Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0194_q1.pkl
Database        : CAlbicans dos (20286 sequences; 6720281 residues)
Timestamp       : 12 Apr 2005 at 10:40:05 GMT
Significant hits: mIPF8527|mPga29:  189 aa - Candida albicans unknown function
                  mCHT2             583 aa - chitinase 2 precursor Candida albicans
                  mSSR1             |Candida albicans 212 aa - Secretory Stress Response
                  mPhr2             |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
                  mEcm33.3          |predicted|m5366.2|CaECM33
                  mSod5/Pga3        |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
                  mALS1.5eoc        |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  TRBOTR            trypsin (EC3.4.21.4 ) precursor-bovine
                  mPga24            |predicted| mIPF5185 C. albicans |CA1678| 533 aa
                  mPga10            |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
                  mPga31            |predicted| C. albicans fungus|CA2156|mIPF8532: 275 aa
                  13836.2           CONTIG=Contig10146 POSCDS1=76347 POSCDS2=77504

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 34 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

Switch to Protein Summary Report

To create a bookmark for this report, right click this link: Peptide Summary Report (../data/20050412/F002879.dat)

        Error tolerant   

1.    mIPF8527|mPga29:                  Mass: 19928    Score: 272    Peptides matched: 7
 189 aa - Candida albicans unknown function
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   453.30   904.59   904.50   0.09 0  28  0.2 1  QIFQELK
22   554.38   1106.75   1106.63   0.12 0  25  0.42 1  TISSIQLFAK
30   615.89   1229.77   1229.65   0.12 0  7  26 1  TDDSAPITIVAK
34   638.85   1275.69   1275.56   0.13 0  59  0.00021 1  YSESEYAVSNK
38   679.95   1357.88   1357.75   0.13 1  108  1.8e-009 1  KTDDSAPITIVAK
53   568.66   1702.97   1702.80   0.16 1  45  0.0042 1  DGTLSFTGDDKVYASK
54   852.49   1702.97   1702.80   0.17 1  (21) 0.95 1  DGTLSFTGDDKVYASK

2.    mCHT2                             Mass: 59565    Score: 193    Peptides matched: 4
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   425.25   848.48   848.40   0.08 0  53  0.00074 1  FADSAPNK
12   495.32   988.62   988.54   0.07 0  66  3.5e-005 1  LSSAIEEIK
14   497.78   993.55   993.49   0.06 0  52  0.00098 1  FADTLWNK
59   970.10   1938.19   1938.01   0.18 0  22  0.7 1  LFVGVPATSNIAGYVDTSK

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 193    Peptides matched: 4
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
      19719.2                           Mass: 51350    Score: 193    Peptides matched: 4
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
3.    mSSR1                             Mass: 20690    Score: 189    Peptides matched: 3
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
48   814.92   1627.83   1627.70   0.13 0  (37) 0.027 1  CSGLNDLSCICTTK
49   815.43   1628.85   1627.70   1.15 0  116  3.4e-010 1  CSGLNDLSCICTTK
55   854.97   1707.93   1707.78   0.16 0  73  7.7e-006 1  EICPNGDADTAISAFK

 
      Proteins matching the same set of peptides:
      3054.1                            Mass: 22993    Score: 189    Peptides matched: 3
 |Ssr1| CONTIG=Contig10262 POSCDS1=71490 POSCDS2=72194
4.    mPhr2                             Mass: 57243    Score: 163    Peptides matched: 3
 |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   520.31   1038.60   1038.50   0.11 0  66  4e-005 1  SNTDASAFVK
35   649.42   1296.83   1296.69   0.14 0  42  0.008 1  EDLPAIEIVGNK
43   782.96   1563.91   1563.75   0.16 0  57  0.00027 1  SIPVGYSANDDSAIR

5.    mEcm33.3                          Mass: 41984    Score: 139    Peptides matched: 5
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   385.23   768.45   768.38   0.07 0  24  0.5 1  SFSGFPK
3   410.79   819.56   819.49   0.08 0  23  0.72 1  VSGGFILK
8   463.77   925.52   925.43   0.09 0  11  9.9 1  LSCSAFNK
36   653.88   1305.75   1305.61   0.14 0  28  0.23 1  NDDLTELDFPK
44   787.49   1572.97   1572.81   0.16 0  53  0.00065 1  TIGGALQISDNSELR

 
      Proteins matching the same set of peptides:
      5366.2                            Mass: 43798    Score: 139    Peptides matched: 5
 |Ecm33.3| CaECM33 CONTIG=Contig10163 POSCDS1=164904 POSCDS2=166142
      24311.1                           Mass: 42880    Score: 139    Peptides matched: 5
 CONTIG=Contig20163 POSCDS1=164513 POSCDS2=165751
6.    mSod5/Pga3                        Mass: 22006    Score: 116    Peptides matched: 1
 |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
39   704.43   1406.85   1406.72   0.14 0  116  3.4e-010 1  AATPAAHEVGDLAGK

 
      Proteins matching the same set of peptides:
      1222.2                            Mass: 23689    Score: 116    Peptides matched: 1
 |Pga3/Sod5| CONTIG=Contig10139 POSCDS1=124618 POSCDS2=125304
      25296.1                           Mass: 26345    Score: 116    Peptides matched: 1
 CONTIG=Contig20139 POSCDS1=124373 POSCDS2=125059
7.    mALS1.5eoc                        Mass: 69052    Score: 93     Peptides matched: 2
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
40   708.41   1414.82   1414.67   0.14 0  45  0.0048 1  STVDPSGYLYASR
52   843.49   1684.97   1684.82   0.16 0  49  0.0018 1  YTTSQTSVDLTADGVK

 
      Proteins matching the same set of peptides:
      13002.2                           Mass: 133694   Score: 93     Peptides matched: 2
 |Als1| CONTIG=Contig10233 POSCDS1=72223 POSCDS2=76005
      21498.1                           Mass: 133402   Score: 93     Peptides matched: 2
 |Als1| CONTIG=Contig20233 POSCDS1=71475 POSCDS2=75257
8.    TRBOTR                            Mass: 24662    Score: 70     Peptides matched: 2
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
20   539.32   1076.63   1076.52   0.11 0  13  7.6 1  APILSDSSCK
26   577.34   1152.67   1152.57   0.11 0  57  0.00029 1  SSGTSYPDVLK

9.    mPga24                            Mass: 52805    Score: 58     Peptides matched: 1
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
33   635.89   1269.76   1269.64   0.13 0  58  0.0002 1  VITVVACDEHK

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 58     Peptides matched: 1
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 58     Peptides matched: 1
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
10.   mPga10                            Mass: 23610    Score: 40     Peptides matched: 2
 |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
31   618.86   1235.71   1235.59   0.12 0  38  0.022 1  IYDQLPECAK
 48   814.92   1627.83   1626.76   1.07 0  2  94 2  AANAASATTSAETATK + Hex (T)

 
      Proteins matching the same set of peptides:
      20169.1                           Mass: 25603    Score: 40     Peptides matched: 2
 |Pga10| CONTIG=Contig10231 POSCDS1=59560 POSCDS2=60312
      21543.1                           Mass: 25731    Score: 40     Peptides matched: 2
 CONTIG=Contig20231 POSCDS1=59564 POSCDS2=60316
11.   mPga31                            Mass: 28082    Score: 39     Peptides matched: 2
 |predicted| C. albicans fungus|CA2156|mIPF8532: 275 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   427.28   852.54   852.46   0.09 0  16  3.6 1  TVYTELK
29   614.35   1226.68   1226.56   0.12 0  23  0.82 1  NINDPYNYSK

 
      Proteins matching the same set of peptides:
      8535.2                            Mass: 37370    Score: 39     Peptides matched: 2
 |Pga31| CONTIG=Contig10225 POSCDS1=23500 POSCDS2=24558
      21866.1                           Mass: 31347    Score: 39     Peptides matched: 2
 CONTIG=Contig20225 POSCDS1=23664 POSCDS2=24539
12.   13836.2                           Score: 37     Peptides matched: 2
 CONTIG=Contig10146 POSCDS1=76347 POSCDS2=77504
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   425.25   848.48   847.44   1.04 1  31  0.12 2  AGKTADSAK
 21   551.85   1101.69   1102.51   -0.83 0  6  36 4  TGVDHLDAK + Hex (S)

 
      Proteins matching the same set of peptides:
      24991.1                           Score: 37     Peptides matched: 2
13.   21725.1                           Mass: 5538     Score: 27     Peptides matched: 1
 CONTIG=Contig20227 POSCDS1=57992 POSCDS2=58138
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   506.32   1010.63   1010.51   0.12 0  27  0.29 1  ISSLNTTK + Hex (S)

 
      Proteins matching the same set of peptides:
      28028.1                           Mass: 5538     Score: 27     Peptides matched: 1
 CONTIG=Contig10227 POSCDS1=58004 POSCDS2=58150
14.   7514.2                            Mass: 57466    Score: 21     Peptides matched: 1
 CONTIG=Contig10141 POSCDS1=69838 POSCDS2=71340
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 29   614.35   1226.68   1226.64   0.04 1  23  0.82 1  NLNDPRTELR

 
      Proteins matching the same set of peptides:
      25119.1                           Mass: 59614    Score: 21     Peptides matched: 1
 CONTIG=Contig20141 POSCDS1=69839 POSCDS2=71341
15.   4195.1                            Score: 21     Peptides matched: 2
 CONTIG=Contig10227 POSCDS1=114726 POSCDS2=117350
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 4   425.25   848.48   847.53   0.96 1  4  67 8  IFRITAK
 6   453.30   904.59   904.57   0.02 1  17  2.6 3  KLVSAFIK

 
      Proteins matching the same set of peptides:
      21693.1                           Score: 21     Peptides matched: 2
16.   10842.2                           Mass: 187295   Score: 20     Peptides matched: 2
 CONTIG=Contig10132 POSCDS1=20756 POSCDS2=25753
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
41   716.92   1431.82   1432.64   -0.82 0  19  1.6 1  QGIDSSTSAFMK + Hex (T)
 59   970.10   1938.19   1937.97   0.22 1  2  64 10  LSNVGTGSFDVFAQMPRL

 
      Proteins matching the same set of peptides:
      25490.1                           Mass: 188722   Score: 20     Peptides matched: 2
 CONTIG=Contig20132 POSCDS1=21315 POSCDS2=26312
17.   15888.3                           Score: 19     Peptides matched: 1
 CONTIG=Contig10230 POSCDS1=117378 POSCDS2=125999
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   506.32   1010.63   1010.51   0.12 0  21  1.1 3  LMSGSFELK

 
      Proteins matching the same set of peptides:
      21605.1                           Score: 19     Peptides matched: 1
18.   9023.3                            Mass: 33980    Score: 19     Peptides matched: 1
 |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   759.91   1517.80   1517.65   0.16 0  19  2.1 1  GITYSPYSDNGGCK

 
      Proteins matching the same set of peptides:
      15898.1                           Mass: 39582    Score: 19     Peptides matched: 1
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
      m15898.1|mSCW1:                   Mass: 35901    Score: 19     Peptides matched: 1
 346 aa - glucanase (by homology) Candida albicans
19.   4544.1                            Score: 18     Peptides matched: 2
 CONTIG=Contig10076 POSCDS1=238004 POSCDS2=242149
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 1   385.23   768.45   768.40   0.05 0  1  95 10  SFTSISK
 17   506.32   1010.63   1010.55   0.08 1  20  1.4 4  LSSLSTKK + Hex (S)

 
      Proteins matching the same set of peptides:
      26481.1                           Score: 18     Peptides matched: 2
20.   477.1                             Score: 18     Peptides matched: 1
 CONTIG=Contig10262 POSCDS1=147351 POSCDS2=148031
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 38   679.95   1357.88   1357.70   0.18 1  18  2.1 2  SQTIKAPSFDHK

21.   24010.1                           Score: 17     Peptides matched: 1
 CONTIG=Contig20172 POSCDS1=17722 POSCDS2=17934
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   506.32   1010.63   1010.60   0.03 0  17  2.9 7  IPGLELELK

 
      Proteins matching the same set of peptides:
      28827.1                           Score: 17     Peptides matched: 1
22.   19795.1                           Mass: 141435   Score: 17     Peptides matched: 1
 CONTIG=Contig10176 POSCDS1=77381 POSCDS2=81067
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   506.32   1010.63   1011.54   -0.91 1  19  1.9 5  NKFFDTIK

 
      Proteins matching the same set of peptides:
      23872.1                           Mass: 144199   Score: 17     Peptides matched: 1
 CONTIG=Contig20176 POSCDS1=77262 POSCDS2=81017
23.   11118.1                           Score: 16     Peptides matched: 1
 CONTIG=Contig2500 POSCDS1=4395 POSCDS2=7787
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   453.30   904.59   904.54   0.05 1  18  2.2 2  KELFQIK

24.   6472.2                            Score: 16     Peptides matched: 1
 CONTIG=Contig10204 POSCDS1=27327 POSCDS2=30668
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   506.32   1010.63   1011.56   -0.94 0  18  2.3 6  FLESIYIK

 
      Proteins matching the same set of peptides:
      22862.1                           Score: 16     Peptides matched: 1
25.   9601.2                            Score: 15     Peptides matched: 1
 CONTIG=Contig1832 POSCDS1=2293 POSCDS2=5013
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   410.79   819.56   819.45   0.11 0  15  3.8 2  VVVNDFK

26.   28204.1                           Score: 15     Peptides matched: 2
 CONTIG=Contig10216 POSCDS1=133497 POSCDS2=137765
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 8   463.77   925.52   926.41   -0.89 0  11  10 2  NDYYQPK
 21   551.85   1101.69   1102.53   -0.85 0  6  36 4  YYPSFEVAK

 
      Proteins matching the same set of peptides:
      13214.2                           Score: 13     Peptides matched: 2
27.   447.1                             Mass: 30537    Score: 15     Peptides matched: 1
 CONTIG=Contig10262 POSCDS1=115892 POSCDS2=116695
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
57   588.30   1761.87   1762.76   -0.88 0  15  4.9 1  TSEATTTNTSANNK + 2 Hex (T)

28.   26178.1                           Score: 14     Peptides matched: 1
 CONTIG=Contig20097 POSCDS1=54361 POSCDS2=54801
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   453.30   904.59   904.48   0.11 1  14  4.8 4  QMTERIK

 
      Proteins matching the same set of peptides:
      29562.1                           Score: 14     Peptides matched: 1
29.   mSUN42                            Mass: 38365    Score: 14     Peptides matched: 1
 |predicted| C. albicans fungus|CA5232| 372 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   495.79   989.56   990.51   -0.95 0  14  5 1  DKPNYNIK

 
      Proteins matching the same set of peptides:
      10421.1                           Mass: 39984    Score: 14     Peptides matched: 1
 CONTIG=Contig10216 POSCDS1=281519 POSCDS2=282637
      22273.1                           Mass: 40504    Score: 14     Peptides matched: 1
 CONTIG=Contig20216 POSCDS1=281957 POSCDS2=283075
30.   8773.2                            Score: 14     Peptides matched: 1
 CONTIG=Contig10166 POSCDS1=47058 POSCDS2=48617
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 13   495.79   989.56   990.55   -0.99 0  14  5 1  LINNLYNK

 
      Proteins matching the same set of peptides:
      24169.1                           Score: 14     Peptides matched: 1
31.   1832.2                            Score: 14     Peptides matched: 1
 CONTIG=Contig10236 POSCDS1=37698 POSCDS2=42110
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 41   716.92   1431.82   1430.64   1.18 1  14  5.2 2  DNIKDTSDSFK + Hex (T)

 
      Proteins matching the same set of peptides:
      21292.1                           Score: 14     Peptides matched: 1
32.   6609.1                            Score: 14     Peptides matched: 1
 CONTIG=Contig10248 POSCDS1=51598 POSCDS2=53937
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 41   716.92   1431.82   1431.59   0.23 0  14  5.2 2  FYNPQDGDYDAK

 
      Proteins matching the same set of peptides:
      20545.1                           Score: 14     Peptides matched: 1
33.   10196.2                           Score: 14     Peptides matched: 2
 CONTIG=Contig10158 POSCDS1=184774 POSCDS2=189030
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   386.77   771.53   771.39   0.14 0  7  31 2  NSSSLHK
 16   505.81   1009.60   1010.57   -0.97 1  7  30 9  HMINKALGK

 
      Proteins matching the same set of peptides:
      24651.1                           Score: 14     Peptides matched: 2
34.   889.2                             Score: 13     Peptides matched: 2
 CONTIG=Contig2507 POSCDS1=12369 POSCDS2=15740
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   497.78   993.55   992.52   1.03 1  6  35 7  KDFEDVLK
 21   551.85   1101.69   1100.61   1.08 0  7  29 2  TNLILDIDGK

35.   8464.2                            Score: 13     Peptides matched: 2
 CONTIG=Contig10256 POSCDS1=35972 POSCDS2=37702
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   453.30   904.59   905.43   -0.83 0  11  11 8  ELQGMNSK
 32   424.26   1269.76   1270.70   -0.94 1  3  77 5  SIINGKNGNINK

 
      Proteins matching the same set of peptides:
      20270.1                           Score: 13     Peptides matched: 2
36.   19785.1                           Mass: 138448   Score: 13     Peptides matched: 2
 CONTIG=Contig10216 POSCDS1=39381 POSCDS2=42905
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   486.79   971.57   971.45   0.11 0  5  45 4  TIEATK + Hex (T); Hex (S)
 19   526.32   1050.63   1051.49   -0.87 0  8  25 2  MWDAIFNR

 
      Proteins matching the same set of peptides:
      22332.1                           Mass: 138907   Score: 13     Peptides matched: 2
 CONTIG=Contig20216 POSCDS1=39366 POSCDS2=42902
37.   13398.2                           Score: 13     Peptides matched: 1
 CONTIG=Contig20014 POSCDS1=39804 POSCDS2=42866
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   495.32   988.62   988.56   0.06 0  15  4.4 2  SLNSQSLIK

 
      Proteins matching the same set of peptides:
      19358.2                           Score: 13     Peptides matched: 1
38.   20170.1                           Score: 12     Peptides matched: 1
 CONTIG=Contig10053 POSCDS1=71020 POSCDS2=71511
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   495.32   988.62   989.48   -0.86 0  12  8 3  NSIASAGENK

 
      Proteins matching the same set of peptides:
      26819.1                           Score: 12     Peptides matched: 1
39.   11553.2                           Score: 12     Peptides matched: 1
 CONTIG=Contig20151 POSCDS1=45334 POSCDS2=46449
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 22   554.38   1106.75   1107.55   -0.80 1  12  7.9 2  SSSSNAKGSGVK

40.   16320.2                           Score: 12     Peptides matched: 1
 CONTIG=Contig10219 POSCDS1=14107 POSCDS2=16269
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   506.32   1010.63   1010.48   0.14 0  12  8.4 9  MTLDELK + Hex (T)

41.   14262.2                           Score: 12     Peptides matched: 1
 CONTIG=Contig10218 POSCDS1=118253 POSCDS2=121198
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   495.32   988.62   988.52   0.10 1  12  9 5  IRSEDEIK

 
      Proteins matching the same set of peptides:
      22110.1                           Score: 12     Peptides matched: 1
42.   10414.1                           Score: 12     Peptides matched: 1
 CONTIG=Contig10223 POSCDS1=18629 POSCDS2=19231
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 13   495.79   989.56   988.54   1.03 1  12  9.5 3  MKLQSGTPK

 
      Proteins matching the same set of peptides:
      17210.3                           Score: 10     Peptides matched: 1
43.   2884.1                            Mass: 65585    Score: 12     Peptides matched: 1
 CONTIG=Contig2514 POSCDS1=100484 POSCDS2=102205
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   477.30   952.58   951.43   1.15 0  12  9.3 1  SSDTSATQR

44.   2295.2                            Score: 11     Peptides matched: 1
 CONTIG=Contig2472 POSCDS1=15227 POSCDS2=17605
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 17   506.32   1010.63   1010.59   0.04 0  11  10 10  IITYVIK + Hex (T)

45.   11054.2                           Score: 11     Peptides matched: 1
 CONTIG=Contig10202 POSCDS1=186318 POSCDS2=186821
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   495.32   988.62   989.51   -0.90 0  11  10 6  SNSISQLNK

 
      Proteins matching the same set of peptides:
      23009.1                           Score: 11     Peptides matched: 1
46.   12819.3                           Score: 11     Peptides matched: 2
 CONTIG=Contig10171 POSCDS1=11468 POSCDS2=13945
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   497.78   993.55   992.50   1.05 0  8  23 5  LNGTIDAK + Hex (T)
 26   577.34   1152.67   1151.59   1.09 1  3  74 9  TRMSLSPAK + Hex (T)

 
      Proteins matching the same set of peptides:
      24092.1                           Score: 11     Peptides matched: 2
47.   1574.1                            Score: 11     Peptides matched: 1
 CONTIG=Contig10080 POSCDS1=105034 POSCDS2=109140
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   453.30   904.59   905.52   -0.93 1  13  6.9 5  FLELEKK

 
      Proteins matching the same set of peptides:
      26364.1                           Score: 11     Peptides matched: 1
48.   4068.2                            Score: 11     Peptides matched: 1
 CONTIG=Contig10141 POSCDS1=1025 POSCDS2=4381
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   453.30   904.59   903.42   1.17 0  11  11 6  EEEELQK

 
      Proteins matching the same set of peptides:
      25169.1                           Score: 11     Peptides matched: 1
49.   24948.1                           Score: 11     Peptides matched: 1
 CONTIG=Contig20147 POSCDS1=53286 POSCDS2=54260
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   497.78   993.55   993.46   0.10 0  11  13 2  FEGTEFHK

 
      Proteins matching the same set of peptides:
      24949.1                           Score: 11     Peptides matched: 1
      24956.1                           Score: 11     Peptides matched: 1
      29129.1                           Score: 11     Peptides matched: 1
50.   16861.2                           Score: 11     Peptides matched: 1
 CONTIG=Contig10155 POSCDS1=36781 POSCDS2=37440
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 12   495.32   988.62   988.58   0.04 0  11  11 7  SSILTDLIK

 
      Proteins matching the same set of peptides:
      24694.1                           Score: 11     Peptides matched: 1
Peptide matches not assigned to protein hits: (no details means no match)
List sorted by Decreasing Score. Sort by Decreasing Intensity or Increasing Query # / Mr

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
65   1232.94   3695.80   3696.55   -0.75 0  11  8.2 1  QMELDPCDEENFEELSTPIDLSQYEENFK + Hex (S)
10   486.79   971.57   972.56   -0.99 1  11  14 1  ASPTAAKVTK
2   386.77   771.53   770.49   1.04 0  11  13 1  IVELVAK
63   1124.89   3371.65   3370.71   0.94 1  10  11 1  GQILCFTQPLIGNYGVPSSTAKDQFNLLK + Hex (T)
16   505.81   1009.60   1009.48   0.12 0  8  22 1  VSTDTPTK + Hex (T)
19   526.32   1050.63   1049.54   1.09 1  8  23 1  TRLANDAK + Hex (T)
21   551.85   1101.69   1100.54   1.14 1  7  28 1  KSIGTTGK + Hex (T); Hex (S)
27   588.34   1174.67   1173.68   1.00 0  6  35 1  IVQIIYSNPK
28   603.81   1205.60   1206.64   -1.04 0  6  39 1  YETIPVPVK + Hex (T)
45   797.95   1593.89   1593.95   -0.05 1  5  48 1  KFFNISVVIVTLSK
60   683.06   2046.16   2046.10   0.06 1  5  43 1  ATTKVTTTIASQIFLK + 2 Hex (T)
51   841.40   1680.80   1679.78   1.01 1  4  59 1  IQKSHNNNNNNNNR
47   806.91   1611.80   1611.77   0.04 0  4  57 1  STGDVTCLDTLIR + Hex (T)
11   488.87   975.72   975.48   0.23 1  4  44 1  NVSRSSGNR
15   504.80   1007.58   1006.49   1.09 1  4  65 1  KIPQCFNT
32   424.26   1269.76   1270.72   -0.97 0  3  62 1  TPASISLNSLIR
62   1023.53   3067.57   3066.47   1.09 1  3  52 1  NLNDNQPRYNQTLSLIDPASTINR + Hex (T); Hex (S)
64   1178.92   3533.73   3534.68   -0.95 0  3  49 1  IIPALWCLYFLTSFGSNCYGLTLTMNR + 2 Hex (T)
24   564.83   1127.65   1128.67   -1.02 0  3  73 1  LFVGSLGPALR
66   1286.95   3857.83   3858.38   -0.55 0  2  54 1  DTTTTTTTTTTTTESTTR + Hex (T); 12 Hex (S)
25   567.80   1133.58   1132.64   0.94 1  2  95 1  LSQGIRQFGK
46   532.31   1593.90   1594.87   -0.98 0  2  93 1  LHSLWTITIPPR + Hex (T)
7   453.76   905.51   904.46   1.05 0  2  1e+002 1  THIMFTR
23   561.83   1121.65   1120.46   1.19 0  2  1e+002 1  SSSTTTNK + 2 Hex (S)
50   832.88   1663.75   1664.83   -1.08 1  1  1.2e+002 1  SGKTIFSNLEFFK + Hex (S)
58   882.97   1763.92   1763.95   -0.02 1  0  1.4e+002 1  KLESLVQFTLWPR + Hex (S)
37   664.42   1326.82         
56   881.93   1761.84         
61   1067.53   2133.05         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Hex (T),Hex (S)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Data File Name         : cw0194_q1.pkl
Number of queries      : 66

Mascot:  http://www.matrixscience.com/ 

Top scoring peptide matches to query 1
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 23.8    0.07   5                          mEcm33.3  SFSGFPK
  8.3   -0.98                                        SITPGPAK
  7.6    1.10                                        STSTPK
  7.1   -0.95                                        KDPDAPK
  5.3    0.00                                        GKPGVSPK
  3.9   -0.06                                        VSLLIPK
  3.6    0.96                                        ALNILPK
  3.4    0.07                                        SFGPFSK
  2.3    0.04                                        SVQPPNK
  1.0    0.05  19                            4544.1  SFTSISK
Top scoring peptide matches to query 2
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.5    1.04                                        IVELVAK
  6.7    0.14  33                           10196.2  NSSSLHK
  6.7    1.15                                        FTSIR
  6.7   -0.87                                        FHSNLR
  6.7    1.15                                        STVYSSK
  6.7   -0.93                                        FQLPIR
  6.7    0.05                                        RMKPIK
  6.7    1.15                                        FSTLR
  6.7    1.11                                        RMIHSK
  6.7   -0.79                                        FTSDR
Top scoring peptide matches to query 3
Score greater than 29 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 22.8    0.08   5                          mEcm33.3  VSGGFILK
 15.5    0.11  25                            9601.2  VVVNDFK
  9.4    0.15                                        VCSDVIK
  9.0    0.08                                        VSFVLQK
  7.7    0.17                                        VVCWEK
  5.7    0.24                                        DADADADK
  5.5    0.17                                        DKDSDLK
  3.9    0.19                                        VSNESER
  3.8    1.11                                        GKSSEIAK
  3.6    0.20                                        ENDDSIK
Top scoring peptide matches to query 4
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 53.1    0.08   2                             mCHT2  FADSAPNK
 30.9    1.04  12                           13836.2  AGKTADSAK
  6.5    0.01                                        KQTITMK
  5.9    1.03                                        YAAPLWK
  5.6    1.08                                        SLSDANNK
  3.9    1.03                                        QFSKPNK
  3.7    1.04                                        KEVDVMK
  3.5    0.96  15                            4195.1  IFRITAK
  3.5    1.00                                        IFQLEAK
  2.4    0.12                                        FDPNDNK
Top scoring peptide matches to query 5
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 16.1    0.09  11                            mPga31  TVYTELK
  7.6    0.14                                        AESGTIK
  7.3    0.10                                        SISGTLK
  5.7    0.10                                        VTTGSIK
  5.7    0.09                                        LSEYTIK
  5.7   -0.89                                        TTNTKK
  4.9    0.12                                        AEYLTEK
  4.7   -0.93                                        SNKHQIK
  4.2    0.11                                        FDTRTTI
  3.6    1.10                                        ITTEIK
Top scoring peptide matches to query 6
Score greater than 32 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 28.2    0.09   1                  mIPF8527|mPga29:  QIFQELK
 17.8    0.05  23                           11118.1  KELFQIK
 17.1    0.02  15                            4195.1  KLVSAFIK
 14.4    0.11  28                           26178.1  QMTERIK
 12.8   -0.93  47                            1574.1  FLELEKK
 10.8    1.14                                        EEEKLEK
 10.8    1.17  48                            4068.2  EEEELQK
 10.6   -0.83  35                            8464.2  ELQGMNSK
 10.5    0.13                                        QLQSSNTK
 10.4    0.05                                        QLEKLFK
Top scoring peptide matches to query 7
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.8    1.05                                        THIMFTR
  0.7    1.04                                        ATDVMIAGK
  0.5    1.07                                        KHSGAYDK
  0.3    0.02                                        LSPLFSSR
  0.2    0.02                                        QKIFNEK
  0.2    0.09                                        NNISSDTR
Top scoring peptide matches to query 8
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 11.3    0.09   5                          mEcm33.3  LSCSAFNK
 11.1   -0.89  26                           28204.1  NDYYQPK
  7.4   -0.86                                        NSTSAGDK
  7.1    0.02                                        LPPKNDSR
  6.4   -0.93                                        NKFYELN
  2.3    0.01                                        LSRAHSQK
  2.3    0.03                                        LSLTMAYK
  2.3   -0.04                                        ISLLLDPR
  2.3    0.08                                        LSTNMAK
  2.3    0.07                                        LSCMFIR
Top scoring peptide matches to query 9
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 11.6    1.15  43                            2884.1  SSDTSATQR
  7.3   -0.96                                        NVAELPRR
  7.3   -0.82                                        GDRGDFCK
Top scoring peptide matches to query 10
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.6   -0.99                                        ASPTAAKVTK
  5.6    0.08                                        TILTTK
  5.6    0.08                                        TILTTK
  5.4    0.10                                        TISTVR
  5.4    0.11  36                           19785.1  TIEATK
  2.2    0.08                                        TTILSK
  2.2    0.08                                        TTLSIK
  1.9    0.05                                        TTFKTVK
  1.9    0.05                                        TFKTISK
  1.7   -0.98                                        HITILTK
Top scoring peptide matches to query 11
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.0    0.23                                        NVSRSSGNR
  4.0    0.18                                        RGFGVWVR
  3.2    0.15                                        RGILTLR
Top scoring peptide matches to query 12
Score greater than 32 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 66.0    0.07   2                             mCHT2  LSSAIEEIK
 15.0    0.06  37                           13398.2  SLNSQSLIK
 12.4   -0.86  38                           20170.1  NSIASAGENK
 12.2   -0.93                                        NSSLSNLKK
 11.9    0.10  41                           14262.2  IRSEDEIK
 11.2   -0.90  45                           11054.2  SNSISQLNK
 10.8    0.04  50                           16861.2  SSILTDLIK
 10.7    0.01                                        IRLFALEK
 10.1    0.10                                        ISKEDEIR
  9.7   -0.84                                        NNECLVNK
Top scoring peptide matches to query 13
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 14.4   -0.95  29                            mSUN42  DKPNYNIK
 14.4   -0.99  30                            8773.2  LINNLYNK
 11.6    1.03  42                           10414.1  MKLQSGTPK
  9.9    0.09                                        THTNLTR
  9.9   -1.02                                        IKVGGLNYK
  9.3   -0.92                                        RSTSGNQNK
  8.0    0.10                                        ENTEEVAAK
  8.0    1.08                                        LTWDETPK
  8.0   -0.89                                        ENTEEEIK
  8.0    1.04                                        SVDVTVVDR
Top scoring peptide matches to query 14
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 51.9    0.06   2                             mCHT2  FADTLWNK
 10.8    0.10  49                           24948.1  FEGTEFHK
 10.8   -0.94                                        MSDLINFR
  8.7   -0.03                                        FIWILFR
  8.1    1.05  46                           12819.3  LNGTIDAK
  6.8    1.05                                        TGEPKTAK
  6.4    1.03  34                             889.2  KDFEDVLK
  6.0    1.12                                        MSNANQSNK
  5.2    1.01                                        TPKSTIAK
  4.7    1.03                                        GLTLNWK
Top scoring peptide matches to query 15
Score greater than 15 indicates homology
Score greater than 35 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.9    1.09                                        KIPQCFNT
  2.1    1.05                                        ESLIPSAYK
  0.2    1.07                                        EKQDAFAAK
Top scoring peptide matches to query 16
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.3    0.12                                        VSTDTPTK
  8.3    0.12                                        STDITTPK
  7.1   -0.80                                        FFSYCCK
  7.1    0.09                                        TMEVVRK
  7.1    0.04                                        NKHEELIK
  7.1    0.18                                        MTTFSK
  7.1    0.08                                        DHEKEKPK
  7.1    0.10                                        HIENLCPK
  6.9   -0.97  33                           10196.2  HMINKALGK
  6.9   -0.94                                        LPGISYSFK
Top scoring peptide matches to query 17
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 26.7    0.12  13                           21725.1  ISSLNTTK
 26.7    0.12  13                           21725.1  ISSLNTTK
 21.1    0.12  17                           15888.3  LMSGSFELK
 19.8    0.08  19                            4544.1  LSSLSTKK
 18.6   -0.91  22                           19795.1  NKFFDTIK
 17.7   -0.94  24                            6472.2  FLESIYIK
 16.8    0.03  21                           24010.1  IPGLELELK
 12.4    0.12                                        LSHSDIDPK
 12.1    0.14  40                           16320.2  MTLDELK
 11.3    0.04  44                            2295.2  IITYVIK
Top scoring peptide matches to query 18
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 65.5    0.11   4                             mPhr2  SNTDASAFVK
 10.1   -0.92                                        TTESLLTK
  9.8    1.08                                        SITNNVTK
  8.8   -0.97                                        MATVIPPPSK
  8.7    1.13                                        GLMDCLMAK
  7.7    1.06                                        SITFKAEDK
  6.8    0.05                                        ITVHNGDRK
  6.8    0.12                                        THTSRK
  6.1    1.04                                        TWLSFTRK
  5.3    1.10                                        SNTNATLR
Top scoring peptide matches to query 19
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.2    1.09                                        TRLANDAK
  7.8   -0.87  36                           19785.1  MWDAIFNR
  6.3    1.01                                        TGLYLSVLGK
  3.6    1.06                                        AFVEGMIKR
  2.2   -0.86                                        AFDVSPSDSK
  0.9    1.11                                        FGNDSQLAAK
  0.8    1.09                                        KQQQATAK
  0.8    1.06                                        QEATKLAK
  0.5    1.09                                        VTYSPVDAAK
  0.4    1.06                                        SKASTVPAK
Top scoring peptide matches to query 20
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 13.0    0.11   8                            TRBOTR  APILSDSSCK
  3.0   -0.82                                        STPTTK
  0.8    1.11                                        GGGGSGGRSTQR
  0.8   -0.90                                        GIPRTSGDK
  0.6   -0.88                                        MMSGVGGNIGR
  0.4    1.01                                        ISFGSGKKPR
  0.2    1.12                                        TPGYIYSK
  0.2    1.15                                        QSEQAEGEAK
  0.2    1.16                                        SSATGYTNK
Top scoring peptide matches to query 21
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  7.1    1.14                                        KSIGTTGK
  7.0    1.14                                        KSIGTTGK
  7.0    1.08  34                             889.2  TNLILDIDGK
  6.0   -0.83  12                           13836.2  TGVDHLDAK
  6.0   -0.85  26                           28204.1  YYPSFEVAK
  6.0   -0.87                                        EEARATIDAK
  6.0    1.11                                        NTAKLHAAK
  5.3   -0.86                                        CGLDLNINGK
  4.1   -0.92                                        SIQRSTNVAK
  4.0    1.11                                        QSIVTVHR
Top scoring peptide matches to query 22
Score greater than 26 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 25.0    0.12   1                  mIPF8527|mPga29:  TISSIQLFAK
 12.3   -0.80  39                           11553.2  SSSSNAKGSGVK
 12.3    0.14                                        TSIERIIK
  9.1    0.15                                        DTLEKIIK
  8.3    0.16                                        TGASNRLLK
  6.3    0.18                                        TSLSVVPEK
  6.0   -0.80                                        YSINQLDGAK
  5.1   -0.80                                        SQTTTRPR
  4.6    1.17                                        NITQELLK
  4.3    0.17                                        TAREELLK
Top scoring peptide matches to query 23
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.8    1.19                                        SSSTTTNK
  1.7    1.04                                        GTRIIATNK
  1.6    0.07                                        LQRSSSTTSR
  1.3    0.10                                        FFNNLQPDK
  1.1    0.17                                        SSSTTTSK
  1.0    0.11                                        ASSGNQKSTSR
  1.0    0.07                                        ISKPTATDK
  0.8    1.12                                        YLTSFTNK
  0.8    1.09                                        FSQHLFTNK
  0.5    1.03                                        LFPGKTFPSK
Top scoring peptide matches to query 24
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.0   -1.02                                        LFVGSLGPALR
  1.2    0.10                                        ISPSPSSPDNK
  1.1   -0.88                                        DWFSFATQK
  0.5   -0.96                                        HTIILENK
  0.5   -1.04                                        EIGIISLKTR
  0.3    0.06                                        HSYPEIRAR
  0.3    0.99                                        VIIVGGDDLVK
Top scoring peptide matches to query 25
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.1    0.94                                        LSQGIRQFGK
  0.1   -0.03                                        ATAIGKSSNSAK
Top scoring peptide matches to query 26
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 56.9    0.11   8                            TRBOTR  SSGTSYPDVLK
  8.8    0.08                                        IIYCTGITGR
  8.0    1.13                                        SIMSGMVWNK
  8.0    1.16                                        SMLSEESNQK
  7.6    0.05                                        SSPLKSYIMK
  5.6    0.21                                        TEMETDNGEK
  5.2    0.11                                        SGKENSTLR
  4.4    0.11                                        AKDSSTLQR
  2.9    1.09  46                           12819.3  TRMSLSPAK
  2.6    1.08                                        QTETISALK
Top scoring peptide matches to query 27
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  6.3    1.00                                        IVQIIYSNPK
  5.8   -0.88                                        QSSGGHLEAYK
  5.5    0.06                                        GTAEHHPVSIK
  5.5    0.13                                        FPNPDTHGYK
  5.5    1.18                                        EVEEEYTK
  5.5    0.15                                        DSRTATTK
  5.5    0.15                                        DSRTATTK
  5.5    0.15                                        DSRTATTK
  5.5    0.95                                        LMLLMLLLSK
  5.5    1.03                                        IMLNSGITPTK
Top scoring peptide matches to query 28
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.9   -1.04                                        YETIPVPVK
  5.9   -0.95                                        MASTVQHASK
  5.0   -0.11                                        IPKLLQHETK
Top scoring peptide matches to query 29
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 22.6    0.04  14                            7514.2  NLNDPRTELR
 22.6    0.12  11                            mPga31  NINDPYNYSK
  3.6   -0.86                                        NIDDPYNYSK
  2.6   -1.02                                        DLPTVPLVVK
  1.2    0.06                                        NLNICFYRK
  1.1    1.03                                        LLVETITK
  1.0   -0.84                                        NNNNTSSSTK
  1.0   -0.84                                        NNNNTSSSTK
  0.9   -0.86                                        NNNTIFSDR
  0.7   -0.87                                        NNNTTINK
Top scoring peptide matches to query 30
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  7.0    0.12   1                  mIPF8527|mPga29:  TDDSAPITIVAK
  4.5    0.09                                        IDDQILTTAIK
  3.4    1.19                                        TNNNNNNSIPK
  0.9    0.25                                        GATSCSSSGLR
  0.6   -0.77                                        GCAMALHGMGAR
  0.1   -0.87                                        KESTPTPATATK
Top scoring peptide matches to query 31
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 38.3    0.12  10                            mPga10  IYDQLPECAK
  4.2    0.07                                        IDYQSIQIEK
  1.5   -0.03                                        HRLLTEIINK
  1.4   -0.90                                        DYPKIEVDMK
  1.2   -0.98                                        FIKNTIYPNK
  0.3    1.15                                        NGTVTMLDDNR
  0.2   -0.96                                        NKLTFIPTR
  0.1    0.98                                        YLTLKIVETR
Top scoring peptide matches to query 32
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.5   -0.97                                        TPASISLNSLIR
  3.4    1.01                                        ITQEPIVSRVK
  3.2    0.02                                        QVQAGVLSSLLR
  2.6    0.11                                        ISEYFEEIIK
  2.5   -0.94  35                            8464.2  SIINGKNGNINK
  1.5    0.09                                        TVATTTTTAKK
  1.5    0.09                                        TVATTTTTAKK
  1.5    0.09                                        TVATTTTTAKK
  1.5    0.09                                        TVATTTTTAKK
  1.0    1.14                                        NREPAEQPNSK
Top scoring peptide matches to query 33
Score greater than 26 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 58.4    0.13   9                            mPga24  VITVVACDEHK
  9.6    0.09                                        VLQNNARQEAK
  8.1    0.05                                        VITPSISDLTPK
  7.7    0.04                                        IVLSQVNEIQK
  6.1   -0.00                                        LISVEKLNNLK
  4.1    0.10                                        IAEGIWPDEIK
  0.6    0.08                                        IVRLYDTTK
  0.6    0.08                                        IVRLYDTTK
  0.1   -0.97                                        LIAAGSLDRTVR
Top scoring peptide matches to query 34
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 58.7    0.13   1                  mIPF8527|mPga29:  YSESEYAVSNK
  1.6   -0.96                                        MSEVASAKGELR
  0.7    0.08                                        YEYLFNVNSK
  0.5    1.13                                        TETDSTLAK
  0.4    0.02                                        RIITPDTNGK
Top scoring peptide matches to query 35
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 42.1    0.14   4                             mPhr2  EDLPAIEIVGNK
  8.8    1.09                                        DLKPQNLLIDK
  3.4   -0.90                                        GIGEDRSKPIVK
  1.1    0.20                                        VEEHESVNNLK
  0.9    0.13                                        VQLSGNPILGDGK
  0.7    1.01                                        IILPAMTLAILK
Top scoring peptide matches to query 36
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 28.3    0.14   5                          mEcm33.3  NDDLTELDFPK
  5.6    1.12                                        DNLNYQFVHR
  2.4   -0.83                                        TLESEEDEDLK
  2.2   -0.83                                        IETDTSGNSNNR
  0.6   -0.90                                        SPPTSWLLMK
  0.2    0.01                                        AAAYKGSVTILGR
Top scoring peptide matches to query 37
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 38
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
108.4    0.13   1                  mIPF8527|mPga29:  KTDDSAPITIVAK
 17.7    0.18  20                             477.1  SQTIKAPSFDHK
 10.2    0.29                                        QTSTHYTPK
  6.1    0.13                                        KTGALLSPDTVEK
  5.0   -0.89                                        FLGNFKIPPQAK
  4.8   -0.78                                        FTPITAESFAK
  4.3    0.20                                        QTLHNDGIFWK
  3.5    0.19                                        KPVDAAMIAEDAK
  3.4    0.20                                        TQSQTKLTK
  3.3    0.09                                        LLQRTESATVLK
Top scoring peptide matches to query 39
Score greater than 29 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
116.1    0.14   6                        mSod5/Pga3  AATPAAHEVGDLAGK
  9.5    0.17                                        QGETEEALIQK
  4.1    0.16                                        WDELTNIIQK
  3.8    0.10                                        KADTITIELQK
  3.8    0.20                                        STQYCFRLGK
  2.9    0.24                                        DKQNTTTK
  1.4    0.07                                        GINGPHLVITPK
  1.1    0.19                                        SDSQSDIRSSTPK
  1.1    1.12                                        AESMKIFPDLQK
  1.1    0.27                                        DGWFNDSNTSHK
Top scoring peptide matches to query 40
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 44.7    0.14   7                        mALS1.5eoc  STVDPSGYLYASR
  5.1    0.01                                        IAMLLFNIPDIR
  4.7    0.04                                        LRTDLLETADIR
  2.9    0.09                                        TSLTYNLARTK
  2.9    0.18                                        STTMQDSFDQKK
  0.6   -0.90                                        TSTNPNSLSPRSR
  0.5    1.08                                        KMADLPMEPALAK
  0.1   -0.82                                        TTSNPTTRSR
Top scoring peptide matches to query 41
Score greater than 28 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 19.2   -0.82  16                           10842.2  QGIDSSTSAFMK
 14.3    1.18  31                            1832.2  DNIKDTSDSFK
 14.3    0.23  32                            6609.1  FYNPQDGDYDAK
  9.0    0.08                                        IFTKWGIMFK
  9.0   -0.84                                        ELGADFTLDYK
  9.0    0.14                                        YTTEAIKSNYDK
  9.0   -0.90                                        FGHTPKFTHSFK
  9.0   -0.89                                        LYEYVDLLYDK
  9.0   -0.91                                        VCFLILTMFK
  9.0    0.10                                        STNNEPAAKPKK
Top scoring peptide matches to query 42
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 18.8    0.16  18                            9023.3  GITYSPYSDNGGCK
  2.2   -1.05                                        IGTLENLKQTIK
Top scoring peptide matches to query 43
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 56.9    0.16   4                             mPhr2  SIPVGYSANDDSAIR
  3.3    1.17                                        TSVAIASTTSTTK
  2.2    1.17                                        QLYSHRYYGTK
Top scoring peptide matches to query 44
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 52.8    0.16   5                          mEcm33.3  TIGGALQISDNSELR
  5.4    0.23                                        WVNLEEVDLDEGR
  2.8    1.00                                        SITKVQYIPIVAIK
  1.1   -0.89                                        INEREIWFNILK
  0.7    0.09                                        MINGKPLYVALAQR
  0.3    0.23                                        TTTATATATAPTR
  0.3    0.23                                        TTTATATATAPTR
Top scoring peptide matches to query 45
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.7   -0.05                                        KFFNISVVIVTLSK
  4.7    0.97                                        AFQLVSVIQGKLYK
Top scoring peptide matches to query 46
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.8   -0.98                                        LHSLWTITIPPR
  1.1   -1.02                                        NSPLKDLPMLQVLK
  0.9    0.02                                        AALNHLILSLASDEK
  0.8   -0.82                                        AIESSDNNEGGEFVK
  0.4   -0.90                                        LAESFNAWDTSKVK
  0.4    0.12                                        PSSERDTLLAESK
  0.4    1.15                                        STTDLNFFHPPR
  0.4    1.15                                        STTDLNFFHPPR
  0.2    0.03                                        PSETLEPPKQVEIK
  0.2   -0.00                                        PSLDDILKPVAEAVK
Top scoring peptide matches to query 47
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.1    0.04                                        STGDVTCLDTLIR
  1.2   -0.08                                        LSSLLNLTHVPTR
  1.2   -0.08                                        LSSLLNLTHVPTR
  0.8    0.96                                        FVAGDTLYNIQRSK
  0.7   -0.07                                        SLAEILGIVTNPEEK
  0.5    1.00                                        DGNIIHWDLSNISK
  0.5   -0.91                                        AQDSIYTESFYK
  0.5   -1.11                                        NVITGQIMQNIVKR
  0.5   -1.02                                        LDSVYFPNYLVQR
  0.5    0.04                                        STGDVTCLDTLIR
Top scoring peptide matches to query 48
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 37.3    0.13   3                             mSSR1  CSGLNDLSCICTTK
  1.8    1.07  10                            mPga10  AANAASATTSAETATK
Top scoring peptide matches to query 49
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
116.3    1.15   3                             mSSR1  CSGLNDLSCICTTK
  4.9    1.03                                        ILYTTELEIGSNK
  4.3    1.03                                        ILYTTELEIGSNK
  4.0   -0.92                                        ERTFNNPTTIK
  3.0    1.15                                        MSTTTTRSGTK
  3.0    1.15                                        MSTTTTRSGTK
  1.7    1.07                                        ESYGIPPTLTAR
  1.0   -0.94                                        TMNQVFKTLADSK
  0.9    1.03                                        GSITSGLASKTETSK
  0.7    0.09                                        KMTTPNNILCK
Top scoring peptide matches to query 50
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.8   -1.08                                        SGKTIFSNLEFFK
Top scoring peptide matches to query 51
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.1    1.01                                        IQKSHNNNNNNNNR
  3.4    0.96                                        TGITIDVDHTPPPR
  1.7    0.94                                        AIRDQFVTPTWAK
  1.7    0.94                                        AIRDQFVTPTWAK
  1.0   -0.06                                        TSTNLEGTFPLIAR
  1.0    1.00                                        TGVSDGTIKTSYK
  0.4    0.96                                        TGITIDVDHTPPPR
Top scoring peptide matches to query 52
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 48.8    0.16   7                        mALS1.5eoc  YTTSQTSVDLTADGVK
Top scoring peptide matches to query 53
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 45.0    0.16   1                  mIPF8527|mPga29:  DGTLSFTGDDKVYASK
Top scoring peptide matches to query 54
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 21.5    0.17   1                  mIPF8527|mPga29:  DGTLSFTGDDKVYASK
  7.6    0.12                                        LTYDTQTATSLITK
  7.6    0.12                                        LTYDTQTATSLITK
  3.5    0.18                                        NPMMTWVSVYSIK
  2.7    0.08                                        TIVCLQHQLSTKK
  1.4    0.10                                        TLTQTLRLTGK
  1.4   -0.92                                        VLLRNTSSEEIAPK
  1.2    0.12                                        LTYDTQTATSLITK
  1.2    1.15                                        WKDYQLVTWSSK
  1.0    0.05                                        KTPVNASADPAPPITPK
Top scoring peptide matches to query 55
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 72.7    0.16   3                             mSSR1  EICPNGDADTAISAFK
  5.0   -0.91                                        KNEESLANGLLCFSK
  3.3   -0.90                                        LERLAMDQTSQQK
  3.3   -0.95                                        LENSGFLQSKTLPK
  1.5   -0.87                                        SITTTTTTTTTEK
  0.8   -0.83                                        KDFPTTGYTEVR
  0.8   -0.97                                        ESVSVAFETLSRSLGK
Top scoring peptide matches to query 56
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 57
Score greater than 14 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 14.8   -0.88  27                             447.1  TSEATTTNTSANNK
  7.6   -0.88  27                             447.1  TSEATTTNTSANNK
  7.6   -0.88  27                             447.1  TSEATTTNTSANNK
  1.6   -0.88  27                             447.1  TSEATTTNTSANNK
  1.6   -0.88  27                             447.1  TSEATTTNTSANNK
  1.6   -0.88  27                             447.1  TSEATTTNTSANNK
  0.6    0.90                                        KMLAATEELTIIVSSR
  0.1    1.01                                        HGQYLGWSGFTGVGAPK
  0.1    0.98                                        LQCEICQSKNGALIK
  0.0    0.89                                        QLMALGEFLIEITKR
Top scoring peptide matches to query 58
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.3   -0.02                                        KLESLVQFTLWPR
Top scoring peptide matches to query 59
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 22.0    0.18   2                             mCHT2  LFVGVPATSNIAGYVDTSK
  4.6    0.16                                        NISISYLQMGLFIPTNK
  3.6    0.07                                        FLIQSVTFLGSAKVSTIK
  3.2    1.20                                        LALAEQGLNSELYFQNK
  2.9   -0.71                                        FRIFGGGTHQCDLNR
  2.8    0.16                                        TLPNLSAEQICPVQAGIK
  2.5   -0.75                                        EWTNNGLIVAYQNQK
  2.5   -0.74                                        TTATLITTQITR
  2.4    0.17                                        LHDSAQSELSNLKQQLK
  2.3    0.22  16                           10842.2  LSNVGTGSFDVFAQMPRL
Top scoring peptide matches to query 60
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.5    0.06                                        ATTKVTTTIASQIFLK
  3.2    1.03                                        DLVYVLGLGIYLTGFLK
  2.1    1.18                                        NTFTLIDGESRDSTITK
  2.1    1.18                                        NTFTLIDGESRDSTITK
  1.9    0.14                                        DSSSSLLLLPTPPTSLGVD
  1.7    1.10                                        DLCNSSLNDQKSLLLLGR
  1.6   -0.90                                        ITTNPPPSTVSIVLANK
  1.4   -0.90                                        ITTNPPPSTVSIVLANK
  1.3   -0.79                                        SSSSNVDTRTSLTTTNSK
  1.3   -0.79                                        SSSSNVDTRTSLTTTNSK
Top scoring peptide matches to query 61
Score greater than 34 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 62
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.3    1.09                                        NLNDNQPRYNQTLSLIDPASTINR
  2.9   -0.90                                        QSSTLQNQNYVAHLPTTVVMMSVPK
  2.9   -0.90                                        QSSTLQNQNYVAHLPTTVVMMSVPK
  2.3    1.02                                        APPTAVESSINFGGHPTIKSTQDPLVQK
  2.2   -0.91                                        NTLGNRDNVIIFSVVFNATNHNASR
  2.1    1.02                                        APPTAVESSINFGGHPTIKSTQDPLVQK
  1.5    1.15                                        STTSASITTSSATTIFLSTSTTWSR
  1.5    1.15                                        STTSASITTSSATTIFLSTSTTWSR
  1.3    1.15                                        STTSASITTSSATTIFLSTSTTWSR
  1.3    1.15                                        STTSASITTSSATTIFLSTSTTWSR
Top scoring peptide matches to query 63
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  9.9    0.94                                        GQILCFTQPLIGNYGVPSSTAKDQFNLLK
  6.0   -1.00                                        FLSYDLSIIDWNTLYPCLTKPLTK
  6.0   -1.00                                        FLSYDLSIIDWNTLYPCLTKPLTK
  4.0   -0.89                                        LEASSCSSNSSESSTSDLIESFPPLETTVSPK
  3.9    1.13                                        DTVHTNVPSPRPSTNSHTSSTYIPR
  3.2   -0.07                                        QQTIGDQIKILISSNPLNIEEYSSHLNR
  3.1   -0.98                                        GIYAGIRPAMLSVSSTTGLMFWSYELAR
  3.0    1.13                                        TEEGRSSFLTLDFWNINTSTNHTTK
  3.0    1.13                                        TEEGRSSFLTLDFWNINTSTNHTTK
  2.9    0.02                                        DDFKTITTTSPNGTTITTLVPTDQAMNQAK
Top scoring peptide matches to query 64
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.2   -0.95                                        IIPALWCLYFLTSFGSNCYGLTLTMNR
  3.2   -0.95                                        IIPALWCLYFLTSFGSNCYGLTLTMNR
  1.5    1.13                                        CYPAGVTTNSKYGVDPNDFSSFYPLFEAMQK
  0.7   -0.96                                        LIPYSSSVNHSTDYLTSTVMGRVQDILDK
  0.7   -0.96                                        LIPYSSSVNHSTDYLTSTVMGRVQDILDK
  0.7   -0.96                                        LIPYSSSVNHSTDYLTSTVMGRVQDILDK
  0.3   -0.95                                        IIPALWCLYFLTSFGSNCYGLTLTMNR
  0.3   -1.16                                        WHIVLCLEKIISHGHTVTISFLHQIIHR
  0.3   -1.16                                        WHIVLCLEKIISHGHTVTISFLHQIIHR
  0.2   -0.81                                        IDPTTTTTTSTVSTTDIPITSK
Top scoring peptide matches to query 65
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.6   -0.75                                        QMELDPCDEENFEELSTPIDLSQYEENFK
 10.6   -0.93                                        VYDPDFHLTANNHLNPNATTFDPVELKYR
 10.6   -0.97                                        STSTKLTPWLITIALQTFQEFHPNR
 10.6   -0.97                                        STSTKLTPWLITIALQTFQEFHPNR
 10.6   -0.97                                        STSTKLTPWLITIALQTFQEFHPNR
 10.6    0.06                                        AATGFLQNDSATSSSSIPNMQVSSSRPKLTR
 10.6    0.05                                        NMXALSFFYTGGICVSLVCMFILGLVETSR
 10.6    0.05                                        NMXALSFFYTGGICVSLVCMFILGLVETSR
  9.3    0.06                                        AATGFLQNDSATSSSSIPNMQVSSSRPKLTR
  8.8    0.05                                        YGVSITDACIGWETTEEVLEVLANAVKTR
Top scoring peptide matches to query 66
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  2.2   -0.55                                        DTTTTTTTTTTTTESTTR
  2.2   -0.55                                        DTTTTTTTTTTTTESTTR
  2.2   -0.55                                        DTTTTTTTTTTTTESTTR
  2.2   -0.55                                        DTTTTTTTTTTTTESTTR
  2.2   -0.55                                        DTTTTTTTTTTTTESTTR
  2.2   -0.55                                        DTTTTTTTTTTTTESTTR
  2.2   -1.01                                        RVYGSYHNYAMYLLTFGTGIAGYGIYQIETK
  2.2   -1.01                                        RVYGSYHNYAMYLLTFGTGIAGYGIYQIETK