1214.69   1215.52   -0.83 0  34  8 1  MEMAADQLYK + Deamidation (NQ); Oxidation (M)
41   806.40   1610.79   1610.71   0.08 0  33  8.4 1  NNNAVNLMINDFTK + 4 Deamidation (NQ)
62   1220.19   2438.37   2438.16   0.21 1  30  13 1  MDQMLSDKNVASISATLQNLEK + 3 Deamidation (NQ)
29   726.45   1450.88   1451.74   -0.86 0  28  31 1  METLSIGTLVTCK
11   609.84   1217.66   1217.64   0.03 1  25  60 1  SATEVLSARER
22   667.35   1332.69   1332.63   0.06 1  23  1.1e+002 1  MDNAVGPQVRTK + 2 Deamidation (NQ); Oxidation (M)
3   468.76   935.50   934.49   1.01 0  22  1.2e+002 1  NSFMVIPK
9   590.35   1178.69   1178.58   0.11 1  22  1.2e+002 1  IRMQDPGYAK + Deamidation (NQ)
7   540.81   1079.61   1079.53   0.08 0  21  1.5e+002 1  LSVIEFVNC
36   787.46   1572.91   1571.81   1.11 1  21  1.5e+002 1  NHFIKLNSNLSER + Deamidation (NQ)
14   633.34   1264.67   1265.63   -0.96 0  21  1.6e+002 1  FIDNPFISGEK
26   695.42   1388.83   1388.68   0.15 1  21  1.7e+002 1  NQPTTKLQTNNK + 3 Deamidation (NQ)
59   1062.12   2122.24   2121.96   0.27 0  19  1.8e+002 1  QLFGPGPSNMADSIAETQSR + Deamidation (NQ); Oxidation (M)
17   635.88   1269.75   1269.73   0.02 0  17  4e+002 1  APIVTAGASSVVAK
5   512.28   1022.54   1021.48   1.05 1  17  3.8e+002 1  KDIDDFNR
43   817.93   1633.86   1633.89   -0.04 1  16  5.1e+002 1  RIYHNLPPPASELK
15   424.25   1269.73   1270.63   -0.90 0  15  6.4e+002 1  TALQNIHSMQK + Deamidation (NQ)
25   682.36   1362.71   1363.67   -0.96 0  15  6.4e+002 1  GVSYSGAATPALDR
28   716.91   1431.81   1430.69   1.12 0  15  5.7e+002 1  AELSNENVEALNK + Deamidation (NQ)
38   797.94   1593.86   1593.80   0.06 0  15  6e+002 1  LMYLAEVDLPESAK + Oxidation (M)
39   532.29   1593.86   1592.87   1.00 1  14  6.5e+002 1  VVDVNIKSNSLYLK + 2 Deamidation (NQ)
56   974.54   1947.07   1948.00   -0.93 0  14  6.3e+002 1  GEALEQQVVQVAHEVGVR + Deamidation (NQ)
44   822.93   1643.85   1642.84   1.01 0  14  8.2e+002 1  AQNIIQELNITLDR + 3 Deamidation (NQ)
24   679.94   1357.86   1357.67   0.19 1  13  8.5e+002 1  RGEPAASAAQSASR
21   662.35   1322.69   1322.62   0.07 0  13  1e+003 1  SELNLPDDQHR
37   794.43   1586.84   1585.80   1.04 0  13  1.1e+003 1  HDAVVCSVVQAVFR
48   870.47   1738.92   1739.00   -0.08 0  12  1e+003 1  PQVHLWQRPLVPIR + Deamidation (NQ)
54   950.49   1898.97   1898.10   0.87 1  12  1e+003 1  VVDNQKIEIIVVLNFR
58   1027.06   2052.10   2052.04   0.06 1  12  1.1e+003 1  VAFITGGGTGLGRGMTTTPSR + Oxidation (M)
55   967.05   1932.09   1932.98   -0.90 1  12  1.1e+003 1  AQAAAPAIHAMNPRVQLR + 3 Deamidation (NQ); Oxidation (M)
63   1023.89   3068.65   3069.64   -0.99 1  10  1.1e+003 1  IIVNLPRQMISRPIYAEEEQVQALLK + 3 Deamidation (NQ); Oxidation (M)
57   976.55   1951.09   1950.01   1.09 1  10  1.8e+003 1  YELRDGLAEISTIESVR
30   732.93   1463.84   1462.76   1.08 0  9  2.6e+003 1  LVEGYNLQIANVK + 3 Deamidation (NQ)
53   931.97   1861.92   1863.09   -1.17 1  9  2.5e+003 1  LPIQRLQIQSTPSILR + Deamidation (NQ)
45   548.96   1643.86   1643.67   0.18 0  6  4.2e+003 1  NNVTNTMGQFNTQR + 4 Deamidation (NQ); Oxidation (M)
32   747.36   1492.71   1493.70   -1.00 1  6  4.4e+003 1  INRTQAEEMLSGK + 2 Deamidation (NQ); Oxidation (M)
52   930.46   1858.91   1860.05   -1.14 0  6  5.4e+003 1  QAAALALLDGDAPGPLIVR
35   761.42   1520.83   1521.77   -0.94 1  4  7.6e+003 1  KDYVMITIPNSPK + Deamidation (NQ); Oxidation (M)
33   1497.34   1496.33   1495.79   0.54 0  3  6.7e+003 1  LEDLDSLYFLLR
64   1423.06   5688.22   5687.46   0.75 0  1  2.4e+003 1  TDGAHPHSDSGNGPPPLPENPTLAQVMAHQTQMMAAMMQQMQQQHQQMHQR + 4 Deamidation (NQ)
51   893.54   1785.06        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 64

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 40 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 36.2    0.07        K.VSFGGIIK.T
 36.2    0.07        R.VSFNILK.S
 36.2    0.07        K.VSNFIIK.D
 36.2    0.11        K.VSNMLLK.N
 36.2    0.11        M.VSTCILK.I
 26.5    0.15        K.VSNFEPK.K
 26.1    0.16        R.VSNAVNSK.G
 23.6    0.11        K.VSNKMIK.T
 23.2    0.10        M.VSNFVVR.L
 22.8    0.15        R.VSNGSSLR.V
Top scoring peptide matches to query 2
Score greater than 44 indicates homology
Score greater than 54 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 44.0    0.08    2  Q5AFA2_CANAL R.FDNPSFK.S
 44.0    0.08                    K.FNNPSXK.D
 44.0    0.11                    K.FNNPSXK.D
 29.3    0.04                    K.YVNPSFK.E
 28.2    0.11                    -.MDNPFSK.F
 25.3    1.06                    K.FNNPSXK.D
 25.3    1.09                    K.FNNPSXK.D
 25.3    0.08                    K.FNNPSXK.D
 25.3    0.11                    K.FNNPSXK.D
 24.8    0.12                    -.MDNTTEK.K
Top scoring peptide matches to query 3
Score greater than 33 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.2    1.01        R.NSFMVIPK.S
 19.1   -0.96        K.RSIDDFGK.A
 18.8    0.03        R.NSFMVIPK.S
 13.3   -0.92        K.NAGLMTQGK.-
 10.8    1.02        K.NSFQSKPK.E
 10.6    0.12        -.MAENSCPK.R
 10.5   -0.95        K.DKITMEGK.L
 10.5    0.03        -.MAEFTLPK.N
 10.5    1.04        K.VANAETTTK.L
 10.0   -0.91        K.GQGIDDGFK.S
Top scoring peptide matches to query 4
Score greater than 48 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 38.3    0.08    2  Q5AFA2_CANAL K.RFDNPSFK.S
 34.5    0.09                    K.KQFEPSMK.F
 32.6    0.01                    R.KTFRPSFK.R
 32.6    0.06                    R.QYGAIPSFK.G
 30.6    0.04                    R.DFRNALFK.Y
 30.2    0.16                    R.SQTTNSNEK.Q
 29.8    0.07                    R.NTDSKVAFK.Q
 28.1    0.07                    K.KENSGISFK.M
 26.4    0.16                    R.TNSDNQTTK.E
 26.1    0.09                    K.RTSDGLSMK.G
Top scoring peptide matches to query 5
Score greater than 25 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.9    1.05        R.KDIDDFNR.R
 16.9    0.07        R.KDIDDFNR.R
 12.1    1.10        K.KDINDECK.N
 10.9    0.07        K.DLKNNFDR.V
 10.9    0.07        K.NIKDDFDR.V
 10.0    0.07        R.IDKNNFDR.R
 10.0    1.09        K.LNENDFNR.N
 10.0    0.11        K.LNENDFNR.N
  9.1    1.03        R.TEFLNQAAK.I
  8.7    0.09        K.RISDDMNR.N
Top scoring peptide matches to query 6
Score greater than 42 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.0    0.08    1+ 1C4FA K.FEGDTLVNR.I
 28.1    0.02             K.FQGNTLKLK.L
 23.4    1.12             K.EMPLDTAQK.I
 22.5    1.04             R.FQRVELEK.E
 22.5    1.00             K.LYRVEIEK.L
 22.5    1.07             R.MEVRIQEK.F
 22.5    1.00             K.YLRVLQEK.G
 20.9    0.08             K.MERTVAEAK.R
 19.9    1.01             K.LYAAILQQK.E
 19.8    0.08             -.MERTIQQK.Q
Top scoring peptide matches to query 7
Score greater than 29 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.2    0.08        K.LSVIEFVNC.-
 15.4    0.08        R.YEVLAVLCN.-
 13.2   -0.96        R.GGKEGQVLHR.S
 11.8    1.03        R.HGPVLSDVQK.S
 10.9    0.15        K.NSLPQFVNC.-
  9.3   -0.94        R.AEVLYNPFK.V
  8.6    1.08        R.EIGEFLTDR.G
  8.3   -0.87        R.LEDADIMMK.V
  8.1    0.06        K.DYLISNVEK.N
  8.0   -0.89        R.YCSLFTYK.D
Top scoring peptide matches to query 8
Score greater than 31 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.0    0.16    5  TRBOTR K.SSGTSYPDVLK.C
 17.9    1.13              K.TAGTIIYGSNR.G
 17.4   -0.81              K.KTSAMAQSTGR.M
 16.7   -0.78              K.SSASNHTNHAK.S
 16.6    1.16              NGGILNYMIR
 16.4   -0.86              R.SSGSYRSAIAR.N
 16.4    1.19              R.GNGSTIYFHR.I
 15.9   -0.87              -.MPPRPATATGR.R
 15.8   -0.85              K.SSGTNANTFKK.C
 15.7   -0.78              K.DSRNSDFTGR.R
Top scoring peptide matches to query 9
Score greater than 34 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.1    0.11        K.IRMQDPGYAK.V
 21.0    0.14        K.LEQSNAQMKK.E
 21.0    0.13        R.VNSASGEKMEK.E
 21.0    0.19        K.QQIASNSANNK.E
 18.6    0.11        R.AASTQATISSDK.L
 18.2    0.14        K.ETVEANYAPGK.T
 17.2    1.19        R.QLESNAIESAD.-
 16.7    1.09        K.NSDVIVMGTVK.E
 16.4    0.12        M.TTTQLTEEQK.Q
 16.3   -0.88        -.MNSSLTAQRR.G
Top scoring peptide matches to query 10
Score greater than 39 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 33.9   -0.83        R.MEMAADQLYK.Q
 24.9   -0.91        R.FLMICEIYK.W
 24.9   -0.83        K.MPMTGDEYIK.S
 24.8    0.11        R.MRNFDEIYK.I
 24.8    0.07        K.TAFKTNELYK.K
 24.0    1.17        K.DMNVSNEIYK.D
 24.0    1.10        K.FLDATNQLYK.A
 24.0    1.17        -.MNTAQNELYK.K
 24.0    1.09        K.RYNLNELYK.V
 24.0    1.10        R.YEVVGDQLYK.E
Top scoring peptide matches to query 11
Score greater than 32 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.4    0.03        K.SATEVLSARER.Y
 18.0    0.06        R.LQVQMSANGLR.V
 16.5    0.04        R.NVLLCSARER.L
 15.4    0.08        K.DLPSGMSARER.R
 14.6    0.06        R.SATQAVQREAR.D
 13.4    0.10        R.DSQDLEARQR.F
 13.2    0.12        NWEQQARQR
 11.9   -0.01        K.LKLEFGNLQR.A
 11.8    0.04        R.DRCVAVLTQR.L
 11.8    0.02        R.KIFAGDPSVER.C
Top scoring peptide matches to query 12
Score greater than 35 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 34.7    0.10    6  Q5A5U4_CANAL K.TDDSAPITIVAK.F
 20.8    0.10                    K.TNDLLALDVQK.L
 20.5    0.14                    R.WVGERTGLNPT.-
 20.2    0.19                    R.TNDSASAXVPPR.T
 20.2    0.19                    R.TNDSASAXVPPR.T
 16.5    0.15                    K.TNCNPGRVANK.S
 16.4    0.11                    R.TDNLRNDIIR.V
 15.9    0.13                    R.TDDLEQLAPTK.S
 15.9    0.18                    K.TDNIRYYER.I
 15.9    0.05                    R.TDNLIRSLGLK.H
Top scoring peptide matches to query 13
Score greater than 52 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 47.9    0.08   14  Q9HFS1_CANAL IYDQLPECAK
 36.9    0.02                    M.IYNKISNLNR.Y
 33.9    0.02                    M.IYNKISNLNR.Y
 33.9   -0.01                    K.LYDKLTENLK.G
 28.4    1.06                    R.FTQPEKLDEK.Y
 26.3   -0.03                    K.LYITLLAGGMGK.R
 24.4    0.03                    K.LYQGGINETIK.N
 24.3    0.02                    R.LYQNLCRLR.Y
 24.3    0.02                    R.LYQNLCRLR.Y
 24.3    0.04                    R.YLDQLRSADR.E
Top scoring peptide matches to query 14
Score greater than 33 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.7   -0.96        K.FIDNPFISGEK.M
 20.4    1.04        R.KDVDEFLAQAK.R
 20.2    1.00        R.FLTEENAILSK.K
 19.7    0.07        R.GIWETMLTGLE.-
 19.7    0.06        K.MEAVLSRSNNK.R
 19.6    1.03        R.FLETAERAAEK.V
 17.3   -0.83        -.MNSPSMGDPXNK.N
 15.3    1.03        R.EAAMGTQVLSLK.D
 14.6   -0.95        R.SSSSALENSTRK.T
 14.5    1.03        -.METIQNSIALK.Q
Top scoring peptide matches to query 15
Score greater than 24 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 15.2   -0.90                    K.TALQNIHSMQK.M
 10.9    0.13                    R.TAIDATDAHEAR.M
  7.9   -1.02                    K.QTLLGSLDLLAK.A
  7.4    0.09   13  Q59Y31_CANAL K.VITVVACDEHK.C
  6.5    0.10                    K.TDILNMSYGLK.A
  6.4   -1.02                    K.QTIGKIAQVLAK.S
  6.4    0.03                    R.RNAAGIGELELK.L
  6.3   -0.98                    R.VPSASAALVSELK.Q
  6.0   -0.96                    M.TAGPSVTVDGVLR.R
  5.9   -0.96                    K.QLNGQVPTSKAK.Q
Top scoring peptide matches to query 16
Score greater than 41 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 48.3    0.11   13  Q59Y31_CANAL K.VITVVACDEHK.C
 26.3   -0.01                    R.VLSLGLVENVVK.R
 23.8    0.04                    R.VLTGVLGNNGAVR.L
 23.8    0.04                    R.VLTGVLGNNGAVR.L
 20.2   -0.01                    R.VLAEGLINSLIK.S
 19.0    0.02                    R.VLTTPDLEVRK.K
 18.9    0.05                    R.VLIADDLADAVR.D
 17.0    0.05                    K.VLRLTYLTQY.-
 16.9    0.07                    K.VIEAVVPEVCR.E
 16.7    0.03                    R.VIEXVQRIWR.G
Top scoring peptide matches to query 17
Score greater than 30 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.2    0.02        K.APIVTAGASSVVAK.G
 16.4    1.04        R.ALEDLQAAGILR.G
 15.7    0.13        K.APPGNDLENKSK.T
 13.0    0.17        K.APEKAPEEXQR.E
 13.0    0.17        K.APEKAPEEXQR.E
 12.9    0.13        K.AIEYAIENGYK.D
 12.7    0.09        R.APEAIKLDNGGGK.V
 12.1    0.17        R.APQNALDTSHSK.I
 11.8    0.22        K.GXPAIXQSSMIK.I
 11.4    0.10        K.APPPANTFGGVSR.D
Top scoring peptide matches to query 18
Score greater than 26 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 24.9    0.11    6  Q5A5U4_CANAL R.YSESEYAVSNK.K
 12.4    0.03                    K.YSQILPEPSNK.A
 12.4   -0.93                    K.QPELSGAMVSDK.V
 12.1    0.02                    K.YTDSQGHVKIK.G
 11.6    0.05                    R.HIQSEYQSRK.M
  7.4   -0.90                    K.GLDYVMDSFSK.C
  7.4    1.10                    R.WIHDEQSFGR.I
  7.0    1.04                    K.LGDIQGPTDFGR.A
  6.7    1.08                    K.GLFEEYASFGR.G
  5.9    0.13                    R.YMREMYPDR.L
Top scoring peptide matches to query 19
Score greater than 50 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 52.8    0.10    8  Q5XQN5_BOVIN R.SLDLDSIIAEVK.A
 52.8    0.10   10  Q6PVZ5_CHICK R.SLDLNSIIAEVK.A
 52.8    0.10   11  Q8BIS2_MOUSE R.SLNLDSIIAEVK.A
 35.6   -0.86                    K.NSNISNLLNALK.D
 33.4    1.08   11  Q8BIS2_MOUSE R.SLNLDSIIAEVK.A
 32.3    0.17                    K.LSNLDEQKPQK.Q
 29.5    0.10                    K.LSNILNISDALK.K
 27.7    0.11                    R.ISDEWITLGIR.D
 26.6   -0.84                    K.NSDININIGSQK.E
 26.1    1.12                    K.NVTINEAIEVAK.K
Top scoring peptide matches to query 20
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 59.2   -0.75    7  Q55E01_DICDI M.DNNNNNNNNEK.Y
 49.5    1.14   12  Q7RDW0_PLAYO K.INNIDINNNEK.F
 46.8    1.19   18  Q6PQQ5_ARATH R.INNNNNNDNEK.T
 46.8    1.19   16  Q551G6_DICDI R.INNNNNNNNEK.Q
 46.4    0.14   15  Q7RQL1_PLAYO K.NNDINKTDENK.R
 44.4    0.15   20  Q5CV94_CRYPV K.NNDITEELNNK.S
 44.4    0.15   20  Q5CV94_CRYPV K.NNDITEELNNK.S
 44.2    0.11   17  Q4DWX6_TRYCR K.ASADITDLENQK.S
 43.9    0.14   15  Q7RQL1_PLAYO K.NNDINKTDENK.R
 43.9   -0.81   19  Q8ILH9_PLAF7 K.NNDNETINDEK.N
Top scoring peptide matches to query 21
Score greater than 25 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.8    0.07        K.SELNLPDDQHR.E
 11.6    1.06        R.SEEVKPMSMLR.R
 11.6    1.10        K.SQEEERQMLR.K
 11.6    1.02        K.SRQASQQTIFR.R
 11.6    1.02        K.SRQASQQTIFR.R
 11.5    1.15        K.SEEPSTIDCER.E
 11.5    0.07        R.SVCHQVGSRHR.I
 11.5    0.05        R.SFSSQRPVMER.Q
 11.5    1.02        K.SHFAAAMRLFR.V
 11.5    1.00        K.SIELMKWIMR.K
Top scoring peptide matches to query 22
Score greater than 35 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 22.6    0.06        K.MDNAVGPQVRTK.K
 21.5    1.09        R.KYNLGFDTMDK.L
 20.7    1.06        K.WLSDNGIIGNNK.N
 20.1    0.99        K.NTISLILPXMDK.F
 19.6    1.03        K.HPLHLMGVNADK.I
 19.1    1.12        R.FSQSMFQVNDK.S
 19.1    1.09        K.KNHEQFLGNDK.Y
 19.1    1.05        K.LRGSWGQIGNDK.I
 18.9    1.01        K.DWLTGRGITADK.L
 18.8    1.09        R.NFATFNFIDDK.K
Top scoring peptide matches to query 23
Score greater than 43 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 48.1    0.10    1  1C4FA    TIFFKDDGNYK
 28.1   -0.85    4  AAP69597 R.TIFFEDDGNYK.S
 22.9   -0.02                K.TLFFVHNKITK.I
 20.8    0.22                R.DVFSMDEMTEK.F
 20.4    0.09                R.ITFFSGFYHTK.K
 20.1    1.13                R.KHNNTNQFNVK.A
 20.1    1.13                R.KHNNTNQFNVK.A
 17.4    0.15                K.TIFDCALCGYK.N
 16.4    0.09                R.LTGTLQPWCSGK.D
 15.5   -0.03                R.TLFLENKEILK.D
Top scoring peptide matches to query 24
Score greater than 24 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.1    0.19        R.RGEPAASAAQSASR.Q
 12.7    1.14        K.VLLLENVNQTGR.D
 11.1   -0.92        K.TLLLKEESLGTR.D
 11.0    0.20        K.GGVEPQTETVWR.Q
 11.0   -0.92        K.ITPQQAFLVLTK.A
 11.0   -0.87        K.TLLLDASVSPDTK.F
 11.0   -0.92        K.TLLLSDAWLTVK.H
 10.1   -0.82        R.MGLAQLGTFHER.Q
  9.8    0.21        R.AENGEPWLKGQK.V
  9.8    0.13        K.NVTAVIGPCISVK.N
Top scoring peptide matches to query 25
Score greater than 25 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.2   -0.96        R.GVSYSGAATPALDR.S
 11.6   -0.90        R.GYVCAQNGELPR.A
 11.6   -0.90        R.GYVCAQNGELPR.A
  9.0    0.01        R.QQYEAALEGLLK.L
  8.5   -0.00        R.MSAIAESKQLTGK.Q
  8.2   -0.87        R.GGSGTEDADTAVER.I
  8.1   -0.97        R.QQYEAALEGLLK.L
  7.9    1.08        K.ANTDKAQADNLAK.S
  7.2   -1.00        M.GAIVNSVAYREGK.R
  6.8    1.06        R.VVADASQDAMLNK.I
Top scoring peptide matches to query 26
Score greater than 33 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 20.6    0.15        K.NQPTTKLQTNNK.S
 19.9   -0.83        K.NQPTTKLQTNNK.S
 19.9    1.02        R.GAKALTEIXPLTK.E
 19.9    1.06        R.GAKALTEIXPLTK.E
 17.2    0.15        K.NQPTTKLQTNNK.S
 15.9    0.15        K.NDEDKVTESKPK.R
 14.9    1.11        R.ASVAQNVILNETK.D
 14.6    0.24        K.NDDNFFIFDDK.I
 14.4   -0.82        K.DNTQLMKGNEPK.C
 14.3   -0.79        K.NKTNNLNNETPK.N
Top scoring peptide matches to query 27
Score greater than 44 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 41.9    0.10    2  Q5AFA2_CANAL K.DAVTWSVDGSVIR.T
 29.2   -0.80                    K.IDNNNSLGNEANK.N
 24.1   -0.82                    K.NNDNDSSKLQNR.I
 24.1   -0.82                    K.NNNNDSSKLQNR.I
 23.7    1.08                    K.INLNNSLKIQNK.N
 22.4   -0.72                    K.INNNPNNNENNK.T
 22.0    0.17                    K.GDLGDDEGDRLSR.C
 21.2    0.10                    K.VSTVADSLNSQQR.S
 21.2    0.01                    R.LTAVLAALAGHDPR.G
 21.1    0.13                    K.MKSSPNADDGLLR.I
Top scoring peptide matches to query 28
Score greater than 27 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.2    1.12        K.AELSNENVEALNK.G
 15.2    0.13        K.AELSNENVEALNK.G
 15.2    1.12        K.AELSNENVEALNK.G
 15.2    0.13        K.AELSNENVEALNK.G
 14.4    0.06        K.NLADISKNSLVEK.M
 13.9   -0.88        R.QGITLPANCTATGK.A
 13.9   -0.88        R.QGLTLPANCTATGK.A
 13.7    0.06        K.MQVTVVDLARER.G
 13.7   -0.93        K.MQVTVVDLARER.G
 13.3    0.10        R.INANVDETVTLDK.V
Top scoring peptide matches to query 29
Score greater than 36 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 27.6   -0.86        -.METLSIGTLVTCK.T
 22.7    1.14        K.NNLESLTIGAFAKA.-
 21.2    0.25        -.VETGSEATADSCPK.A
 20.9    0.13        R.GSELSSGGLMTRIK.A
 20.7    0.25        R.ADSNMGSVISDPDK.T
 20.7    0.19        R.NYNNLGLCNIVR.C
 20.7    0.19        R.NYNNLGLCNIVR.C
 20.7    0.19        R.NYNNLGLCNIVR.C
 20.1    0.15        R.SGEILGFAGLMGAGR.T
 19.4   -0.82        R.VMDLAETNTLMAK.I
Top scoring peptide matches to query 30
Score greater than 21 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8    1.08        K.LVEGYNLQIANVK.I
  8.2    1.11        -.MTGAAIQVRDLCK.T
  6.6    0.12        K.QNRQSISSPSFGR.K
  5.9   -0.95        AGSGKTFLINELSK
  5.7    1.11        R.DNLDALFELREK.W
  5.1    1.11        R.DNLAFQVVKGQDK.D
  4.7    0.14        R.VDFAELARNSGER.Q
  4.6    0.12        K.MTLAIENDNVVTK.L
  4.0    1.12        K.TEGKEEISNDTIK.C
  3.8    0.12        K.MTLAIENDNVVTK.L
Top scoring peptide matches to query 31
Score greater than 26 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 47.2    0.11    5  TRBOTR K.LQGIVSWGSGCAQK.N
 26.0   -0.88    5  TRBOTR K.LQGIVSWGSGCAQK.N
 10.3    0.03              R.IQGLSGEVLQGYVK.H
  8.7    0.03              K.LKGVIVNIDYDNK.R
  6.5    0.11              K.IQFSSMFFGVNLT.-
  6.3   -0.88              R.NQGLSERVDFGNR.I
  6.3    0.07              K.KLGLVNTATDASGSR.V
  6.3    0.07              K.KLGLVNTATNASGSR.V
  6.1   -0.94              R.INSPAIVADAQHQK.V
  6.0   -0.03              K.IIGQVRXQAEHLK.T
Top scoring peptide matches to query 32
Score greater than 19 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3   -1.00        K.INRTQAEEMLSGK.R
  5.8    1.04        K.NSQADTSTPQKEGK.E
  5.2   -1.06        K.DIEKLSQSEFIGK.V
  4.6   -1.00        R.GMQQQPQPHSALR.T
  4.2   -0.01        K.INRTQAEEMLSGK.R
  4.1    0.99        R.NSKPSYSDIAANPK.V
  3.9   -1.00        R.GMQQQPQPHSALR.T
  3.7    0.96        K.DKQFIQVLNEQK.E
  3.5   -0.12        K.KVLEIAVFEGGFGK.D
  3.5    0.94        K.MRGGAFAQLGVTER.A
Top scoring peptide matches to query 33
Score greater than 15 indicates homology
Score greater than 53 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6    0.54        R.LEDLDSLYFLLR.V
  2.6    0.54        R.LENLSDLYFLLR.V
Top scoring peptide matches to query 34
Score greater than 43 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 91.8    0.13    1+ 1C4FA FSVSGEGEGDATYGK
 25.1    0.07             R.LSDNAIIAVEGGESE.-
 19.8    1.07             -.MSLFPSAFESGVSK.I
 19.4    1.02             K.NLSIKGPWLCGEK.L
 19.3    1.04             R.IFYVNIFEGSGEK.L
 19.3    1.09             R.LMGVFGQFEGSWK.N
 19.3    1.09             K.RMYILGMEGSANK.L
 18.6    1.06             -.MISHIVSQESGXK.E
 17.5    1.05             K.ANELQRAINEQSK.L
 17.5    1.05             K.ANELQRAINEQSK.L
Top scoring peptide matches to query 35
Score greater than 16 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.9   -0.94        K.KDYVMITIPNSPK.D
  3.7   -0.95        HMPPNLQTVDLLK
  3.6    0.01        R.TNKGALAVEVYSLR.T
  3.4    0.25        K.TQCLDSCEMFTI.-
  3.2    1.11        R.TGEGLDVRGSQGFPX.-
  2.8   -0.88        R.DMMLLVNAGSEAQK.V
  2.7    1.06        R.TRNDIGNINSFIR.D
  2.5    1.11        R.AENLVELDMKDSR.L
  2.4    1.07        R.TDALAAMADITARGK.I
  2.3   -1.08        K.TLLRPGEVLAAARR.V
Top scoring peptide matches to query 36
Score greater than 33 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.1    1.11        K.NHFIKLNSNLSER.F
 21.1    0.12        K.NHFIKLNSNLSER.F
 20.4    0.01        K.ANLFLLFIQQLPR.L
 19.4    0.10        K.NTLALKLMAQGXYN.-
 19.1    0.10        R.GAFDARDWAALKPR.I
 18.8   -0.96        R.DYSENIPLKLLLR.R
 18.6   -0.88        K.NTLALKLMAQGXYN.-
 16.3    0.04        K.LANTKLLSNVSGVEK.V
 15.8    0.11        K.RDAGQIISFSHTNK.G
 15.8    0.00        R.DAPLLPGRLLQQPR.D
Top scoring peptide matches to query 37
Score greater than 23 indicates homology
Score greater than 56 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.5    1.04        R.HDAVVCSVVQAVFR.A
  9.9   -0.91        K.AIVPNGELCSAGDSAK.A
  9.6    1.09        K.YCTIGHGAIVHACK.V
  7.0    1.07        R.EHGLGTFVAQQQLR.I
  6.2   -0.94        K.GFGFVQFAHLEHAK.A
  5.2   -0.84        K.TIAGEMNGIFMDEK.S
  5.2   -0.07        K.RPASYGALLLSVVGGK.L
  4.3    0.07        K.NLPNPPKQLYCNK.G
  4.2   -0.92        K.NLPNPPKQLYCNK.G
  3.8    1.00        R.VSKLYGLPAANPNGGK.E
Top scoring peptide matches to query 38
Score greater than 27 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.9    0.06        R.LMYLAEVDLPESAK.T
 14.8   -1.08        K.VLIVLTEPSDVVRR.S
 13.5   -1.06        R.VVSERVTSVTLHLR.T
 13.1   -0.94        K.MLSTPQTVVTEYAR.M
 13.0    1.04        R.ENQYTVVSQIRVR.R
 13.0    1.04        R.ENQYTVVSQIRVR.R
 12.8    1.00        R.CVYLQAVIKETLR.L
 11.7    0.06        R.ENQYTVVSQIRVR.R
 11.6    1.15        K.AIEREQDDTMTER.L
 11.2   -0.94        R.RDLGTGEEVTLSYR.V
Top scoring peptide matches to query 39
Score greater than 27 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.5    1.00        K.VVDVNIKSNSLYLK.F
 13.6   -1.05        R.VVSERVTSVTLHLR.T
 13.0    0.07        R.LMYLAEVDLPESAK.T
 11.6   -1.08        K.VLIVLTEPSDVVRR.S
 11.6    1.00        R.CVYLQAVIKETLR.L
 11.5    1.15        K.AIEREQDDTMTER.L
 11.3   -0.93        R.RDLGTGEEVTLSYR.V
 11.3    1.05        R.ENQYTVVSQIRVR.R
 11.3    0.00        R.AHARTTVQEVDLVR.Q
 10.9    0.01        R.LPNIVASGPITDAGNR.T
Top scoring peptide matches to query 40
Score greater than 43 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 54.4    0.11    9  Q5AJC0_CANAL R.IQFSLWPGGDSSNAK.G
 40.9   -0.88    9  Q5AJC0_CANAL R.IQFSLWPGGDSSNAK.G
 28.1   -0.01                    K.LKAYINILDSLSEK.E
 25.8    0.09                    R.MGLKSAQNALDSLQK.A
 20.4    0.04                    K.TSSLSISNLDLSELK.I
 19.6    0.02                    K.IQEKIQYDLSIEK.I
 19.2    1.18                    K.EAEEMEPNALGRSR.K
 18.7    1.14                    R.EQAEINNTDLISEK.Y
 18.6    0.08                    R.LSEKINWQMSIEK.N
 18.3    0.01                    K.QIIQAYNSVNKLSK.D
Top scoring peptide matches to query 41
Score greater than 41 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 33.3    0.08        K.NNNAVNLMINDFTK.L
 27.6    1.02        K.LALNTNLSLDEYNK.L
 25.4   -0.05        R.RLMNDLQVIHMNK.C
 24.4   -0.90        K.NNNAVNLMINDFTK.L
 22.7    0.08        K.NNNAVNLMINDFTK.L
 22.7    0.08        K.NNNAVNLMINDFTK.L
 22.0   -0.04        -.MSXGFGLFLIPTATK.N
 22.0   -0.04        -.MSXGFGLFLIPTATK.N
 20.9    0.13        K.NNDGTSDGNDVSTSTK.T
 19.8    1.00        K.LSSAQIAASEAASNYK.N
Top scoring peptide matches to query 42
Score greater than 40 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
107.3    0.12    3  Q5AFN8_CANAL K.CSGLNDLSCICTTK.N
 76.7   -0.86    3  Q5AFN8_CANAL K.CSGLNDLSCICTTK.N
 22.0    1.02                    R.VFGAQAAISRNNYSK.V
 22.0    1.02                    R.VFGAQAAISRNNYSK.V
 21.1   -0.02                    R.TQGLNDIIIELNQR.L
 19.8    0.05                    K.MRIDNNAEYVIMK.E
 19.1    0.96                    R.TQGLNDIIIELNQR.L
 18.6   -0.02                    K.QSAVTSPGAVTPDLGTK.R
 17.6   -1.02                    K.SDPTNSLNPGIGKTTK.L
 17.4   -0.00                    K.RFIDLSTVGSTMASK.I
Top scoring peptide matches to query 43
Score greater than 27 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.7   -0.04        K.RIYHNLPPPASELK.L
 13.8    1.10        K.EFEYGGISGNKYNR.N
 11.8    0.07        R.MMMKNIMHPNVIK.N
 11.7   -0.91        R.FLMYINMIESNTK.T
 11.3   -0.85        R.AGSSQLFVCNYMNK.G
 10.8    0.05        K.AMYWAQRASYFLK.C
 10.7    0.13        R.DMGHLQVDYRDNR.L
 10.5    1.01        R.QNLRGVANIDEYLK.D
 10.5    1.01        R.QNLRGVANIDQYIK.D
 10.4    0.00        K.SQYFPQSVKYLFK.D
Top scoring peptide matches to query 44
Score greater than 25 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.6    1.01        K.AQNIIQELNITLDR.K
 13.1    0.96        K.GHHPISAVIGTAITGGR.Q
 11.5    0.98        K.EQGLIIEKVLETDR.R
 10.5   -1.02        R.HDPALLTAILGLENPA.-
 10.0    1.05        R.EWLENGAIRVNGER.V
  9.4   -0.03        R.HDPALLTAILGLENPA.-
  8.8    0.96        K.QNNAISAVVFPIIEK.H
  8.8    0.96        K.QNNAISAVVFPIIEK.H
  8.8    0.96        K.QNNAISAVVFPIIEK.H
  8.7   -1.02        R.ISETLGTATELRAQR.N
Top scoring peptide matches to query 45
Score greater than 19 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.5    0.18        R.NNVTNTMGQFNTQR.Q
  6.5    0.18        R.NNVTNTMGQFNTQR.Q
  5.9   -1.03        K.ELARMTVTQVLEQK.G
  5.1    1.00        R.GFHPCQAVYILLPK.G
  4.9    1.01        K.VAEEPAEPLNLGLYK.Y
  4.8    0.98        K.LLSDMGDLVARTAGPK.I
  4.7    0.02        R.AELADLDESTLGAALR.E
  4.7   -1.02        R.ISETLGTATELRAQR.N
  4.7   -0.05        K.QMGVINRQTVAVAIK.D
  4.7   -0.05        K.QMGVINRQTVAVAIK.D
Top scoring peptide matches to query 46
Score greater than 37 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 34.3    0.13        K.QTNHDSSISNKDNLK.I
 22.9    0.08        R.TQPPVIMPGMQTEIK.T
 22.8   -0.95        R.VMPSKPLVMSQDVQK.G
 22.2    0.00        R.VFENGAWKTVDPVLK.D
 21.5    0.11        K.NPDYDFFIDVSSRK.T
 19.2    0.07        K.NDKSVNIDVDLQVDK.Q
 18.8    0.23        K.YYYFNDNGQMQIK.W
 18.8    0.23        K.YYYFNDNGQMQIK.W
 17.7   -0.98        R.VFENGAWKTVDPVLK.D
 17.6    0.13        K.QTNHDSSISNKDNLK.I
Top scoring peptide matches to query 47
Score greater than 35 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 68.0    1.12    3  Q5AFN8_CANAL K.EICPNGDADTAISAFK.S
 19.0    0.16                    R.LQCPQCVFGTNCPK.T
 18.1    1.12                    K.EICNAYTELNDPIR.Q
 17.1   -0.07                    R.ELQKAPALLLTEDIR.F
 15.6   -0.97                    K.QDLLLRNNQNPQEK.S
 14.9   -0.97                    K.QDLLLRNNQNPQEK.S
 14.2   -0.97                    K.QDLLLRNNQNPQEK.S
 14.2   -0.97                    K.QDLLLRNNQNPQEK.S
 14.0   -0.87                    K.QNIGSTSMSNGVQSQR.V
 14.0   -0.87                    K.QNIGSTSMSNGVQSQR.V
Top scoring peptide matches to query 48
Score greater than 25 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.4   -0.08        -.PQVXLWQRPLVPIR.I
 11.6   -0.82        M.VSHLCRINCHHFC.-
 11.6   -1.06        -.PQVXLWQRPLVPIR.I
 11.5   -0.84        R.NNPMTGIDEDGRMFK.T
  9.3    1.05        R.SHVRTGSNNSEAPLAAK.T
  8.2   -0.95        K.MSAQHGSPTRKPSGTAK.D
  7.8   -0.93        K.TYPTVKICNYEGPAK.I
  7.0   -1.02        K.SGDQVLVQVTKDPVGAK.G
  6.3   -0.95        K.NPINTPDKAIPSMDVK.V
  5.9    0.93        R.HSVKWPQVVALIFSK.I
Top scoring peptide matches to query 49
Score greater than 37 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
125.5    0.14    2  Q5AFA2_CANAL K.QYSYSDQSGSWESIK.A
 95.4   -0.84    2  Q5AFA2_CANAL K.QYSYSDQSGSWESIK.A
 30.1   -0.84    2  Q5AFA2_CANAL K.QYSYSDQSGSWESIK.A
 16.8   -0.80                    K.NSNNLSDKNNNNNNGK.S
 16.8   -0.80                    K.NSNNLSDKNNNNNNGK.S
 16.5   -0.01                    K.EYSLSIIVTNHMTKK.Y
 16.4   -0.02                    K.QYSIHVSGNNIPPPLK.S
 16.4   -0.02                    K.QYSIHVSGNNIPPPLK.S
 16.0    0.05                    R.QHLLHWGFVXPDQK.H
 15.7    0.15                    K.IEEEQNKCQQQAEK.Q
Top scoring peptide matches to query 50
Score greater than 35 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein      Peptide
 65.7    0.14    2  Q5AFA2_CANAL K.SSDCSPVPALGSSFLEK.F
 18.5   -0.84                    K.CQCVLAADEVVFNQK.E
 18.3    0.13                    K.TPQLHEHGMVTSTPTK.T
 17.7    0.11                    K.MTLENQFHINYNLK.R
 16.5   -0.82                    K.MQLAEQIAMVDTENR.Q
 16.4    0.15                    R.KFGDWVLNINGDMDR.A
 14.7    0.25                    R.GNACNDVMFFYIGDR.C
 14.7    0.15                    R.KFGDWVLNINGDMDR.A
 13.5    0.16                    K.MQLAEQIAMVDTENR.Q
 13.4   -0.90                    K.MSKSLGNYIGINESPR.E
Top scoring peptide matches to query 51
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 52
Score greater than 17 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6   -1.14        R.QAAALALLDGDAPGPLIVR.W
  4.6    0.04        R.EVIIHQQNFEESTQR.V
  4.6   -0.86        K.CLYKNADDASCTGADAK.E
  4.5    0.06        K.TYEPTGAFNGKQFEGGR.S
  4.5    0.06        K.TYEPTGAFNGKQFEGGR.S
  4.3    0.20        R.SCREGVCGSDGMNMNGK.N
  4.3    0.04        R.EVIIHQQNFEESTQR.V
  3.0   -0.93        K.QVLLMKEHECNENSK.N
  2.7    0.86        K.APLVTPPHLLSRDLMAK.G
  2.6    0.05        R.QYTGNGECFLWKLDK.V
Top scoring peptide matches to query 53
Score greater than 21 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6   -1.17        K.LPIQRLQIQSTPSILR.V
  8.6   -1.17        K.LPIQRLQIQSTPSILR.V
  8.6    1.03        R.DQQITPQQQIDFSRR.F
  8.5   -1.03        K.YSATAAMNAGPILANIIR.R
  8.1    0.01        R.SYIENKMQGLPNQPIK.L
  7.5    0.04        R.DQQITPQQQIDFSRR.F
  7.5    0.04        R.DQQITPQQQIDFSRR.F
  7.5   -0.94        R.DQQITPQQQIDFSRR.F
  7.1    0.95        K.LKLILNNQQFQLEQK.N
  7.1    0.95        K.LKLILNNQQFQLEQK.N
Top scoring peptide matches to query 54
Score greater than 24 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.2    0.87        K.VVDNQKIEIIVVLNFR.T
 10.5    1.07        R.NEKLYVGEDLESLNMK.E
 10.5    0.09        R.NEKLYVGEDLESLNMK.E
  9.9    1.15        K.ETHTNQMTICTGVFNK.L
  9.9   -0.07        M.EMILISSSTLRFHPLR.T
  9.6   -0.94        K.HNNHMAKILTPAMYAR.L
  9.4    0.07        R.EMISTSLSPQKSSGFSGR.R
  8.2   -1.00        K.NHRLEVLSYIINNCR.N
  8.1    1.06        R.LFGSGMNLTTILNNTQR.V
  8.1    1.06        R.LFGSGMNLTTILNNTQR.V
Top scoring peptide matches to query 55
Score greater than 24 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.6   -0.90        R.AQAAAPAIHAMNPRVQLR.I
 10.4   -0.90        R.AALQLVHVAQPGNTDELR.I
  9.0    1.15        R.IGVFAMQVAMNEAFKMK.L
  6.3    0.18        M.ADNDGAVSNGIIVEQTSNK.G
  6.3   -0.92        K.AIAQVDTFRSSLGAVQNR.L
  5.4   -1.01        K.AIALSIGFLWIRASYPR.F
  5.0    1.10        K.SFAENAKIIFDGVHVER.D
  4.8    0.09        R.AQAAAPAIHAMNPRVQLR.I
  4.7    1.15        R.SEHQGALWDCLLSFIR.L
  4.7    0.34        K.FFESHTCDSENANSCK.I
Top scoring peptide matches to query 56
Score greater than 26 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.3   -0.93        R.GEALEQQVVQVAHEVGVR.L
 12.3    0.04        R.ALKMHGGGPQVVAGKPLDR.A
  8.4    0.15        K.KEAASGVMTFFTLGAMDR.K
  8.2    0.12        R.LSTVIQNITEGTDREDR.E
  7.6   -0.02        R.TSDLILIVLDATKSLAMK.R
  6.4    0.17        R.QPHNPTHIRGAGNQFDR.K
  6.2    0.16        K.ESQLAGRIVQENGCETR.N
  6.2    0.17        R.AVHEKLEMMGLSNMADR.Q
  6.2    0.36        K.INQMNQMNQMNQMNR.M
  6.2    0.36        K.INQMNQMNQMNQMNR.M
Top scoring peptide matches to query 57
Score greater than 20 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.6    1.09        R.YELRDGLAEISTIESVR.K
  6.6    0.15        K.VVIDCFSGVGAIDIDPMK.I
  4.6    0.25        K.NSGVAGGIGNNSGGSSNISGNK.N
  4.3    1.00        R.DLFAVLGVFAALSVYIPR.L
  3.3    0.07        K.GAATNFISLVSEGTDTKIK.C
  2.9    0.12        K.DFESLLNVISEKSDDIK.L
  2.7    1.19        R.NGIERYELIQDGGENSR.R
  1.6   -0.89        K.FLPEDIGQAPIVNAPEGGK.V
  1.6    0.19        K.DANNKTNFQAIFDNNPK.F
  1.5    1.12        K.NIIYNNNSSLTIINNNK.N
Top scoring peptide matches to query 58
Score greater than 24 indicates homology
Score greater than 55 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.1    0.06        K.VAFITGGGTGLGRGMTTTPSR.L
 12.1    1.02        K.EIYNNNIIINTTITSSIK.Q
 11.4   -0.88        R.DQSVIEDWKFVAMVVDR.L
 10.5    0.10        R.MGLSRAILNYIQENANAR.E
 10.5   -0.88        R.MGLSRAILNYIQENANAR.E
  9.6    0.08        K.ESTIINIYWETAQEISR.N
  9.0   -0.81        R.GYRASDWXLDQPDWTGR.L
  9.0   -0.85        R.SISSFQPQFVAPQVDMNR.T
  8.6    0.12        K.INDISRNSYANMIILPNS.-
  8.5   -0.93        K.TDSAFAGILLMGDNSLRTR.N
Top scoring peptide matches to query 59
Score greater than 30 indicates homology
Score greater than 54 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.9    0.27        R.QLFGPGPSNMADSIAETQSR.N
 17.3    0.18        R.DNLAPHMALVPMVIEQTSR.G
 15.5    1.06        K.LFIINSNSEKFLINNILK.K
 14.5    0.14        R.SKASSLPHGVPILSQEEQSK.E
 14.3    1.06        K.LFIINSNSEKFLINNILK.K
 14.0    0.08        -.MLILAIDTASIYCAVALIR.H
 14.0    0.08        -.MLILALDTASIYCAVALIR.Q
 13.6    0.15        K.LKQNNALDFDDIIMLTIK.L
 13.6    0.15        K.LKQNNALDFDDIIMLTIK.L
 13.6    0.15        K.LKQNNALDFDDIIMLTIK.L
Top scoring peptide matches to query 60
Score greater than 40 indicates homology
Score greater than 53 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 36.5    0.18        R.IVGGQVLYYREDGSVVDLLK.L
 25.4    0.26        K.DMINLVSEEKLIFEGTEQK.E
 18.6    0.20        K.KALEMMLSYGIDGLIVEPTK.S
 16.4    0.25        R.LDMQVVSATYNNLSLAVQQK.F
 15.1    0.17        R.IVMNNYSARYRPGLNLVVK.Q
 14.7    0.23        R.NLTTFDVDLNTTSNLVKQAK.T
 14.5    0.17        K.VLFNVLSYRFPYLQAHEK.M
 14.3   -0.66        K.AAGKNQGGSVDMVWINGENFK.S
 14.2    0.30        K.AASIDDILNTGFNLKNNGTDK.D
 13.5   -0.66        K.AAGKNQGGSVDMVWINGENFK.S
Top scoring peptide matches to query 61
Score greater than 51 indicates homology
Score greater than 53 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
134.4    0.19    1  1C4FA GEELFTGVVPILVELDGDVNGHK
 30.6    1.18    1  1C4FA GEELFTGVVPILVELDGDVNGHK
 14.3    1.12             R.ALSREEDLAVFVVLHDVNLAAR.W
 13.8    0.20             R.DLSEMTGVALGTVNTTITELLMK.D
 13.4    0.30             R.SVQLGMPTGVLAQPYSSDQSVDR.V
 12.8   -0.77             K.VSQLEFENNMLQDISNKITSK.Y
 12.7    0.20             R.NLLSMSQEKYASHVVEVAFLR.A
 12.3    1.19             K.ALELKDFPDYSTELVNGVLANK.E
 12.2   -0.74             R.DXEDVFAGKNTDLEVLMEWLK.-
 12.1    0.06             M.FDALVIGSGPAGLAIAAELAQRGLK.V
Top scoring peptide matches to query 62
Score greater than 39 indicates homology
Score greater than 54 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 30.1    0.21        R.MDQMLSDKNVASISATLQNLEK.I
 25.6    0.22        K.EMVEDLNDHIHLENDILFAR.V
 20.2    0.23        R.NANAYRQVSVPELTQQMFDPK.N
 20.2    0.23        R.NANAYRQVSVPELTQQMFDPK.N
 20.2    0.23        R.NANAYRQVSVPELTQQMFDPK.N
 18.8    0.08        K.TLDHVAAIRQSMAVQESLLAIR.Q
 18.5    0.18        R.AIVDSMSTSSLDKVSPSDFINPK.V
 18.5    0.18        R.AVIDSMSTSSLDKVSSPDFINPK.V
 17.8    0.09        R.EEFXQEIASLLPSKNLFYAIR.L
 17.6    0.20        K.IFGNNEVAASLHQSIVLHDDTR.L
Top scoring peptide matches to query 63
Score greater than 21 indicates homology
Score greater than 53 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.3   -0.99        R.IIVNLPRQMISRPIYAEEEQVQALLK.T
  8.4   -0.87        R.STHNPLLNTGVFGQQSGAAYVGNXRVINR.H
  8.3   -0.92        R.STHNPLLNTGVFGQQSGAAYVGNXRVINR.H
  7.4    1.03        K.EISELLTLAQTLNVRIAAVTPDACALQR.L
  7.4    1.03        K.EISELLTLAQTLNVRIAAVTPDACALQR.L
  7.0    1.13        R.QPPQDMAAEQAVLGGMLLSKDAIANVLER.L
  7.0    1.13        R.QPPQDMAAEQAVLGGMLLSKDAIANVLER.L
  7.0    1.16        R.DMLQKPTNHVLPSNSLEQLATTLDNMR.C
  7.0    1.16        R.DMLQKPTNHVLPSNSLEQLATTLDNMR.C
  7.0    1.16        R.DMLQKPTNHVLPSNSLEQLATTLDNMR.C
Top scoring peptide matches to query 64
Score greater than 13 indicates homology
Score greater than 48 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.3    0.75        R.TDGAHPHSDSGNGPPPLPENPTLAQVMAHQTQMMAAMMQQMQQQHQQMHQR.M
  1.0   -0.23        R.TDGAHPHSDSGNGPPPLPENPTLAQVMAHQTQMMAAMMQQMQQQHQQMHQR.M
  0.3    0.68        K.TIIFNQSSGGDPEIVMHSFNCGGEFFYCNTAQLFNSTWAPGSNKPKGNSSGK.I
  0.1    0.66        R.ETEIVTSNAQFFRENLQTMLDYYNLSQNGSHTIQVMYGCEVLYGSLFR.A
  0.1    0.72        K.TIIFNQSSGGDPEIVMHSFNCGGEFFYCNTAQLFNSTWAPGSNKPEGNSSGK.I
  0.0    0.93        K.NNNNNTNNSNNNNNNNNNNNINNNNNNNSNKQTANNTTNDFSFDQNTDLR.S
  0.0   -0.06        K.NNNNNTNNSNNNNNNNNNNNINNNNNNNSNKQTANNTTNDFSFDQNTDLR.S
  0.0   -1.04        K.NNNNNTNNSNNNNNNNNNNNINNNNNNNSNKQTANNTTNDFSFDQNTDLR.S