Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0150_q7.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 16 Nov 2006 at 09:43:41 GMT
Significant hits: mSod5/Pga3  |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
                  mSSR1       |Candida albicans 212 aa - Secretory Stress Response
                  15363.2     |Pir1| CONTIG=Contig20045 POSCDS1=52307 POSCDS2=53464
                  mCrh11      |predicted| C. albicans |CA0375|: 453 aa
                  mCHT2       583 aa - chitinase 2 precursor Candida albicans
                  9023.3      |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
                  mALS1.5eoc  |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  mPga4       |predicted| mIPF8796 C. albicans CA4800| 451 aa
                  19516.2     |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
                  mPga24      |predicted| mIPF5185 C. albicans |CA1678| 533 aa
                  mPhr2       |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
                  mEcm33.3    |predicted|m5366.2|CaECM33
                  mUTR2       |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 31 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mSod5/Pga3                        Mass: 22006    Score: 191    Queries matched: 3
 |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
35   568.34   1134.67   1134.51   0.16 0  85  2.1e-007 1  K.HGNIMGESYK.T
58   704.46   1406.90   1406.72   0.18 0  106  2.2e-009 1  R.AATPAAHEVGDLAGK.H
59   469.99   1406.94   1406.72   0.23 0  (102) 5.9e-009 1  R.AATPAAHEVGDLAGK.H

 
      Proteins matching the same set of peptides:
      1222.2                            Mass: 23689    Score: 191    Queries matched: 3
 |Pga3/Sod5| CONTIG=Contig10139 POSCDS1=124618 POSCDS2=125304
      25296.1                           Mass: 26345    Score: 191    Queries matched: 3
 CONTIG=Contig20139 POSCDS1=124373 POSCDS2=125059

2.    mSSR1                             Mass: 20690    Score: 158    Queries matched: 2
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
81   814.96   1627.90   1627.70   0.20 0  126  1.4e-011 1  K.CSGLNDLSCICTTK.N
87   855.50   1708.99   1708.76   0.23 0  33  0.032 1  K.EICPNGDADTAISAFK.S + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      3054.1                            Mass: 22993    Score: 158    Queries matched: 2
 |Ssr1| CONTIG=Contig10262 POSCDS1=71490 POSCDS2=72194
3.    15363.2                           Mass: 40824    Score: 147    Queries matched: 1
 |Pir1| CONTIG=Contig20045 POSCDS1=52307 POSCDS2=53464
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
107   664.07   1989.18   1988.93   0.25 0  148  1.2e-013 1  K.ACSSANNLEMTLHDSVLK.D

 
      Proteins matching the same set of peptides:
      m15363.2                          Mass: 38940    Score: 147    Queries matched: 1
 |mPir1| 367 aa Candida albicans
      19968.1                           Mass: 36680    Score: 147    Queries matched: 1
 |Pir1| CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
      m19968.1                          Mass: 34796    Score: 147    Queries matched: 1
 |mPir1| 328 aa CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
4.    mCrh11                            Mass: 44667    Score: 121    Queries matched: 3
 |predicted| C. albicans |CA0375|: 453 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
19   505.83   1009.65   1009.50   0.15 1  12  3.5 1  K.RFDNPSFK.S
38   592.89   1183.77   1183.60   0.17 0  25  0.21 1  R.GGYHDIANPLK.D
96   883.00   1763.99   1763.76   0.22 0  85  2e-007 1  K.QYSYSDQSGSWESIK.A

 
      Proteins matching the same set of peptides:
      14360.2                           Mass: 46818    Score: 121    Queries matched: 3
 |Crh11| CONTIG=Contig10158 POSCDS1=92919 POSCDS2=94280
      24611.1                           Mass: 47890    Score: 121    Queries matched: 3
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
5.    mCHT2                             Mass: 59565    Score: 84     Queries matched: 2
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   495.36   988.70   988.54   0.15 0  48  0.0014 1  K.LSSAIEEIK.C
16   497.83   993.64   993.49   0.15 0  36  0.015 1  K.FADTLWNK.F

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 84     Queries matched: 2
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
      19719.2                           Mass: 51350    Score: 84     Queries matched: 2
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
6.    9023.3                            Mass: 33980    Score: 76     Queries matched: 1
 |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
36   573.90   1145.79   1145.60   0.18 0  76  2.6e-006 1  K.SNQQAAISSIK.S

 
      Proteins matching the same set of peptides:
      15898.1                           Mass: 39582    Score: 76     Queries matched: 1
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
      m15898.1|mSCW1:                   Mass: 35901    Score: 76     Queries matched: 1
 346 aa - glucanase (by homology) Candida albicans
7.    mALS1.5eoc                        Mass: 69052    Score: 72     Queries matched: 1
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
61   708.44   1414.87   1414.67   0.20 0  72  4.3e-006 1  K.STVDPSGYLYASR.V

 
      Proteins matching the same set of peptides:
      13002.2                           Mass: 133694   Score: 72     Queries matched: 1
 |Als1| CONTIG=Contig10233 POSCDS1=72223 POSCDS2=76005
      21498.1                           Mass: 133402   Score: 72     Queries matched: 1
 |Als1| CONTIG=Contig20233 POSCDS1=71475 POSCDS2=75257
8.    mPga4                             Mass: 47426    Score: 53     Queries matched: 3
 |predicted| mIPF8796 C. albicans CA4800| 451 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 18   504.32   1006.63   1006.47   0.16 0  0  68 2  K.NPSGDGGYLK.S
50   677.46   1352.90   1352.71   0.19 0  18  1.5 1  K.YFQELGINTIR.V
99   916.01   1830.01   1829.77   0.24 0  38  0.01 1  R.LPSGLYFNCGDDDMAR.I

 
      Proteins matching the same set of peptides:
      8796.1                            Mass: 49422    Score: 53     Queries matched: 3
 |Pga4| CONTIG=Contig10194 POSCDS1=248535 POSCDS2=249890
      23247.1                           Mass: 53324    Score: 53     Queries matched: 3
 CONTIG=Contig20194 POSCDS1=251401 POSCDS2=252756
9.    19516.2                           Mass: 94340    Score: 47     Queries matched: 2
 |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
25   521.85   1041.68   1041.52   0.16 0  31  0.05 1  R.HQDFVPATK.I
31   557.87   1113.72   1113.56   0.17 0  16  1.8 1  R.GGIQGFHGDVK.V

 
      Proteins matching the same set of peptides:
      mIPF19516                         Mass: 90303    Score: 47     Queries matched: 2
 |mHYR1| validated by us| C. albicans fungus|CA1576| 900 aa
      19734.1                           Mass: 94169    Score: 47     Queries matched: 2
 |Hyr1| CONTIG=Contig20216 POSCDS1=152490 POSCDS2=155303
      m19734.1                          Mass: 91992    Score: 47     Queries matched: 2
 |mHyr1| validated by us| C. albicans fungus 917 aa
10.   mPga24                            Mass: 52805    Score: 46     Queries matched: 2
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   635.91   1269.81   1269.64   0.17 0  46  0.0018 1  K.VITVVACDEHK.C
43   424.28   1269.83   1269.64   0.19 0  (31) 0.059 1  K.VITVVACDEHK.C

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 46     Queries matched: 2
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 46     Queries matched: 2
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
11.   mPhr2                             Mass: 57243    Score: 46     Queries matched: 1
 |validated by us| C albicans |CA3867| 544 aa pH-regulated protein 2
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   520.33   1038.65   1038.50   0.15 0  46  0.0015 1  K.SNTDASAFVK.A

 
      Proteins matching the same set of peptides:
      4604.2                            Mass: 59477    Score: 46     Queries matched: 1
 |Phr2| CONTIG=Contig20237 POSCDS1=156145 POSCDS2=157779
      14612.3                           Mass: 67274    Score: 46     Queries matched: 1
 CONTIG=Contig10237 POSCDS1=160121 POSCDS2=161755
      mPhr1                             Mass: 58075    Score: 45     Queries matched: 1
 |experimentally validated by us| C albicans |CA4857| 548 aa
      15932.2                           Mass: 60276    Score: 45     Queries matched: 1
 |Phr1| CONTIG=Contig10192 POSCDS1=117957 POSCDS2=119603
      23455.1                           Mass: 60747    Score: 45     Queries matched: 1
 CONTIG=Contig20192 POSCDS1=117993 POSCDS2=119639
12.   mEcm33.3                          Mass: 41984    Score: 37     Queries matched: 1
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   463.81   925.60   925.43   0.17 0  37  0.011 1  K.LSCSAFNK.L

 
      Proteins matching the same set of peptides:
      5366.2                            Mass: 43798    Score: 37     Queries matched: 1
 |Ecm33.3| CaECM33 CONTIG=Contig10163 POSCDS1=164904 POSCDS2=166142
      24311.1                           Mass: 42880    Score: 37     Queries matched: 1
 CONTIG=Contig20163 POSCDS1=164513 POSCDS2=165751
13.   mUTR2                             Mass: 49676    Score: 36     Queries matched: 1
 |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
33   563.85   1125.68   1125.51   0.17 0  36  0.014 1  R.YDYPQTPSR.I

 
      Proteins matching the same set of peptides:
      8080.2                            Mass: 52187    Score: 36     Queries matched: 1
 |Utr2| CONTIG=Contig20123 POSCDS1=148155 POSCDS2=149567
      29345.1                           Mass: 54908    Score: 36     Queries matched: 1
 CONTIG=Contig10123 POSCDS1=148333 POSCDS2=149745
14.   mALS3.5eoc                        Mass: 94266    Score: 25     Queries matched: 1
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
39   610.91   1219.81   1219.66   0.15 1  25  0.3 1  K.KISINVDFER.S

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 25     Queries matched: 1
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 25     Queries matched: 1
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928
15.   10558.1                           Mass: 6342     Score: 21     Queries matched: 1
 CONTIG=Contig10212 POSCDS1=241895 POSCDS2=242053
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   409.30   816.59   816.44   0.15 0  21  0.67 1  -.MIEPSLK.A

 
      Proteins matching the same set of peptides:
      22579.1                           Mass: 6584     Score: 21     Queries matched: 1
 CONTIG=Contig20212 POSCDS1=246597 POSCDS2=246755
16.   20170.1                           Score: 20     Queries matched: 1
 CONTIG=Contig10053 POSCDS1=71020 POSCDS2=71511
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 15   495.36   988.70   989.48   -0.78 0  20  1 2  K.NSIASAGENK.L

 
      Proteins matching the same set of peptides:
      26819.1                           Score: 20     Queries matched: 1
17.   5739.1                            Score: 19     Queries matched: 1
 CONTIG=Contig20173 POSCDS1=59958 POSCDS2=61484
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 15   495.36   988.70   988.51   0.19 0  19  1.1 3  K.SLSSPEQIK.E + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      28804.1                           Score: 19     Queries matched: 1
18.   8527.1                            Mass: 21461    Score: 15     Queries matched: 1
 |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
54   453.66   1357.95   1357.75   0.20 1  15  3.7 1  K.KTDDSAPITIVAK.F

 
      Proteins matching the same set of peptides:
      mIPF8527|mPga29:                  Mass: 19928    Score: 15     Queries matched: 1
 189 aa - Candida albicans unknown function
      21875.1                           Mass: 22824    Score: 15     Queries matched: 1
 CONTIG=Contig20225 POSCDS1=30286 POSCDS2=30900
19.   14783.2                           Score: 14     Queries matched: 1
 CONTIG=Contig10119 POSCDS1=247589 POSCDS2=249247
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 36   573.90   1145.79   1145.61   0.18 0  15  2.8 2  R.NGPSMILSSIK.L

 
      Proteins matching the same set of peptides:
      25769.1                           Score: 14     Queries matched: 1
20.   714.1                             Score: 14     Queries matched: 1
 CONTIG=Contig10225 POSCDS1=137903 POSCDS2=139516
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 39   610.91   1219.81   1220.58   -0.77 0  14  3.9 2  K.QNSIDVNEFR.L

 
      Proteins matching the same set of peptides:
      21843.1                           Score: 14     Queries matched: 1
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
114   1067.58   2133.15   2132.99   0.16 1  13  2.9 1  VQQLQMSADQHGDSLKTTK + 3 Deamidation (NQ); Oxidation (M)
32   560.88   1119.75   1119.50   0.25 0  13  4.7 1  STSPELNSQR + 2 Deamidation (NQ)
22   513.84   1025.67   1025.57   0.10 0  13  3.2 1  YPAIAIHGGK
47   659.90   1317.78   1317.64   0.14 0  12  4.3 1  QTQQSIVDQIR + 3 Deamidation (NQ)
11   435.79   869.56   869.54   0.01 1  11  3 1  RELLLAR
28   547.35   1092.69   1092.58   0.11 1  11  5.2 1  KFADIGNTVK + Deamidation (NQ)
64   716.95   1431.89   1431.72   0.16 0  11  6.4 1  QSPVSSTGVDVSIR + Deamidation (NQ)
40   612.39   1222.77   1222.60   0.16 1  10  7.8 1  KMACLLQSEK + Oxidation (M)
143   1336.74   2671.47   2671.12   0.35 0  9  7.8 1  AFLNYLSLQSEETDNSDNYTESK + 4 Deamidation (NQ)
125   1150.67   2299.33   2299.04   0.29 0  9  8.3 1  GDGQQSQSQSQLPSQQQSQPR + Deamidation (NQ)
128   1169.83   2337.65   2338.16   -0.51 1  9  12 1  MWDAIFNRVVTDESVTALQK + Oxidation (M)
152   1029.25   3084.71   3084.34   0.38 1  9  7.2 1  NGQGQLYDDFLEIYNFQTDTKSNEDK + 3 Deamidation (NQ)
146   927.81   2780.40   2780.37   0.03 1  9  5.7 1  RELYSMFQICLNYNIIVMIMVK + 3 Deamidation (NQ)
132   1193.66   2385.31   2386.04   -0.73 1  9  7.7 1  ILNRQYELNYNYNYNNMK + 4 Deamidation (NQ); Oxidation (M)
48   664.89   1327.77   1327.78   -0.01 0  9  7.5 1  VSPVMESILIIK
57   697.92   1393.83   1393.65   0.17 0  9  8.8 1  MITSTNSWPVNK + Deamidation (NQ); Oxidation (M)
53   679.98   1357.94   1358.71   -0.77 0  9  15 1  EVIEVTGWDLAK
75   774.99   1547.96   1547.87   0.09 1  8  13 1  STLAKFVAWINGLK + Deamidation (NQ)
86   855.01   1708.01   1707.78   0.23 0  8  12 1  MTNWGVIQDGSELNK + Deamidation (NQ); Oxidation (M)
92   869.53   1737.04   1737.68   -0.64 1  8  13 1  EDDKQSTVDNNNNDK + 3 Deamidation (NQ)
111   1047.63   2093.25   2094.01   -0.76 1  7  15 1  MNYYYSLLNTNIDGRIK + Deamidation (NQ); Oxidation (M)
100   931.51   1861.01   1860.93   0.08 0  7  11 1  GSNYLLNQGDEIAVGVGR
13   467.31   932.61   932.46   0.15 1  6  16 1  STEPRSQK + Deamidation (NQ)
83   845.50   1688.99   1689.77   -0.77 0  6  17 1  TQSTFQFAGMATGSQK + Deamidation (NQ)
148   1438.94   2875.86   2875.37   0.48 1  6  18 1  CLRTAYTMQRPVYIALPSNMVDMK + 2 Deamidation (NQ); Oxidation (M)
110   1035.09   2068.16   2068.08   0.08 1  6  18 1  LTKAYNLYQGLDDSIINK
118   728.81   2183.42   2182.99   0.42 0  6  28 1  MSNKPSMNSLSAPPAIYMNK + 3 Deamidation (NQ)
106   993.11   1984.20   1983.89   0.31 0  5  24 1  GSGASGSSSGGGASINGNSIFGR + Deamidation (NQ)
91   868.52   1735.03   1734.92   0.12 1  5  22 1  GITGSVDLYQSKTLPR + Deamidation (NQ)
145   1390.98   2779.94   2779.46   0.49 0  5  24 1  MSQPINLAIVGTGIFATDNHLPTIQK + Deamidation (NQ)
14   468.78   935.54   935.53   0.01 0  5  16 1  SINFITLK + Deamidation (NQ)
78   797.98   1593.95   1593.95   -0.00 1  5  23 1  KFFNISVVIVTLSK
89   862.06   1722.11   1721.85   0.26 1  5  31 1  DRQYMSQLIANQQK
45   645.37   1288.73   1288.66   0.07 1  4  21 1  TQVDELKQSNK
156   1244.34   3730.00   3730.78   -0.78 1  4  19 1  EQDYITDKHDLEININNIHLDVTTSNLFGQTK + 3 Deamidation (NQ)
44   1272.90   1271.90   1271.57   0.32 1  4  39 1  KNVTTDFMGDK + Deamidation (NQ); Oxidation (M)
124   1121.67   2241.32   2240.99   0.33 1  4  29 1  KLSSNSYALMTNNNGSGHSQK + 4 Deamidation (NQ)
70   732.95   1463.89   1463.77   0.12 1  4  29 1  GRTVYNGAVSNVVK + Deamidation (NQ)
79   532.33   1593.96   1593.95   0.01 1  4  30 1  KFFNISVVIVTLSK
108   1027.11   2052.21   2052.08   0.13 1  4  30 1  GKLSANGFSILDVNDFLLK + 2 Deamidation (NQ)
163   1387.37   4159.09   4158.91   0.18 0  4  13 1  SINNLNSNNNNNNITHGLLSSPSITSNSTTTSNHGNYNK + 2 Deamidation (NQ)
18   504.32   1006.63   1006.40   0.23 0  4  29 1  NSADNNESR + Deamidation (NQ)
166   1387.97   5547.86   5548.59   -0.73 1  4  12 1  FSDEVDVHDASLISPAQSPLLVDQSQSSQQQQQQLDYSLPMDKLLQQMK + 6 Deamidation (NQ)
27   534.35   1066.68   1066.49   0.19 0  3  28 1  YQAENTVDK
66   721.41   1440.81   1440.78   0.02 0  3  29 1  SLGAPIGSVLVGDEK
41   620.39   1238.77   1239.48   -0.72 0  3  32 1  EMPMNINDIM + Deamidation (NQ); 2 Oxidation (M)
122   1108.16   2214.30   2214.11   0.19 0  3  38 1  QPVGPVGLLCPFNFPSAMGAR
73   752.46   1502.90   1502.76   0.14 0  3  33 1  NSSLALNSLNAALGR + 3 Deamidation (NQ)
98   608.67   1822.99   1823.75   -0.77 0  3  29 1  GTENFDAMTYAQMAMK + Oxidation (M)
138   837.46   2509.35   2510.14   -0.79 0  3  27 1  SGSSLCTPRPQSMVAPVSTSNSSR + 2 Deamidation (NQ); Oxidation (M)
71   490.96   1469.85   1469.67   0.18 0  3  30 1  MIEVQSNYVDEK + Oxidation (M)
147   945.53   2833.56   2833.43   0.13 1  3  31 1  NIPSDKTIVMAHSMGAYLMATLAINR + Oxidation (M)
153   1124.97   3371.89   3372.55   -0.66 1  3  32 1  MSRTAITSNLNLTPFETTNNNLDVSESIDR + 4 Deamidation (NQ); Oxidation (M)
134   1231.73   2461.44   2462.15   -0.72 1  3  41 1  RVSDQASSSSNQEIVDNPETATK
115   1069.64   2137.26   2137.04   0.22 1  3  45 1  YENELAMRQSVEADIAGLK + Deamidation (NQ)
123   1112.63   2223.24   2224.02   -0.78 1  2  37 1  MSVQIFNDQATEERAENAR + Oxidation (M)
155   1238.37   3712.08   3711.65   0.42 0  2  31 1  YFQDFLSFFFYITCQTNSLMSHSNNNINLK + 3 Deamidation (NQ); Oxidation (M)
77   796.96   1591.91   1591.75   0.16 1  2  36 1  LTAEVENAKCQNSK + Deamidation (NQ)
136   619.06   2472.21   2472.14   0.08 1  2  28 1  ASEEEEDEDTESPQPVSKPIKK + Deamidation (NQ)
158   1310.77   3929.30   3929.90   -0.60 1  2  33 1  NSVATTPSPLGVNTSSNRINKPMITSNNNNNINNMGK + Deamidation (NQ); Oxidation (M)
102   947.08   1892.15   1891.91   0.24 0  2  57 1  NNTSTDGGIIINLPSMVK + 3 Deamidation (NQ); Oxidation (M)
101   626.06   1875.17   1875.96   -0.79 1  2  61 1  FQQNEVNIKIGTNQIK + 3 Deamidation (NQ)
131   1189.19   2376.36   2377.05   -0.70 1  2  48 1  LSCEYDTQDPYNKKPEFSR + Deamidation (NQ)
159   1334.77   4001.30   4001.95   -0.65 0  2  38 1  SVSSASPIAILQQLFPHQCNTSITNPMLQNTTLIQK + 6 Deamidation (NQ); Oxidation (M)
109   1031.59   2061.16   2060.97   0.19 0  2  46 1  IHPQANYIALQSMDNSIK + 3 Deamidation (NQ); Oxidation (M)
154   1178.99   3533.96   3534.62   -0.66 1  2  39 1  KQLDECSELLELAQNNYTHSLYQHSLENR + 3 Deamidation (NQ)
116   1074.14   2146.27   2146.12   0.15 1  2  59 1  SSEESELLPNNLTPFTKIK
82   842.01   1682.00   1681.79   0.21 0  1  53 1  LNTFNNQVLGFQER + 3 Deamidation (NQ)
139   1298.70   2595.39   2595.14   0.26 1  1  38 1  SMISNNQSFQKSMISNNQLFQK + 6 Deamidation (NQ); Oxidation (M)
141   1325.25   2648.49   2649.25   -0.76 0  1  44 1  TIVMTAQHNNMQQQAFQQQLMK + 2 Oxidation (M)
49   668.94   1335.86   1335.66   0.20 1  1  77 1  GSSLKNGNGSVTSK + Deamidation (NQ)
157   1287.03   3858.06   3858.69   -0.63 1  1  41 1  QQNTSSSRFNETHELNDLLTQGTGLDTFGNTGDTR + 5 Deamidation (NQ)
7   404.79   807.57   807.35   0.21 1  1  50 1  KNTECR + Deamidation (NQ)
126   1155.17   2308.33   2309.05   -0.72 0  0  67 1  AIEEGYNVGIIEPTDGSSSAGDK + Deamidation (NQ)
95   881.03   1760.04   1759.83   0.21 1  0  67 1  SSTQENSFNVYKNLK + 2 Deamidation (NQ)
137   830.07   2487.18   2487.10   0.08 0  0  45 1  KPVDSPSSSPSPSPSTSQSMMGHR + Deamidation (NQ); Oxidation (M)
113   1059.16   2116.32   2115.93   0.38 1  0  88 1  KQASFLMNQAIDECTNVK + 4 Deamidation (NQ); Oxidation (M)
62   711.49   1420.96   1421.73   -0.77 1  0  1.1e+002 1  NIIGMASTRISSR + Deamidation (NQ); Oxidation (M)
46   438.29   1311.84   1311.62   0.22 1  0  78 1  SHNTLMNKTHK + 2 Deamidation (NQ)
1   400.27   399.26        
2   463.25   462.24        
3   584.37   583.36        
4   712.41   711.40        
5   766.62   765.61        
6   404.28   806.55        
8   406.28   810.54        
10   412.28   822.55        
17   1003.79   1002.78        
20   510.31   1018.62        
21   513.83   1025.64        
24   1040.76   1039.75        
26   529.83   1057.65        
29   1101.85   1100.84        
30   555.85   1109.68        
34   564.85   1127.68        
37   583.88   1165.75        
51   1354.24   1353.24        
52   1356.26   1355.26        
55   683.42   1364.83        
56   691.93   1381.84        
60   708.43   1414.84        
63   476.95   1427.81        
65   478.31   1431.90        
67   481.94   1442.80        
68   482.63   1444.86        
69   487.31   1458.90        
72   1480.18   1479.18        
74   761.43   1520.84        
76   785.45   1568.88        
80   538.96   1613.87        
84   565.35   1693.04        
85   566.04   1695.09        
88   856.49   1710.96        
90   862.53   1723.05        
93   871.95   1741.88        
94   873.00   1744.00        
97   898.05   1794.08        
103   950.55   1899.09        
104   985.60   1969.19        
105   987.56   1973.11        
112   1047.65   2093.29        
117   723.75   2168.23        
119   729.08   2184.20        
120   1093.62   2185.22        
121   1103.19   2204.37        
127   777.77   2330.27        
129   783.08   2346.23        
130   783.44   2347.30        
133   1218.14   2434.27        
135   1236.23   2470.44        
140   1323.14   2644.26        
142   891.48   2671.41        
144   1380.23   2758.44        
149   975.21   2922.61        
150   981.84   2942.49        
151   1023.58   3067.72        
160   1341.07   4020.18        
161   1367.22   4098.64        
162   1370.28   4107.83        
164   1392.97   4175.88        
165   1474.10   4419.29        
167   1433.39   5729.53        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 167

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 16 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 3
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 4
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 5
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 6
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 7
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.5    0.21        K.KNTECR.K
  0.5    0.21        K.KNTNNSK.Q
  0.5    0.21        K.KSENDSK.S
  0.5    0.16        K.QESFGIK.I
Top scoring peptide matches to query 8
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 9
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.1    0.15   15  10558.1 MIEPSLK
  9.3    0.24               K.QNENIPT.-
  9.3    0.08               R.MLIISIK.I
  5.5    0.12               R.ILASGGTAK.L
  4.5    0.21               K.ENPDLTK.L
  4.1    0.19               K.MPPLQSK.T
  4.1    0.10               R.IMAKNLK.K
  3.9   -0.80               R.INANDGSK.S
  3.5    0.13               K.LLNEVTK.I
  3.5    0.14               K.MIANIQK.K
Top scoring peptide matches to query 10
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 11
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.3    0.01        K.RELLLAR.V
 11.2   -0.01        K.QLIAAKVK.N
 11.2    0.08        K.LHMKNVK.Y
  3.2    0.10        R.NLNPAIAR.A
  0.2    0.11        K.QIHGPYR.L
Top scoring peptide matches to query 12
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 36.7    0.17   12  mEcm33.3 K.LSCSAFNK.L
 12.1    0.09                R.LSRAHSQK.S
  2.2    0.15                -.LSCMFIR.S
  1.8    0.16                K.LSNFTTNK.K
  1.0    0.10                K.LSLTMAYK.I
  1.0    0.10                R.LSQFRFK.T
  0.2    0.04                R.ISLLLDPR.H
  0.2    0.10                M.LSFKQFR.V
  0.2    0.18                K.LSNSFSNR.Q
  0.2    0.18                R.LSSMTDTR.H
Top scoring peptide matches to query 13
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.4    0.15        K.STEPRSQK.Q
Top scoring peptide matches to query 14
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.01        R.SINFITLK.K
  3.0    0.04        K.VSQYPTLK.L
  1.5    0.12        K.YGDPNQLK.R
  1.3    0.15        R.EMELNGDK.F
  1.3    0.10        K.DNPQYATK.N
  1.3    0.01        R.YLLNATLK.T
  1.2    0.10        K.EMIERNK.I
  1.2    0.12        K.QANTPEFK.E
  1.1    0.13        K.LSNENETK.S
  1.1    0.13        K.SINEESEK.Y
Top scoring peptide matches to query 15
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 48.2    0.15    5  mCHT2   K.LSSAIEEIK.C
 19.6   -0.78   16  20170.1 K.NSIASAGENK.L
 19.1    0.19   17  5739.1  K.SLSSPEQIK.E
 13.0    0.10               K.ISKLSNISK.Y
 12.1    0.18               K.NENIVGKSK.L
 12.1    0.18               K.NENIVGKSK.L
 11.2    0.10               K.SLSIITSIR.F
 10.8    0.16               K.ISTHAVSFK.L
 10.4   -0.72               R.NSFNENHK.G
 10.4   -0.72               R.NSFNENHK.G
Top scoring peptide matches to query 16
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 36.1    0.15    5  mCHT2 K.FADTLWNK.F
 10.9    0.22             -.MSNANQSNK.F
 10.1   -0.76             -.MSNANQSNK.F
  8.6   -0.76             -.MSNANQSNK.F
  6.8    0.22             -.MSNANQSNK.F
  6.8    0.22             -.MSNANQSNK.F
  6.5    0.13             K.FIGKDETGK.R
  6.0   -0.76             -.MSNANQSNK.F
  5.7    0.18             K.FEGTEFHK.M
  5.6    0.11             K.FWKNISAK.S
Top scoring peptide matches to query 17
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 18
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.7    0.23             K.NSADNNESR.N
  0.1    0.16    8  mPga4 K.NPSGDGGYLK.S
Top scoring peptide matches to query 19
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.3    0.15    4  mCrh11 K.RFDNPSFK.S
 11.2   -0.78              K.KYNANENR.V
  8.0    0.18              K.QYQLNQSK.L
  7.2    0.20              K.KYNANENR.V
  7.1    0.12              K.RHQLVDDK.E
  6.8    0.16              K.QNWSIAYK.I
  6.5    0.14              K.KISGSENFK.F
  5.7    0.11              K.ITTNSSLFK.T
  5.0    0.08              K.RHLSEIQK.D
  4.0    0.19              K.QSEELQFK.N
Top scoring peptide matches to query 20
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 21
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 22
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.6    0.10        K.YPAIAIHGGK.D
  8.2   -0.74        K.GGMNKGGMNK.G
  7.4    0.23        K.IMLQDMNK.V
  3.3    0.24        K.GGMNKGGMNK.G
  3.1   -0.76        R.LDMQDYDK.N
  3.1    0.18        -.IMTEVFNR.G
  2.5    0.10        R.IYVFSRNK.E
  2.5    0.17        K.MLRDANYK.Q
  1.7    0.15        R.TNHIEAVNK.R
  1.6    0.05        K.LFVLRNHK.H
Top scoring peptide matches to query 23
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 45.9    0.15   11  mPhr2 SNTDASAFVK
  7.8    0.16             K.SNSQRYQR.I
  2.4    0.10             R.QIEHLNRK.Y
Top scoring peptide matches to query 24
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 25
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 31.1    0.16    9  19516.2 R.HQDFVPATK.I
  8.5    0.14               K.QTQGPSKPAK.K
  7.4    0.20               R.HKTQEDER.E
  2.9    0.19               HQCENILK
  2.0    0.10               K.HELSSLKTK.M
  0.1    0.23               M.AASDAHNNNK.K
  0.0    0.23               M.AASDAHNNNK.K
  0.0    0.23               M.AASDAHNNNK.K
Top scoring peptide matches to query 26
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 27
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.4    0.19        K.YQAENTVDK.L
  2.1   -0.80        K.YQAENTVDK.L
  1.0    0.14        K.YKTNTQGVR.T
Top scoring peptide matches to query 28
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.3    0.11        R.KFADIGNTVK.K
 10.3    0.16        R.MAGFPENALK.A
 10.0    0.18        -.MSQEDLLTR.V
  9.0   -0.77        K.NSEDIMQQK.S
  8.4    0.20        K.ASTAESEAAQK.L
  8.2    0.09        K.FKSWVEAVK.E
  7.7    0.11        R.FAGCGSLLLR.T
  7.4    0.17        R.NSNHRHATR.V
  6.5    0.16        R.QQSVSKASQK.S
  6.4    0.14        K.SIFNQLNEK.S
Top scoring peptide matches to query 29
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 30
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 31
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.6    0.17    9  19516.2 R.GGIQGFHGDVK.V
  9.9    0.05               K.KVLDGALTGLK.N
  4.9    0.08               R.LDNLIKGVNK.C
  3.7    0.18               K.KNNPELAGDR.S
  3.4    0.08               K.ELLIEVRDK.K
  2.9    0.19               -.EAAFFNSTVK.S
  1.8    0.19               M.DICFFWVK.Q
  1.8    0.11               R.NLGVHISFVK.S
  1.3    0.10               K.LVGVPCAVATK.Q
  0.9    0.22               R.SSDGLYNMVK.A
Top scoring peptide matches to query 32
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.8    0.25        K.STSPELNSQR.I
Top scoring peptide matches to query 33
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.8    0.17   13  mUTR2 R.YDYPQTPSR.I
  2.4    0.13             -.YLFDELNGR.L
Top scoring peptide matches to query 34
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 35
Score greater than 30 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 84.8    0.16    1  mSod5/Pga3 K.HGNIMGESYK.T
 12.5    0.14                  R.HASINSTDYK.S
  3.6    0.07                  K.QYEAVRLEK.L
  3.0    0.16                  K.KSGHWDNYK.D
  2.7    0.13                  R.HYEQVLAMK.D
  2.3    0.08                  K.QYQLLNEVK.S
  2.1    0.07                  K.KTGTEMEIVK.E
  1.6    0.11                  K.QFILDEQDK.K
  1.0    0.07                  K.ILPMQLEYK.L
  0.5   -0.78                  K.FYNNNGNYK.N
Top scoring peptide matches to query 36
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 75.7    0.18    6  9023.3  K.SNQQAAISSIK.S
 15.4    0.18   19  14783.2 R.NGPSMILSSIK.L
 11.5    0.16               R.NSKLDISQIK.D
  8.9    0.19               R.DVNKTIQEAK.Q
  7.9    0.18               R.NKSQNDSLLK.A
  3.6    0.19               R.NGELGAIGSSIK.R
  2.8   -0.75               R.TDNVVCTNPK.C
  1.6    0.16               K.KLQINNSLSK.L
  1.6    0.16               K.KLQINNSLSK.L
  1.6    0.16               K.KLQINNSLSK.L
Top scoring peptide matches to query 37
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 38
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.8    0.17    4  mCrh11 R.GGYHDIANPLK.D
  9.0    0.13              K.ILNQLQNIPK.I
  8.3    0.16              K.IQNNEIPIDK.Y
  8.3    0.16              K.IQNNEIPIDK.Y
  6.1    0.15              K.SNPGNNQVLLK.Q
  4.1    0.13              R.LHTYAQNLPK.E
  3.6    0.07              K.KLDVKPMIPK.K
  3.4    0.11              R.SDAKGAINAPIK.V
  3.2    0.16              K.IQNNEIPIDK.Y
  3.1    0.12              K.IDQDEKPIVK.E
Top scoring peptide matches to query 39
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 24.8    0.15   14  mALS3.5eoc K.KISINVDFER.S
 13.6   -0.77   20  714.1      K.QNSIDVNEFR.L
 10.9    0.13                  K.KGNHPILNTAR.N
  5.7    0.26                  K.QSLLVGQNSNC.-
  5.6    0.26                  K.QSLLVGQNSNC.-
  3.7   -0.73                  K.QSLLVGQNSNC.-
  3.5   -0.73                  K.QSLLVGQNSNC.-
  1.7    0.19                  R.QVLEGPSYATR.F
  0.8   -0.80                  K.ELSFKDPQTR.I
  0.5   -0.72                  K.NGNNEKDTNSK.E
Top scoring peptide matches to query 40
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.8    0.16        K.KMACLLQSEK.K
  7.8   -0.73        K.NQTSTSSGNNGR.K
  7.8   -0.73        K.NQTSTSSGNNGR.K
  7.1    0.25        K.NQTSTSSGNNGR.K
  7.1    0.25        K.NQTSTSSGNNGR.K
  6.4    0.17        R.NQAKYWLDGK.V
  6.4    0.17        R.NQAKYWLDGK.V
  3.8    0.15        K.LKSYNQNVEK.M
  3.0    0.19        R.GFNNNTNIISK.F
  3.0    0.19        R.GFNNNTNIISK.F
Top scoring peptide matches to query 41
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.2   -0.72        K.EMPMNINDIM.-
  1.3   -0.72        K.EMPMNINDIM.-
  0.9   -0.72        K.EMPMNINDIM.-
Top scoring peptide matches to query 42
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.0    0.17   10  mPga24 K.VITVVACDEHK.C
  4.9    0.20              K.QGEPVALKPTDN.-
  2.2    0.17              R.SNISLPMVEHK.G
  1.3    0.08              R.IVLSQVNEIQK.H
  0.7    0.18              K.IAIDHFNAPGSK.D
Top scoring peptide matches to query 43
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 31.0    0.19   10  mPga24 K.VITVVACDEHK.C
  8.8    0.10              R.IVLSQVNEIQK.H
  5.5    0.19              R.SNISLPMVEHK.G
  3.3    0.17              K.DITAVLADSTHK.I
  1.5    0.20              K.SNNPNVLINER.S
  0.4    0.22              K.QGEPVALKPTDN.-
Top scoring peptide matches to query 44
Score greater than 13 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.2    0.32        K.KNVTTDFMGDK.V
  0.8    0.38        R.KYNANESSDNK.I
Top scoring peptide matches to query 45
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.3    0.07        K.TQVDELKQSNK.S
  1.4    0.12        -.AISDADVAPTNSK.I
  0.4    0.03        R.ALMALGELSALGK.T
Top scoring peptide matches to query 46
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.0    0.22        K.SHNTLMNKTHK.W
Top scoring peptide matches to query 47
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.8    0.14        R.QTQQSIVDQIR.E
  6.6    0.13        K.MKEWNDNLIR.Q
  5.7    0.10        K.KMWLSPNGTIR.N
  5.7    0.10        K.KMWLSPNGTLR.N
  4.2    0.13        R.KFEEPNTSPIR.F
  3.7    0.20        K.NVAAGCNPMDLR.R
  2.7    0.06        R.KPFQQRLMIR.I
  2.6    0.15        -.KSMFSYSQAIR.F
  1.6    0.18        K.SQFMFTSNSLR.F
  1.6    0.14        R.QTQQSIVDQIR.E
Top scoring peptide matches to query 48
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8   -0.01        K.VSPVMESILIIK.S
  8.2    0.01        R.RFPEVVELALR.R
  7.3    0.06        R.DNGLPLSKVWAK.V
  5.6    0.06        K.HYHETIFIIR.I
  5.3   -0.02        K.AEALLIMVSILR.V
  4.7    0.19        K.VSTDDGSIDYEK.A
  3.2   -0.04        K.VISTLNVVIKDK.E
  2.3    0.18        K.SGSAQSLSNFNSK.G
  2.1    0.06        R.SQVVSNSPEIIR.R
  0.9    0.17        K.QASEMYNDIIK.Q
Top scoring peptide matches to query 49
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8    0.20        K.GSSLKNGNGSVTSK.S
Top scoring peptide matches to query 50
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.8    0.19    8  mPga4 K.YFQELGINTIR.V
 12.7   -0.79    8  mPga4 K.YFQELGINTIR.V
  4.0   -0.79    8  mPga4 K.YFQELGINTIR.V
  0.5    0.15             R.NVPQLYHQLIK.L
  0.5    0.32             K.YFQLNNQHMR.A
Top scoring peptide matches to query 51
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 52
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 53
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6   -0.77        K.EVIEVTGWDLAK.T
  4.8   -0.73        K.QSIQFVADEPPK.D
  4.6    0.14        R.KVQLAMITPITK.E
  4.6    0.18        K.QTIPSFVTIQPK.S
  0.6    0.23        K.KNQELQELLNK.W
  0.6    0.18        R.KLLDWEQVISK.R
  0.3   -0.73        K.ESPRWLMQVGR.Y
  0.2    0.19        K.QLLPSSIGKNSSK.K
Top scoring peptide matches to query 54
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.6    0.20   18  8527.1 K.KTDDSAPITIVAK.F
  3.4    0.23              K.EVRDIQSQLAAK.T
  2.5   -0.76              K.EVRDIQSQLAAK.T
  0.9    0.46              K.QGDNDSSYNDDK.K
Top scoring peptide matches to query 55
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 56
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 57
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.8    0.17        K.MITSTNSWPVNK.I
  6.0    0.22        -.MQSELYSSTYGK.G
  3.1    0.03        K.IFTLLFPKSSNK.S
  2.4    0.18        K.FGGTCVNVGCVPK.K
  2.0    0.16        K.ELQLANSFTENK.Y
  1.1    0.22        R.NDLLYNDNGDNK.D
  1.0    0.14        K.NIYQGLIAMENK.S
  0.8    0.08        K.LMVEFKQLLEK.K
  0.4    0.20        R.EMSLCRELNNK.N
  0.4    0.14        K.APVGNPEGADKPNK.K
Top scoring peptide matches to query 58
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
106.0    0.18    1  mSod5/Pga3 R.AATPAAHEVGDLAGK.H
 10.6    0.19                  K.MNSLSNLLQDKK.K
  6.8    0.28                  R.QNQGDWMGVVSGK.G
  4.3    0.18                  -.NKFNCELIQLK.V
  3.6    0.21                  R.EQYMQLAAQTPK.S
  3.1    0.16                  R.SRSSSLLNTISNK.I
  3.0    0.28                  R.QNQGDWMGVVSGK.G
  2.4    0.23                  R.SDSQSDIRSSTPK.S
  2.3   -0.65                  R.QQQQQQQETQK.K
  2.3   -0.65                  R.QQQQQQQETQK.K
Top scoring peptide matches to query 59
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
102.5    0.23    1  mSod5/Pga3 R.AATPAAHEVGDLAGK.H
  3.8    0.33                  R.QNQGDWMGVVSGK.G
  1.8   -0.75                  R.KMNSLSNLLQDK.K
  1.5    0.30                  R.SNSNDPINRDFK.L
  0.7    0.33                  R.QNQGDWMGVVSGK.G
Top scoring peptide matches to query 60
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 61
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 72.2    0.20    7  mALS1.5eoc K.STVDPSGYLYASR.V
 11.1    0.21                  K.STVDQSGYLTTSR.F
  7.2    0.07                  R.IAMLLFNIPDIR.L
  6.9    0.09                  K.LRTDLLETADIR.R
  3.5    0.23                  -.STTMQDSFDQKK.Q
  3.4    0.24                  K.TSDVMETVFQDK.K
  1.6    0.23                  R.ISSYSSCLDLNR.C
  1.4    0.21                  R.QQHFNRAENIR.R
  1.4    0.21                  R.QQHFNRAENIR.R
  1.4    0.21                  R.QQHFNRAENIR.R
Top scoring peptide matches to query 62
Score greater than 13 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.1   -0.77        K.NIIGMASTRISSR.H
Top scoring peptide matches to query 63
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 64
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.6    0.16        K.QSPVSSTGVDVSIR.D
  2.4    0.16        K.TVEELGWDKLNK.F
  1.8    0.19        K.QVSDAWVAAGKGDK.I
  1.7    0.12        K.ENIPSFLEKLDK.Q
  1.6    0.09        K.ILSICFLNPISR.H
  0.9    0.18        K.QSEIVKDEELNK.F
  0.6    0.19        -.CDGISINPSINIK.I
  0.5   -0.76        K.ALQMEANELEER.K
  0.1    0.20        K.DLEQSWLLQGNK.G
Top scoring peptide matches to query 65
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 66
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.2    0.02        K.SLGAPIGSVLVGDEK.F
  2.7    0.01        R.NTPIIGITENKNK.I
Top scoring peptide matches to query 67
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 68
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 69
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 70
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1    0.12        K.GRTVYNGAVSNVVK.Y
  2.1    0.14        K.NVAGGYSSAQRVVR.N
  1.7   -0.69        R.LTQNNANNNNTNK.K
  1.7   -0.69        R.LTQNNANNNNTNK.K
  1.3   -0.69        R.LTQNNANNNNTNK.K
  1.3   -0.69        R.LTQNNANNNNTNK.K
Top scoring peptide matches to query 71
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0    0.18        R.MIEVQSNYVDEK.D
  3.0    0.15        -.MTKILSQDDFQK.Q
Top scoring peptide matches to query 72
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 73
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.1    0.14        R.NSSLALNSLNAALGR.K
  2.0    0.08        K.SNLSSSPVILKQTK.L
  0.2    0.11        K.MASINCIPQTKIK.L
  0.1    0.23        K.NSDNYIISLCFR.C
Top scoring peptide matches to query 74
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 75
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3    0.09        K.STLAKFVAWINGLK.V
  6.9    0.13        K.VNFQNISPFQLLK.I
  6.9    0.13        K.VNFQNISPFQLLK.I
  1.7    0.19        K.VNELTNGNKSLETK.N
  0.8    0.30        K.DNNNTIIENEDQK.F
  0.8    0.30        K.DNNNTIIENEDQK.F
  0.7    0.17        K.VIDEIVNTLPCFK.N
  0.4    0.13        K.VNFQNISPFQLLK.I
  0.4   -0.79        R.GVGATGNSGSGGGGGTTKK.L
  0.1    0.13        K.NETRNQFITLTVL.-
Top scoring peptide matches to query 76
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 77
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.3    0.16        R.LTAEVENAKCQNSK.L
  1.1    0.16        R.LTAEVENAKCQNSK.L
  1.1    0.16        R.LTAEVENAKCQNSK.L
  0.3    0.21        R.LTQNNANNNNTNKK.K
  0.3    0.21        R.LTQNNANNNNTNKK.K
  0.3    0.21        R.LTQNNANNNNTNKK.K
  0.2    0.13        K.DNDRSIIDQIFQK.A
Top scoring peptide matches to query 78
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.1   -0.00        R.KFFNISVVIVTLSK.M
  1.2    0.21        R.LIELNCDSINMEK.I
  1.2   -0.77        R.LIELNCDSINMEK.I
Top scoring peptide matches to query 79
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1    0.01        R.KFFNISVVIVTLSK.M
Top scoring peptide matches to query 80
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 81
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
125.8    0.20    2  mSSR1 K.CSGLNDLSCICTTK.N
 81.2   -0.78    2  mSSR1 K.CSGLNDLSCICTTK.N
  2.7    0.17             R.QQQQPQQQQEEVK.S
  2.5    0.21             K.MFDNIINSLNNDSK.D
Top scoring peptide matches to query 82
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5    0.21        R.LNTFNNQVLGFQER.E
  1.5   -0.78        R.LNTFNNQVLGFQER.E
Top scoring peptide matches to query 83
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3   -0.77        K.TQSTFQFAGMATGSQK.K
  4.4    0.21        R.AHNGNNKTTTTTPTTK.C
Top scoring peptide matches to query 84
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 85
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 86
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.7    0.23        -.MTNWGVIQDGSELNK.G
  4.1    0.19        K.EESENLFNEKLNIK.Q
  2.0    0.22        K.MELNFLIPDDLEDK.W
  1.8    0.12        K.QFITLTQLGGNATTLK.D
  1.1   -0.75        -.MTNWGVIQDGSELNK.G
  0.6    0.19        K.EESENLFNEKLNIK.Q
  0.5    0.17        K.LEMFESSLQSSPPLK.Y
  0.4    0.14        R.LQSAGSSGGITTLQMIK.T
  0.1    0.24        R.MNQLTEPQIMDLNK.E
  0.1    0.08        R.QEKVMHQLNLINLK.K
Top scoring peptide matches to query 87
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 33.1    0.23    2  mSSR1 K.EICPNGDADTAISAFK.S
  0.8    0.17             R.NHTMNVSGRIPPQGAK.E
  0.4    0.13             R.SLLANSSATNLNAYLR.G
Top scoring peptide matches to query 88
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 89
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.0    0.26        R.DRQYMSQLIANQQK.S
  4.1    0.33        K.NLQQKDESLSDDLSK.L
  3.5    0.20        K.VSEKITFDLIDDSIK.I
  3.1    0.30        K.GAPGNFTSFLELPENK.T
  1.5    0.20        K.GFINLIGQDSLRFDK.I
  0.4   -0.73        R.DRQYMSQLIANQQK.S
Top scoring peptide matches to query 90
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 91
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4    0.12        K.GITGSVDLYQSKTLPR.F
Top scoring peptide matches to query 92
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.7   -0.64        K.EDDKQSTVDNNNNDK.D
  7.7   -0.64        K.EDDKQSTVDNNNNDK.D
  7.7   -0.64        K.EDDKQSTVDNNNNDK.D
  7.7   -0.64        K.EDDKQSTVDNNNNDK.D
  7.7   -0.64        K.EDDKQSTVDNNNNDK.D
  7.7   -0.64        K.EDDKQSTVDNNNNDK.D
  5.7    0.15        K.FQTVHFQTFNIINK.A
  5.7    0.15        K.FQTVHFQTFNIINK.A
  4.6    0.34        K.EDDKQSTVDNNNNDK.D
  4.6    0.34        K.EDDKQSTVDNNNNDK.D
Top scoring peptide matches to query 93
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 94
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 95
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2    0.21        R.SSTQENSFNVYKNLK.F
  0.2   -0.77        R.SSTQENSFNVYKNLK.F
  0.2    0.21        R.SSTQENSFNVYKNLK.F
  0.2   -0.77        R.SSTQENSFNVYKNLK.F
Top scoring peptide matches to query 96
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 85.0    0.22    4  mCrh11 K.QYSYSDQSGSWESIK.A
 63.5   -0.76    4  mCrh11 K.QYSYSDQSGSWESIK.A
 41.2   -0.76    4  mCrh11 K.QYSYSDQSGSWESIK.A
  5.8    0.16              K.CGGNTLLRCAVSVDNK.T
  3.9    0.04              K.NQPLSLRNNPQLIQK.R
  3.8    0.17              K.GEDEVVDNGTTSRIGSK.D
  3.8    0.12              M.SANRISPPMSYMPAVK.S
  3.2    0.12              M.SANRISPPMSYMPAVK.S
  3.1    0.17              -.YQQNQYIMTLGFDK.F
  2.1    0.15              K.KYMEVHGQQSALDLK.V
Top scoring peptide matches to query 97
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 98
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0   -0.77        R.GTENFDAMTYAQMAMK.I
  0.3    0.27        K.SESENVCGGDNNNDRR.Y
Top scoring peptide matches to query 99
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 37.9    0.24    8  mPga4 R.LPSGLYFNCGDDDMAR.I
  7.6   -0.74    8  mPga4 R.LPSGLYFNCGDDDMAR.I
Top scoring peptide matches to query 100
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.2    0.08        K.GSNYLLNQGDEIAVGVGR.D
  4.1    0.10        K.SNSLATDVRLAEDINNK.V
  1.2    0.03        K.NPLQAFAVIYRNEGIR.G
  1.2    0.03        K.NPLQAFAVIYRNEGIR.G
Top scoring peptide matches to query 101
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7   -0.79        K.FQQNEVNIKIGTNQIK.A
  0.1    0.19        K.FQQNEVNIKIGTNQIK.A
  0.1    0.19        K.FQQNEVNIKIGTNQIK.A
  0.1    0.29        K.IEGIINNELQMNNELK.Q
Top scoring peptide matches to query 102
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7    0.24        K.NNTSTDGGIIINLPSMVK.L
  1.7   -0.63        -.MQGQNRTTSMNNHTNR.R
  1.4    0.30        K.FIDEYYDNSLSNIGNK.N
  1.4    0.30        K.FIDEYYDNSLSNIGNK.N
  1.4   -0.68        K.FIDEYYDNSLSNIGNK.N
  1.0    0.29        K.SNNVIAYGYKTSAMESR.S
  0.5    0.14        -.MTISNSNLFKPIKVGNK.T
  0.5    0.36        -.MQGQNRTTSMNNHTNR.R
  0.5   -0.63        -.MQGQNRTTSMNNHTNR.R
  0.5   -0.63        -.MQGQNRTTSMNNHTNR.R
Top scoring peptide matches to query 103
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 104
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 105
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 106
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.4    0.31        R.GSGASGSSSGGGASINGNSIFGR.S
  5.4    0.31        R.GSGASGSSSGGGASINGNSIFGR.S
  5.3   -0.66        K.ACGNDDNFIQSLSRCVK.W
  5.3   -0.66        K.ACGNDDNFIQSLSRCVK.W
  5.2    0.32        K.ACGNDDNFIQSLSRCVK.W
  4.8   -0.66        K.ACGNDDNFIQSLSRCVK.W
  4.7    0.32        K.ACGNDDNFIQSLSRCVK.W
  4.7    0.32        K.ACGNDDNFIQSLSRCVK.W
  4.4    0.27        K.YMEKVEPLNDYDNVVR.F
  4.0    0.27        K.YMEKVEPLNDYDNVVR.F
Top scoring peptide matches to query 107
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
148.2    0.25    3  15363.2 K.ACSSANNLEMTLHDSVLK.D
 91.1   -0.73    3  15363.2 K.ACSSANNLEMTLHDSVLK.D
 77.5   -0.73    3  15363.2 K.ACSSANNLEMTLHDSVLK.D
  6.5    0.18               K.NNNLQFLKNLNLNGEIK.W
Top scoring peptide matches to query 108
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.9    0.13        K.GKLSANGFSILDVNDFLLK.E
  0.2   -0.73        -.NSPQNTNIHPNNANMSKR.H
Top scoring peptide matches to query 109
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6    0.19        K.IHPQANYIALQSMDNSIK.V
  1.6    0.19        K.IHPQANYIALQSMDNSIK.V
  1.3    0.17        R.LNSPHINMAELAIHNNQK.Q
  1.3    0.17        R.LNSPHINMAELAIHNNQK.Q
  1.3    0.17        R.LNSPHINMAELAIHNNQK.Q
Top scoring peptide matches to query 110
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6    0.08        K.LTKAYNLYQGLDDSIINK.R
  0.2   -0.75        K.WLNYEEDKQDENMIAR.V
Top scoring peptide matches to query 111
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.4   -0.76        -.MNYYYSLLNTNIDGRIK.I
  4.5    0.50        K.QSESNNSSNNFGDGDSSTNK.M
  4.5   -0.48        K.QSESNNSSNNFGDGDSSTNK.M
  4.5    0.25        K.FSNLDTVITEGGGNLSQGER.Q
  3.6    0.01        K.TTTTTTTLILILILYTRR.Q
  3.6   -0.78        K.YVQITNCGLNNIDQSILK.L
  3.6   -0.59        R.ANSQQKQEGNSWNQGDGNK.E
  3.4   -0.70        R.EQMNNLQDEMINITSIAK.E
  3.4   -0.70        R.EQMNNLQDEMINITSIAK.E
  3.4   -0.70        R.EQMNNLQDEMINITSIAK.E
Top scoring peptide matches to query 112
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 113
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2    0.38        K.KQASFLMNQAIDECTNVK.K
Top scoring peptide matches to query 114
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.1    0.16        K.VQQLQMSADQHGDSLKTTK.N
 13.1    0.16        K.VQQLQMSADQHGDSLKTTK.N
 13.1    0.16        K.VQQLQMSADQHGDSLKTTK.N
  8.1   -0.04        K.VILAYEKIGQILSTYTHGK.L
  7.3   -0.01        K.VYAWGNTNISVIDIRTALK.S
Top scoring peptide matches to query 115
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5    0.22        K.YENELAMRQSVEADIAGLK.R
  2.5   -0.76        K.YENELAMRQSVEADIAGLK.R
  1.2    0.31        K.SADQGNGTSKQQQSAQSTQGK.R
  1.2   -0.68        K.SADQGNGTSKQQQSAQSTQGK.R
  1.1    0.09        R.ALSTVLNPQHLISIIEMIK.N
  0.7    0.18        K.SMIPIVTPSWVYDSISSQK.M
Top scoring peptide matches to query 116
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.5    0.15        K.SSEESELLPNNLTPFTKIK.H
  0.5    0.27        K.KEDEFEEHILQQVQSMR.S
  0.5    0.27        K.KEDEFEEHILQQVQSMR.S
  0.5    0.27        K.KEDEFEEHILQQVQSMR.S
  0.0    0.13        K.YQSSSSVALQLSHRLTQLK.Q
Top scoring peptide matches to query 117
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 118
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.6    0.42        R.MSNKPSMNSLSAPPAIYMNK.A
  5.0   -0.55        K.STEGRDSCTVIEAINMSGEK.L
  4.5    0.45        R.LIDLDNENMELSSTELSNK.S
  4.0    0.45        K.LNGDNDLMLTVPQTYPMDK.I
  3.5    0.56        K.WNMDDQNGNENQQTELTK.E
  3.4    0.29        R.DSQIILMSFLQKVVFDER.M
  3.4   -0.70        R.DSQIILMSFLQKVVFDER.M
  3.0    0.37        K.GGHNLSDADILKWANQQVSK.G
  2.5    0.56        K.WNMDDQNGNENQQTELTK.E
  2.5   -0.74        R.ILELLNDSQLQVDIINSEK.L
Top scoring peptide matches to query 119
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 120
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 121
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 122
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.2    0.19        K.QPVGPVGLLCPFNFPSAMGAR.K
  2.0   -0.80        K.QPVGPVGLLCPFNFPSAMGAR.K
  1.0    0.31        K.NNYPGHQPNIESILQPSMR.D
  1.0    0.31        K.NNYPGHQPNIESILQPSMR.D
  0.9    0.31        K.NNYPGHQPNIESILQPSMR.D
  0.9    0.31        K.NNYPGHQPNIESILQPSMR.D
  0.9   -0.68        K.NNYPGHQPNIESILQPSMR.D
  0.6   -0.77        R.QQNVYFGVTLDNALVQGFAK.I
  0.6   -0.77        R.QQNVYFGVTLDNALVQGFAK.I
  0.6   -0.77        R.QQNVYFGVTLDNALVQGFAK.I
Top scoring peptide matches to query 123
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.4   -0.78        MSVQIFNDQATEERAENAR
  2.2    0.18        K.FNDLSTALSDADLQAREDLK.Q
  1.2    0.22        R.VYEVATFYTMYNRHPMGK.Y
  1.2    0.22        R.VYEVATFYTMYNRHPMGK.Y
  0.3    0.22        K.FEMEQNLRQGVDADINGLR.Q
  0.3    0.22        K.FEMEQNLRQGVDADINGLR.Q
  0.3    0.22        K.FEMEQNLRQGVDADINGLR.Q
Top scoring peptide matches to query 124
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.1    0.33        R.KLSSNSYALMTNNNGSGHSQK.S
  4.1    0.33        R.KLSSNSYALMTNNNGSGHSQK.S
  4.1    0.33        R.KLSSNSYALMTNNNGSGHSQK.S
  4.1    0.33        R.KLSSNSYALMTNNNGSGHSQK.S
  3.9   -0.65        R.KLSSNSYALMTNNNGSGHSQK.S
  3.4    0.18        R.DHRVHGINNANIQNHIFLK.D
  3.4    0.18        R.DHRVHGINNANIQNHIFLK.D
  3.4    0.18        R.DHRVHGINNANIQNHIFLK.D
  3.4    0.17        K.LQIQVPADGEYEKPEQLVGK.K
  2.5    0.22        R.ILHPEHELPLFQQMHSQR.Q
Top scoring peptide matches to query 125
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3    0.29        R.GDGQQSQSQSQLPSQQQSQPR.R
  9.3   -0.70        R.GDGQQSQSQSQLPSQQQSQPR.R
  9.3    0.29        R.GDGQQSQSQSQLPSQQQSQPR.R
  9.3    0.29        R.GDGQQSQSQSQLPSQQQSQPR.R
  8.2    0.22        K.ARTISNNLQQQQQQQQNLR.E
  5.4   -0.70        R.GDGQQSQSQSQLPSQQQSQPR.R
  4.7   -0.70        R.GDGQQSQSQSQLPSQQQSQPR.R
  4.0    0.29        R.GDGQQSQSQSQLPSQQQSQPR.R
  3.9    0.29        R.GDGQQSQSQSQLPSQQQSQPR.R
  2.9    0.15        K.LIEFSTQPSAPPSNAIISNRR.I
Top scoring peptide matches to query 126
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.4   -0.72        K.AIEEGYNVGIIEPTDGSSSAGDK.F
Top scoring peptide matches to query 127
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 128
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.2   -0.51        K.MWDAIFNRVVTDESVTALQK.A
  9.2    0.52        R.QYTYNPKPSYVPGNASIPNAR.R
  7.0    0.56        K.AFNPVKVSIADSMADNSPTMNK.N
  7.0   -0.37        K.SFGWDSSDAFTQHDVQELNR.I
  7.0    0.50        K.VNWEQADIFQPLTYQDKLK.N
  7.0    0.50        K.VNWEQADIFQPLTYQDKLK.N
  5.6   -0.59        R.IVMVGLGSMELKIPNYAFAIR.E
Top scoring peptide matches to query 129
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 130
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 131
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7   -0.70        R.LSCEYDTQDPYNKKPEFSR.V
  1.7   -0.70        R.LSCEYDTQDPYNKKPEFSR.V
Top scoring peptide matches to query 132
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.9   -0.73        K.ILNRQYELNYNYNYNNMK.I
  8.9   -0.73        K.ILNRQYELNYNYNYNNMK.I
  2.3    0.27        K.IQQQQQQQQQHQLSEQDKK.L
  2.3    0.41        -.MSWHNQSNKNSNNDDEYGNK.N
  2.3   -0.58        -.MSWHNQSNKNSNNDDEYGNK.N
  1.8    0.40        R.DVEMEESKDEFDNFDYNNK.Y
  1.8    0.40        R.DVEMEESKDEFDNFDYNNK.Y
  1.8    0.40        R.DVEMEESKDEFDNFDYNNK.Y
  1.8   -0.58        R.DVEMEESKDEFDNFDYNNK.Y
  1.8    0.26        K.ILNRQYELNYNYNYNNMK.I
Top scoring peptide matches to query 133
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 134
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.6   -0.72        K.RVSDQASSSSNQEIVDNPETATK.I
  2.4   -0.78        K.YIEQAFHAANETLNAAHRIHR.F
  2.4   -0.78        K.YIEQAFHAANETLNAAHRIHR.F
  1.7    0.26        K.TTTWDDPRLPSSLDQNVPQYK.R
  1.7    0.26        K.TTTWDDPRLPSSLDQNVPQYK.R
  1.7    0.26        K.TTTWDDPRLPSSLDQNVPQYK.R
  1.5    0.11        R.KGIPDSLYVPTMAGIPTSLFLNK.L
Top scoring peptide matches to query 135
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 136
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.3    0.08        K.ASEEEEDEDTESPQPVSKPIKK.S
Top scoring peptide matches to query 137
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.2    0.08        K.KPVDSPSSSPSPSPSTSQSMMGHR.V
  0.2    0.08        K.KPVDSPSSSPSPSPSTSQSMMGHR.V
Top scoring peptide matches to query 138
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0   -0.79        R.SGSSLCTPRPQSMVAPVSTSNSSR.D
  3.0    0.20        R.SGSSLCTPRPQSMVAPVSTSNSSR.D
  1.6    0.13        K.HSVFYTILRDYGPQEAAAAMNR.M
  1.4   -0.79        R.GSDASMSSVNSSINANFPPPIQMK.S
  1.0    0.26        K.FNQAVSDFNFYQDSNPTEVKR.A
  1.0   -0.72        K.FNQAVSDFNFYQDSNPTEVKR.A
  0.9    0.08        K.SNLNRAFLPNLQLSYFIDNNR.Q
  0.9    0.30        R.TGLKGMDEEGTINDNETDDGQNR.E
  0.9    0.30        R.TGLKGMDEEGTINDNETDDGQNR.E
  0.9    0.30        R.TGLKGMDEEGTINDNETDDGQNR.E
Top scoring peptide matches to query 139
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.4    0.26        K.SMISNNQSFQKSMISNNQLFQK.S
  1.4   -0.73        K.SMISNNQSFQKSMISNNQLFQK.S
  1.4    0.26        K.SMISNNQSFQKSMISNNQLFQK.S
  1.4   -0.73        K.SMISNNQSFQKSMISNNQLFQK.S
  1.4    0.26        K.SMISNNQSFQKSMISNNQLFQK.S
  1.4   -0.73        K.SMISNNQSFQKSMISNNQLFQK.S
  1.4   -0.73        K.SMISNNQSFQKSMISNNQLFQK.S
  1.1    0.35        K.QAIESHMQQEENIGGYEEEQNK.N
  1.1    0.35        K.QAIESHMQQEENIGGYEEEQNK.N
  1.1    0.35        K.QAIESHMQQEENIGGYEEEQNK.N
Top scoring peptide matches to query 140
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 141
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.2   -0.76        K.TIVMTAQHNNMQQQAFQQQLMK.Y
  0.7    0.17        K.NLPLPPIPVQETENGKINEESSNK.N
  0.2    0.17        K.NLPLPPIPVQETENGKINEESSNK.N
Top scoring peptide matches to query 142
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 143
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.4    0.35        R.AFLNYLSLQSEETDNSDNYTESK.T
Top scoring peptide matches to query 144
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 145
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.49        -.MSQPINLAIVGTGIFATDNHLPTIQK.I
  5.3   -0.50        -.MSQPINLAIVGTGIFATDNHLPTIQK.I
  0.5   -0.36        K.NDNLTPMTVDELNQLRIYHGTYR.T
Top scoring peptide matches to query 146
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.9    0.03        R.RELYSMFQICLNYNIIVMIMVK.I
Top scoring peptide matches to query 147
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.9    0.13        R.NIPSDKTIVMAHSMGAYLMATLAINR.N
  2.9    0.13        R.NIPSDKTIVMAHSMGAYLMATLAINR.N
  2.9    0.13        R.NIPSDKTIVMAHSMGAYLMATLAINR.N
Top scoring peptide matches to query 148
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.3    0.48        R.CLRTAYTMQRPVYIALPSNMVDMK.V
  6.3    0.48        R.CLRTAYTMQRPVYIALPSNMVDMK.V
  3.7    0.49        -.MVTINYEPLEHLPHIDENISPEER.S
  3.0   -0.45        K.LIRELSVEDFEGESGSNDFTFNESR.E
  2.7    0.57        K.HANEMYDQFLVLLEQNQIDHIQR.M
  1.2   -0.23        R.NNDDSYGSSSFGSSNDDDNSYGSSNKR.S
  0.0    0.38        M.SLFRSLQNSPSTISIFHNSSIPLSNK.L
Top scoring peptide matches to query 149
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 150
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 151
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 152
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.1    0.38        K.NGQGQLYDDFLEIYNFQTDTKSNEDK.S
  6.4   -0.67        K.VLYDAELSQMQTHVSDTSVVLSMDNNR.N
  4.6    0.43        R.DAYSSLDDGIQEEEDEQDNDANDIKVR.F
  4.6    0.43        R.DAYSSLDDGIQEEEDEQDNDANDIKVR.F
  4.6    0.43        R.DAYSSLDDGIQEEEDEQDNDANDIKVR.F
  4.6    0.31        R.DLDQFLELQQSQQSEYLLQDQEETR.S
  4.6    0.31        R.DLDQFLELQQSQQSEYLLQDQEETR.S
  4.4    0.27        K.NNNNNSTATTTITNTILSTPQNVRYNSK.K
  3.8    0.14        K.NNSINDLIEDQVLLLVQKFSDVTHSSR.G
  3.1    0.29        K.NSSLEFDAPIGLVYMPDNLDEHKTSFK.L
Top scoring peptide matches to query 153
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8   -0.66        K.MSRTAITSNLNLTPFETTNNNLDVSESIDR.V
  2.8   -0.66        K.MSRTAITSNLNLTPFETTNNNLDVSESIDR.V
Top scoring peptide matches to query 154
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.66        R.KQLDECSELLELAQNNYTHSLYQHSLENR.K
  1.6   -0.66        R.KQLDECSELLELAQNNYTHSLYQHSLENR.K
Top scoring peptide matches to query 155
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.4    0.42        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
  2.4    0.42        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
  2.4    0.42        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
  2.4    0.42        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
  2.4   -0.56        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
  2.4   -0.56        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
  2.4   -0.56        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
  2.4   -0.56        K.YFQDFLSFFFYITCQTNSLMSHSNNNINLK.V
Top scoring peptide matches to query 156
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.2   -0.78        R.EQDYITDKHDLEININNIHLDVTTSNLFGQTK.S
  3.1    0.20        R.EQDYITDKHDLEININNIHLDVTTSNLFGQTK.S
  3.1   -0.78        R.EQDYITDKHDLEININNIHLDVTTSNLFGQTK.S
  3.1    0.20        R.EQDYITDKHDLEININNIHLDVTTSNLFGQTK.S
  3.1    0.20        R.EQDYITDKHDLEININNIHLDVTTSNLFGQTK.S
  1.4   -0.78        K.DPQDFESSVDILFSGLEDLLTISHSYLMTSNIK.Q
  1.4   -0.74        R.DNNDTSPNAHNSLQNEYLLFLHELKVSLQCSK.F
  0.9   -0.79        K.CMNEIDAVNELLVLLCRISNDVTFTGNESYLK.V
  0.7    0.06        K.FIRVTSLLKPDFNIPHEQQDAQEFLLFVLDR.L
  0.7    0.06        K.FIRVTSLLKPDFNIPHEQQDAQEFLLFVLDR.L
Top scoring peptide matches to query 157
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.7   -0.63        K.QQNTSSSRFNETHELNDLLTQGTGLDTFGNTGDTR.I
Top scoring peptide matches to query 158
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.8   -0.60        K.NSVATTPSPLGVNTSSNRINKPMITSNNNNNINNMGK.R
  1.3   -0.60        K.NSVATTPSPLGVNTSSNRINKPMITSNNNNNINNMGK.R
  1.3   -0.60        K.NSVATTPSPLGVNTSSNRINKPMITSNNNNNINNMGK.R
  0.7    0.30        R.INDYKVVPDQEVIAIGVNNLIGTFFNAYPATGSFSR.S
  0.7   -0.69        R.INDYKVVPDQEVIAIGVNNLIGTFFNAYPATGSFSR.S
  0.7   -0.69        R.INDYKVVPDQEVIAIGVNNLIGTFFNAYPATGSFSR.S
  0.7   -0.69        R.INDYKVVPDQEVIAIGVNNLIGTFFNAYPATGSFSR.S
  0.7   -0.60        K.NSVATTPSPLGVNTSSNRINKPMITSNNNNNINNMGK.R
  0.3    0.08        -.VIVVASDSVMIAGGFDVVSVSVGVLIISLSSGIVATVVVR.D
  0.2    0.13        K.HMQDVLQVLIENIPTLTNLINEKLLNLLSLVLSGK.G
Top scoring peptide matches to query 159
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.7   -0.65        K.SVSSASPIAILQQLFPHQCNTSITNPMLQNTTLIQK.E
  0.3    0.53        K.TIQDSCDNSQPMYEEMQNISTTIRNQVSPNINQK.E
  0.3    0.53        K.TIQDSCDNSQPMYEEMQNISTTIRNQVSPNINQK.E
  0.3    0.45        K.VNRQLHNFSEDPMTLFTISSSGPVNGNGNEHNGATLK.I
Top scoring peptide matches to query 160
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 161
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 162
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 163
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.9    0.18        K.SINNLNSNNNNNNITHGLLSSPSITSNSTTTSNHGNYNK.I
  2.7   -0.66        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
  2.7   -0.66        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
  2.7   -0.66        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
  2.7   -0.66        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
  2.7   -0.66        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
  2.5    0.32        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
  2.5    0.32        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
  2.4   -0.06        R.STTIPVPQSQLSQDELFAFLSGLINFVNVCIIIFFAK.H
  2.1    0.32        R.IAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNEGSK.N
Top scoring peptide matches to query 164
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 165
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 166
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6   -0.73        K.FSDEVDVHDASLISPAQSPLLVDQSQSSQQQQQQLDYSLPMDKLLQQMK.K
  3.6   -0.73        K.FSDEVDVHDASLISPAQSPLLVDQSQSSQQQQQQLDYSLPMDKLLQQMK.K
  3.4    0.31        K.SNPTPQPQVQQNVQQMNQNNVIRNNAIVGTNGAAPGQINGVPIANSNITMER.F
  3.4    0.31        K.SNPTPQPQVQQNVQQMNQNNVIRNNAIVGTNGAAPGQINGVPIANSNITMER.F
  3.4    0.31        K.SNPTPQPQVQQNVQQMNQNNVIRNNAIVGTNGAAPGQINGVPIANSNITMER.F
  3.4   -0.67        K.SNPTPQPQVQQNVQQMNQNNVIRNNAIVGTNGAAPGQINGVPIANSNITMER.F
  3.4   -0.67        K.SNPTPQPQVQQNVQQMNQNNVIRNNAIVGTNGAAPGQINGVPIANSNITMER.F
  2.0   -0.73        K.FSDEVDVHDASLISPAQSPLLVDQSQSSQQQQQQLDYSLPMDKLLQQMK.K
  1.8    0.26        K.FSDEVDVHDASLISPAQSPLLVDQSQSSQQQQQQLDYSLPMDKLLQQMK.K
  1.3    0.37        K.NTRTPNAQFGNQTAAGTPLQQQQQQPFPHGNNSNPMLNQTAQQPPQSQQR.Q
Top scoring peptide matches to query 167
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide