Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0150_q10.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 16 Nov 2006 at 09:41:38 GMT
Significant hits: mALS3.5eoc  |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mSod5/Pga3  |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
                  mCHT2       583 aa - chitinase 2 precursor Candida albicans
                  mSSR1       |Candida albicans 212 aa - Secretory Stress Response
                  9023.3      |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
                  mPhr1       |experimentally validated by us| C albicans |CA4857| 548 aa
                  mCrh11      |predicted| C. albicans |CA0375|: 453 aa
                  mALS1.5eoc  |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  19516.2     |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
                  8527.1      |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
                  mRBT5       |predicted| C. albicans fungus|CA2558| 241 aa
                  mPga24      |predicted| mIPF5185 C. albicans |CA1678| 533 aa
                  mUTR2       |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase
                  mPga36.1    |predicted1| mIPF10662| C. albicans fungus|CA3827| 392 aa

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 31 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mALS3.5eoc                        Mass: 94266    Score: 396    Queries matched: 9
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
30   546.88   1091.74   1091.56   0.17 0  46  0.0024 1  K.ISINVDFER.S
65   695.94   1389.86   1390.64   -0.78 0  78  1.1e-006 1  K.TCSSNGIFITYK.N + Deamidation (NQ)
66   696.43   1390.85   1390.64   0.20 0  (36) 0.018 1  K.TCSSNGIFITYK.N + Deamidation (NQ)
90   845.51   1689.00   1688.75   0.25 0  104  3.1e-009 1  K.CFTAGTNTVTFNDGGK.K
91   564.68   1691.03   1690.85   0.18 0  128  1.4e-011 1  K.FTTSQTSVDLTAHGVK.Y
92   846.55   1691.08   1690.85   0.23 0  (127) 2.2e-011 1  K.FTTSQTSVDLTAHGVK.Y
93   564.71   1691.11   1690.85   0.26 0  (14) 4.4 1  K.FTTSQTSVDLTAHGVK.Y
94   846.58   1691.15   1691.84   -0.69 0  (107) 2.4e-009 1  K.FTTSQTSVDLTAHGVK.Y + Deamidation (NQ)
101   606.71   1817.11   1816.84   0.27 1  46  0.0022 1  K.CFTAGTNTVTFNDGGKK.I

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 396    Queries matched: 9
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 396    Queries matched: 9
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928

2.    mSod5/Pga3                        Mass: 22006    Score: 144    Queries matched: 4
 |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
40   568.35   1134.68   1134.51   0.17 0  79  9.2e-007 1  K.HGNIMGESYK.T
41   568.39   1134.76   1135.50   -0.73 0  (39) 0.013 1  K.HGNIMGESYK.T + Deamidation (NQ)
67   704.46   1406.91   1406.72   0.19 0  45  0.0032 1  R.AATPAAHEVGDLAGK.H
81   788.97   1575.92   1575.69   0.23 0  22  0.43 1  K.TEYDDSYISLNEK.S

 
      Proteins matching the same set of peptides:
      1222.2                            Mass: 23689    Score: 144    Queries matched: 4
 |Pga3/Sod5| CONTIG=Contig10139 POSCDS1=124618 POSCDS2=125304
      25296.1                           Mass: 26345    Score: 144    Queries matched: 4
 CONTIG=Contig20139 POSCDS1=124373 POSCDS2=125059
3.    mCHT2                             Mass: 59565    Score: 138    Queries matched: 2
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
13   497.83   993.65   993.49   0.15 0  48  0.001 1  K.FADTLWNK.F
108   968.10   1934.18   1934.89   -0.71 0  92  5.5e-008 1  -.SNQVALYWGQNGAGGQER.L + Deamidation (NQ)

4.    mSSR1                             Mass: 20690    Score: 106    Queries matched: 1
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
86   814.97   1627.93   1627.70   0.23 0  108  1e-009 1  K.CSGLNDLSCICTTK.N

 
      Proteins matching the same set of peptides:
      3054.1                            Mass: 22993    Score: 106    Queries matched: 1
 |Ssr1| CONTIG=Contig10262 POSCDS1=71490 POSCDS2=72194
5.    9023.3                            Mass: 33980    Score: 87     Queries matched: 2
 |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
42   573.90   1145.78   1145.60   0.17 0  71  6.7e-006 1  K.SNQQAAISSIK.S
78   759.94   1517.87   1517.65   0.22 0  17  1.3 1  K.GITYSPYSDNGGCK.S

 
      Proteins matching the same set of peptides:
      15898.1                           Mass: 39582    Score: 87     Queries matched: 2
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
      m15898.1|mSCW1:                   Mass: 35901    Score: 87     Queries matched: 2
 346 aa - glucanase (by homology) Candida albicans
6.    mPhr1                             Mass: 58075    Score: 86     Queries matched: 4
 |experimentally validated by us| C albicans |CA4857| 548 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
21   520.35   1038.68   1038.50   0.19 0  53  0.00035 1  R.SNTDASAFVK.A
77   503.65   1507.92   1507.67   0.24 1  17  1.4 1  K.YNDPLADADACKR.D
102   617.37   1849.08   1848.80   0.27 1  12  4.3 1  R.VYAIDPDKDHEECMK.I
115   790.81   2369.41   2369.09   0.32 1  10  7.2 1  R.GIAYQQDAAGSVSSGYDADPNRK.Y

 
      Proteins matching the same set of peptides:
      15932.2                           Mass: 60276    Score: 86     Queries matched: 4
 |Phr1| CONTIG=Contig10192 POSCDS1=117957 POSCDS2=119603
      23455.1                           Mass: 60747    Score: 86     Queries matched: 4
 CONTIG=Contig20192 POSCDS1=117993 POSCDS2=119639
7.    mCrh11                            Mass: 44667    Score: 72     Queries matched: 3
 |predicted| C. albicans |CA0375|: 453 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
47   592.90   1183.78   1183.60   0.18 0  47  0.0013 1  R.GGYHDIANPLK.D
75   487.98   1460.91   1460.69   0.22 0  9  11 1  K.FDNGLGPHFESLK.K + Deamidation (NQ)
85   805.51   1609.00   1608.77   0.23 0  18  1.3 1  K.QGTIDSGSNGLSLTMK.K + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      14360.2                           Mass: 46818    Score: 72     Queries matched: 3
 |Crh11| CONTIG=Contig10158 POSCDS1=92919 POSCDS2=94280
      24611.1                           Mass: 47890    Score: 72     Queries matched: 3
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
8.    mALS1.5eoc                        Mass: 69052    Score: 72     Queries matched: 3
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
27   532.37   1062.74   1062.58   0.15 0  11  7 1  R.SQSKPFTLR.W
38   561.38   1120.74   1120.55   0.18 0  21  0.67 1  K.TCTSNGIQIK.Y
70   708.45   1414.88   1414.67   0.21 0  40  0.0077 1  K.STVDPSGYLYASR.V

 
      Proteins matching the same set of peptides:
      13002.2                           Mass: 133694   Score: 72     Queries matched: 3
 |Als1| CONTIG=Contig10233 POSCDS1=72223 POSCDS2=76005
      21498.1                           Mass: 133402   Score: 72     Queries matched: 3
 |Als1| CONTIG=Contig20233 POSCDS1=71475 POSCDS2=75257
9.    19516.2                           Mass: 94340    Score: 62     Queries matched: 2
 |Hyr1| CONTIG=Contig10216 POSCDS1=152086 POSCDS2=154845
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   472.82   943.63   943.48   0.15 0  37  0.014 1  K.STAYLYAR.E
37   557.87   1113.72   1113.56   0.17 0  25  0.2 1  R.GGIQGFHGDVK.V

 
      Proteins matching the same set of peptides:
      mIPF19516                         Mass: 90303    Score: 62     Queries matched: 2
 |mHYR1| validated by us| C. albicans fungus|CA1576| 900 aa
      19734.1                           Mass: 94169    Score: 62     Queries matched: 2
 |Hyr1| CONTIG=Contig20216 POSCDS1=152490 POSCDS2=155303
      m19734.1                          Mass: 91992    Score: 62     Queries matched: 2
 |mHyr1| validated by us| C. albicans fungus 917 aa
10.   8527.1                            Mass: 21461    Score: 62     Queries matched: 2
 |Pga29| CONTIG=Contig10225 POSCDS1=30293 POSCDS2=30907
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
59   679.98   1357.95   1357.75   0.20 1  62  7.5e-005 1  K.KTDDSAPITIVAK.F
60   453.66   1357.97   1357.75   0.23 1  (13) 5.1 1  K.KTDDSAPITIVAK.F

 
      Proteins matching the same set of peptides:
      mIPF8527|mPga29:                  Mass: 19928    Score: 62     Queries matched: 2
 189 aa - Candida albicans unknown function
      21875.1                           Mass: 22824    Score: 62     Queries matched: 2
 CONTIG=Contig20225 POSCDS1=30286 POSCDS2=30900
11.   mRBT5                             Mass: 22745    Score: 50     Queries matched: 2
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
49   618.90   1235.78   1235.59   0.19 0  51  0.00051 1  R.IYDQLPECAK.E
50   618.90   1235.78   1235.59   0.20 0  (14) 2.6 1  R.IYDQLPECAK.E

 
      Proteins matching the same set of peptides:
      mPga10                            Mass: 23610    Score: 50     Queries matched: 2
 |predicted| C. albicans fungus|CA4381|mIPF20169: 250 aa
      19952.1                           Mass: 24614    Score: 50     Queries matched: 2
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      20169.1                           Mass: 25603    Score: 50     Queries matched: 2
 |Pga10| CONTIG=Contig10231 POSCDS1=59560 POSCDS2=60312
      21543.1                           Mass: 25731    Score: 50     Queries matched: 2
 CONTIG=Contig20231 POSCDS1=59564 POSCDS2=60316
      21544.1                           Mass: 25457    Score: 50     Queries matched: 2
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
12.   mPga24                            Mass: 52805    Score: 48     Queries matched: 2
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
53   635.93   1269.85   1269.64   0.21 0  48  0.0012 1  K.VITVVACDEHK.C
54   635.93   1269.85   1269.64   0.21 0  (13) 4.2 1  K.VITVVACDEHK.C

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 48     Queries matched: 2
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 48     Queries matched: 2
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
13.   mUTR2                             Mass: 49676    Score: 47     Queries matched: 1
 |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
39   563.85   1125.69   1125.51   0.18 0  47  0.0012 1  R.YDYPQTPSR.I

 
      Proteins matching the same set of peptides:
      8080.2                            Mass: 52187    Score: 47     Queries matched: 1
 |Utr2| CONTIG=Contig20123 POSCDS1=148155 POSCDS2=149567
      29345.1                           Mass: 54908    Score: 47     Queries matched: 1
 CONTIG=Contig10123 POSCDS1=148333 POSCDS2=149745
14.   mPga36.1                          Mass: 35596    Score: 45     Queries matched: 1
 |predicted1| mIPF10662| C. albicans fungus|CA3827| 392 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
105   935.04   1868.08   1867.82   0.25 0  46  0.0015 1  K.QQSCGGTDDVSSQSATLK.C

 
      Proteins matching the same set of peptides:
      mPga36.2                          Mass: 35170    Score: 45     Queries matched: 1
 |predicted2| mIPF10662| C. albicans fungus|CA3827| 392 aa
      10662.2                           Mass: 37379    Score: 45     Queries matched: 1
 |Pga36| CONTIG=Contig10233 POSCDS1=119212 POSCDS2=120390
      21466.1                           Mass: 39845    Score: 45     Queries matched: 1
 CONTIG=Contig20233 POSCDS1=118488 POSCDS2=119666
15.   8325.2                            Mass: 8775     Score: 28     Queries matched: 2
 CONTIG=Contig10173 POSCDS1=69682 POSCDS2=69921
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   493.37   984.73   984.56   0.17 0  26  0.19 1  R.LAQQDGLLK.N
 46   584.90   1167.79   1167.62   0.17 0  2  46 3  K.DHASVQISIAK.V

 
      Proteins matching the same set of peptides:
      23913.1                           Mass: 8775     Score: 28     Queries matched: 2
 CONTIG=Contig20173 POSCDS1=69681 POSCDS2=69920
16.   Sun41                             Mass: 44292    Score: 21     Queries matched: 1
 |14577.2 CONTIG=Contig10185 POSCDS1=2766 POSCDS2=4022
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
24   524.86   1047.70   1047.54   0.17 0  21  0.65 1  K.LSETVAICR.T

 
      Proteins matching the same set of peptides:
      mSUN41                            Mass: 37529    Score: 21     Queries matched: 1
 |predicted NN| C. albicans fungus|CA0883|SUN41: 396 aa DNKNIKREDCDKTSFHGHHKHKRAVAYDYAYVTVTVD
      mSUN41_HMM                        Mass: 37529    Score: 21     Queries matched: 1
 |predicted HMM| C. albicans fungus|CA0883|SUN41: 402 aa APAFEADNKNIKREDCDKTSFHGHHKHKRAVAYDYAYVTVTVD
      23637.1                           Mass: 44492    Score: 21     Queries matched: 1
 CONTIG=Contig20185 POSCDS1=2766 POSCDS2=4022
17.   4692.2                            Mass: 9119     Score: 20     Queries matched: 1
 CONTIG=Contig2020 POSCDS1=2636 POSCDS2=2875
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   730.62   729.61   730.37   -0.76 0  20  1.3 1  K.GSAVQNR.L

18.   27852.1                           Score: 17     Queries matched: 1
 CONTIG=Contig10236 POSCDS1=206952 POSCDS2=207188
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 47   592.90   1183.78   1183.66   0.13 1  17  1.5 2  R.SDAKGAINAPIK.V

19.   572.2                             Score: 16     Queries matched: 2
 CONTIG=Contig2518 POSCDS1=190144 POSCDS2=195330
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 42   573.90   1145.78   1145.59   0.19 1  13  4.5 2  R.DVNKTIQEAK.Q + Deamidation (NQ)
 52   633.44   1264.86   1264.61   0.25 1  7  19 3  R.DTAGRSAEMSLK.D

20.   12729.2                           Mass: 128342   Score: 15     Queries matched: 4
 CONTIG=Contig10218 POSCDS1=112046 POSCDS2=115486
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 31   547.36   1092.70   1092.53   0.17 1  6  17 7  R.QQSVSKASQK.S + 3 Deamidation (NQ)
 33   547.36   1092.71   1092.53   0.18 1  (2) 45 8  R.QQSVSKASQK.S + 3 Deamidation (NQ)
 34   547.40   1092.79   1092.53   0.26 1  (6) 27 4  R.QQSVSKASQK.S + 3 Deamidation (NQ)
52   633.44   1264.86   1264.54   0.32 0  12  7.2 1  K.QMQGQINGQMK.E + 3 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      22178.1                           Mass: 129971   Score: 15     Queries matched: 4
 CONTIG=Contig20218 POSCDS1=111780 POSCDS2=115220
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
20   513.88   1025.74   1025.45   0.29 0  15  2.6 1  WDNSNVYK + Deamidation (NQ)
19   511.86   1021.71   1021.44   0.27 0  15  3.1 1  SELQECQK + Deamidation (NQ)
44   580.92   1159.83   1159.57   0.26 1  15  3.7 1  GDDNIEKQIK + Deamidation (NQ)
34   547.40   1092.79   1093.51   -0.72 0  14  4.4 1  MAGFPENALK + Deamidation (NQ); Oxidation (M)
32   547.36   1092.70   1092.56   0.15 1  14  3.2 1  FAQKLSQDR + Deamidation (NQ)
23   523.37   1044.73   1044.56   0.18 0  13  4.5 1  LSSPATLNSR
35   549.83   1097.65   1097.51   0.14 0  12  3.1 1  NFIFNNSNK + Deamidation (NQ)
31   547.36   1092.70   1092.53   0.17 0  12  4.6 1  MAGFPENALK + Oxidation (M)
11   491.33   980.65   980.48   0.17 0  11  5.6 1  VEGYTVGEK
26   530.39   1058.77   1058.56   0.21 0  11  8.9 1  NALTNPSLTK + Deamidation (NQ)
104   932.02   1862.03   1862.01   0.03 1  10  5.5 1  GTTPFIMLRSQIIQTR + Deamidation (NQ)
125   1461.28   2920.55   2920.50   0.05 1  10  5.6 1  QFQLFMSLTTYIDRLSLWDTLSVK + Oxidation (M)
9   463.83   925.64   926.42   -0.78 1  10  6 1  NKQFNMK + 2 Deamidation (NQ); Oxidation (M)
129   1023.92   3068.75   3068.45   0.30 0  9  7.6 1  VVMSMTNQLDSMILIFQTLHNNASTTR + 4 Deamidation (NQ)
136   1233.03   3696.06   3696.72   -0.66 1  9  7.6 1  TNFVVDFGDMTRFHPLQQCEPLMDLSWLER + Oxidation (M)
56   1312.56   1311.55   1311.70   -0.15 1  8  9.1 1  NPLIVNEQQKK + 2 Deamidation (NQ)
74   722.48   1442.95   1442.67   0.28 1  8  14 1  TVNMNFESRVTK + 2 Deamidation (NQ); Oxidation (M)
117   837.46   2509.37   2510.09   -0.72 0  8  10 1  NVNINNNVNDNVNDNFMTSNIK + 4 Deamidation (NQ)
33   547.36   1092.71   1092.53   0.18 0  7  14 1  MAGFPENALK + Oxidation (M)
127   978.23   2931.67   2932.24   -0.57 0  7  13 1  FSPATTPEDLAMQQETNNTQYVSNNK + 5 Deamidation (NQ)
71   716.97   1431.93   1432.65   -0.72 0  6  21 1  ALQMEANELEER + Deamidation (NQ)
73   717.02   1432.03   1431.84   0.19 1  6  28 1  RVYLVLTNVNLK + Deamidation (NQ)
51   623.38   1244.74   1244.62   0.12 0  6  15 1  QGETEEALIQK
83   532.34   1594.00   1593.95   0.05 1  5  27 1  KFFNISVVIVTLSK
7   457.86   913.71   913.57   0.14 1  5  28 1  QLSIGKLR
88   552.70   1655.08   1654.81   0.28 1  5  31 1  NIWNTLNQAAHRSK + 3 Deamidation (NQ)
69   469.98   1406.93   1407.68   -0.75 1  5  34 1  TLRESTSPSESSK
14   499.31   996.60   996.56   0.04 0  4  18 1  NILDIVPGR + Deamidation (NQ)
141   1341.09   4020.25   4021.03   -0.78 1  4  20 1  GLQIANYSVVPLSDHFGIIEFVMNVQTMKGVISEQR + 2 Deamidation (NQ)
103   931.53   1861.04   1861.84   -0.80 0  4  27 1  NQNNFLEPPTGCLQVK + 4 Deamidation (NQ)
36   552.77   1103.53   1103.52   0.00 0  3  30 1  ETTIHNFNK + Deamidation (NQ)
46   584.90   1167.79   1167.51   0.28 1  3  34 1  MSNSNINNKK + 3 Deamidation (NQ); Oxidation (M)
99   869.55   1737.08   1736.85   0.23 1  3  41 1  LSAVANGKFVSQQQQK + 5 Deamidation (NQ)
8   463.80   925.59   925.53   0.05 1  3  23 1  VHSNTIKK
29   534.35   1066.69   1067.46   -0.77 0  3  32 1  TMNQSMVQK + 2 Deamidation (NQ)
76   732.95   1463.89   1463.70   0.19 1  3  38 1  IQKGNELNDYDR
18   510.85   1019.70   1019.42   0.28 0  3  46 1  ANNNNNLSR + 4 Deamidation (NQ)
119   870.16   2607.44   2608.07   -0.63 0  3  34 1  QCYSCGDVGHIQTECPNQAQGAK + Deamidation (NQ)
45   582.89   1163.76   1163.61   0.15 1  3  42 1  QGTGTSASSIKK
138   1302.42   3904.23   3903.63   0.59 1  3  32 1  LSSNKYIIDYDNNNNNNNNNNQDDNNDSISIPTK + 6 Deamidation (NQ)
121   1380.24   2758.47   2759.20   -0.73 1  2  30 1  YNKYYCTMCLASSCSPSSLPLQK + 2 Deamidation (NQ)
113   1112.62   2223.23   2223.90   -0.67 1  2  38 1  LEQSEEEQQQQQQNKDTK + 7 Deamidation (NQ)
120   891.49   2671.46   2671.11   0.35 0  2  41 1  CTCASDVMLQSCGFITIFEECK + Oxidation (M)
55   654.36   1306.70   1306.55   0.15 1  2  36 1  KLGSDNNDGQQK + 4 Deamidation (NQ)
17   507.34   1012.66   1013.44   -0.78 0  2  36 1  LYEMESDK
144   1400.46   4198.37   4197.78   0.58 0  1  37 1  VEGLSNLSCMEIDPEAAMSDLQQQAQQYNNDPNDPLK + 4 Deamidation (NQ); 2 Oxidation (M)
109   993.12   1984.22   1984.90   -0.68 1  1  65 1  DVSWDANVVDNEHLNKK + 3 Deamidation (NQ)
142   1352.44   4054.31   4054.76   -0.45 1  1  41 1  QQEQHLSDVDNDKLSSSSNQQQQDAHETVLEEQEK + 4 Deamidation (NQ)
84   535.66   1603.97   1603.73   0.24 0  1  66 1  ENSNSTNPELLETR + Deamidation (NQ)
122   924.21   2769.61   2769.27   0.33 1  1  57 1  VDATTQTQYDEISSNKANPINQVTK + 5 Deamidation (NQ)
112   1074.15   2146.29   2146.05   0.24 1  1  74 1  DLNKMLEQLNQTDVEINK + 2 Deamidation (NQ)
25   529.84   1057.66   1057.57   0.09 0  1  51 1  LADAIEANLK + Deamidation (NQ)
80   788.47   1574.93   1574.83   0.09 0  1  55 1  DSVAPPPPPVPDFIK
110   1031.59   2061.16   2061.01   0.14 0  0  61 1  AELVNLIGVSGSANSTGDVQK + 3 Deamidation (NQ)
72   478.32   1431.95   1431.80   0.15 1  0  92 1  MALKSVLVQIGEK + Deamidation (NQ); Oxidation (M)
1   478.31   477.30        
2   540.39   539.38        
3   544.99   543.99        
4   566.35   565.34        
6   894.54   893.53        
15   499.81   997.60        
16   504.86   1007.71        
22   520.87   1039.72        
28   534.35   1066.68        
43   1152.73   1151.72        
48   1232.11   1231.10        
57   1338.35   1337.35        
58   1356.26   1355.26        
61   1359.27   1358.26        
62   1370.90   1369.89        
63   1385.66   1384.65        
64   1388.69   1387.68        
68   469.98   1406.92        
79   775.49   1548.97        
82   798.01   1594.00        
87   549.98   1646.93        
89   558.71   1673.10        
95   565.34   1693.01        
96   565.35   1693.03        
97   570.72   1709.13        
98   577.37   1729.08        
100   582.36   1744.05        
106   950.56   1899.10        
107   954.06   1906.10        
111   1035.11   2068.20        
114   783.12   2346.34        
116   1218.16   2434.30        
118   857.47   2569.39        
123   952.84   2855.49        
124   718.90   2871.56        
126   974.53   2920.56        
128   1000.56   2998.65        
130   1082.27   3243.78        
131   1124.97   3371.90        
132   1179.01   3534.01        
133   1190.30   3567.88        
134   1192.81   3575.41        
135   1201.03   3600.08        
137   1287.05   3858.14        
139   1314.71   3941.11        
140   1326.23   3975.66        
143   1390.96   4169.86        
145   1433.66   4297.95        
146   1473.91   4418.70        
147   1393.13   5568.49        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 147

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Score greater than 7 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 14 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 3
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 4
Score greater than 21 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 5
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 19.7   -0.76   17  4692.2 K.GSAVQNR.L
Top scoring peptide matches to query 6
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 7
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.9    0.14        K.QLSIGKLR.H
  4.9    0.15        R.QTVAVGVIK.S
  3.2    0.26        K.AKEYFEK.M
  1.6   -0.77        K.NTNVPDKK.K
  1.6   -0.78        R.SNKVPQSR.S
Top scoring peptide matches to query 8
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.3    0.05        K.VHSNTIKK.E
  3.3    0.10        K.YFDILQK.S
Top scoring peptide matches to query 9
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.9   -0.78        K.NKQFNMK.L
  9.2   -0.78        R.NQYDLMK.E
  0.5    0.13        K.IPPTIEEK.R
  0.4    0.15        R.KLFQNFK.L
  0.3    0.15        R.KEFIFNK.Y
Top scoring peptide matches to query 10
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 36.6    0.15    9  19516.2 K.STAYLYAR.E
  5.7    0.18               K.AMGFNYIK.L
  5.7    0.15               K.KMNFYLK.E
  1.4    0.19               R.STLQHSNR.T
  0.0    0.12               K.STEPQVRK.R
Top scoring peptide matches to query 11
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.5    0.17        K.VEGYTVGEK.K
  5.3    0.09        K.TLALLEGHK.A
  5.2    0.17        R.ITSMIDSAK.E
  4.7    0.17        K.YGQVVETGK.F
  1.6    0.15        K.VDVINMFK.D
  1.6    0.16        R.VNFRMWK.H
  0.7    0.17        K.NLGYDITGK.V
  0.6    0.17        K.TLYIGNNGK.T
Top scoring peptide matches to query 12
Score greater than 26 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 26.3    0.17   15  8325.2 R.LAQQDGLLK.N
 12.5    0.12              R.AIKAGSGIIR.L
  7.1    0.14              R.LAQASARLR.F
  6.9    0.32              K.ENWDEHR.F
  2.6   -0.77              -.MAPRTPADK.L
Top scoring peptide matches to query 13
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 47.8    0.15    3  mCHT2 K.FADTLWNK.F
 14.8    0.23             -.MSNANQSNK.F
  9.6    0.23             -.MSNANQSNK.F
  9.6    0.23             -.MSNANQSNK.F
  8.0    0.19             K.FEGTEFHK.M
  7.1    0.21             K.FAVEDEQR.N
  6.5    0.07             R.FIWILFR.M
  4.8    0.19             -.MFIPNNNK.K
  4.8    0.19             -.MFIPNNNK.K
  4.5   -0.76             -.MSNANQSNK.F
Top scoring peptide matches to query 14
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.4    0.04        K.NILDIVPGR.V
Top scoring peptide matches to query 15
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 16
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 17
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.6   -0.78        K.LYEMESDK.A
  0.7    0.06        R.ALLRDAGIGK.I
  0.5    0.17        K.QIYEMSVK.E
Top scoring peptide matches to query 18
Score greater than 15 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.8    0.28        R.ANNNNNLSR.S
  2.8    0.28        K.GKNDVNNGNS.-
  2.8    0.28        K.GKNDVNNGNS.-
  2.8   -0.70        K.GKNDVNNGNS.-
  2.8    0.28        K.GKNDVNNGNS.-
  2.8   -0.70        K.GKNDVNNGNS.-
  2.8   -0.70        K.GKNDVNNGNS.-
  2.8    0.28        K.KGDDDDNNK.N
  2.8   -0.70        K.KGDDDDNNK.N
  2.8   -0.70        K.KGDDDDNNK.N
Top scoring peptide matches to query 19
Score greater than 27 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.7    0.27        K.SELQECQK.L
 14.7    0.22        K.SENTLNSKK.L
 14.7    0.21        -.SLHYSCKK.I
 14.7    0.26        M.SNSNINNKK.F
 14.3    0.27        K.NASSNNSGGSK.S
 14.3   -0.71        K.NASSNNSGGSK.S
 14.3   -0.71        K.NASSNNSGGSK.S
Top scoring peptide matches to query 20
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.8    0.29        K.WDNSNVYK.L
 14.8    0.29        K.WDNSNVYK.L
 13.1    0.15        K.SVDALVPIGR.G
Top scoring peptide matches to query 21
Score greater than 30 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 52.6    0.19    6  mPhr1 SNTDASAFVK
 46.9   -0.80    6  mPhr1 SNTDASAFVK
 13.8    0.20             K.SNSQRYQR.I
  8.3   -0.78             K.SNSQRYQR.I
  5.1    0.13             K.ITVHNGDRK.H
  5.1    0.17             -.QFVMVDRK.R
  5.1    0.14             R.QIEHLNRK.Y
  4.8    0.13             R.KPHESTGRK.L
  3.2    0.20             K.MNGATSMTVK.K
  1.8   -0.76             K.NSQSEYSPK.R
Top scoring peptide matches to query 22
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 23
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.0    0.18        K.LSSPATLNSR.V
 11.7    0.16        R.LSSHFVSIR.R
  7.8    0.19        -.VTAEQNIIR.M
  3.1    0.12        R.LRNPYIIR.Y
  2.7    0.22        K.ADTEQKQPK.-
  2.7    0.22        K.ADTEQKQPK.-
  2.3    0.21        K.EAEADKNLR.S
  2.3    0.27        K.QASLSMHDR.D
  2.3    0.18        K.SLQGDSGLIR.K
  2.1   -0.77        R.VAQTENLNR.S
Top scoring peptide matches to query 24
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 21.0    0.17   16  Sun41 K.LSETVAICR.T
 11.3    0.10             K.LSMVLSLGTK.A
  1.6   -0.74             K.NSDVDQTNR.L
  1.6   -0.74             K.NSDVDQTNR.L
  1.1    0.13             R.LSGRLPYNK.E
  1.1   -0.75             K.NSVNMNEEI.-
  1.1    0.16             R.ISDGSLLTNK.Y
  1.0    0.10             K.LSAEKVVFR.V
  0.4    0.18             K.ISLDNDMIK.Q
  0.4    0.10             R.LSLEKMLSK.I
Top scoring peptide matches to query 25
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.7    0.09        K.LADAIEANLK.I
Top scoring peptide matches to query 26
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.5    0.21        K.NALTNPSLTK.D
  5.4    0.25        K.ADENDAVVVK.K
  0.5    0.21        K.VSQDLADAIK.K
Top scoring peptide matches to query 27
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 11.0    0.15    8  mALS1.5eoc R.SQSKPFTLR.W
  3.0    0.22                  K.IMNNGTKQR.E
  2.5    0.19                  R.FENIQQKR.L
  2.5    0.19                  R.FENIQQKR.L
  2.5    0.15                  R.LYDQLQKR.G
  2.1    0.17                  K.SAKSGQISSAK.I
  0.3   -0.79                  R.FENIQQKR.L
  0.2    0.24                  K.SNQTELDTR.L
  0.2    0.12                  R.SYLLRINGK.V
  0.1    0.14                  K.KTLASLQSSK.S
Top scoring peptide matches to query 28
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 29
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.1   -0.77        K.TMNQSMVQK.F
  1.6    0.15        K.YKTNTQGVR.T
  0.8    0.15        K.YKTNTQGVR.T
  0.1    0.20        K.YQAENTVDK.L
Top scoring peptide matches to query 30
Score greater than 26 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 46.0    0.17    1  mALS3.5eoc K.ISINVDFER.S
 10.7   -0.73                  K.NSLNDASSER.E
  9.6    0.10                  K.LSILSGFISR.L
  9.0    0.11                  R.ISIGSIDLFK.L
  9.0    0.14                  K.ISLETLFNR.W
  9.0    0.23                  K.IAENSKCDR.K
  2.5    0.08                  R.TVLIDKYLK.R
Top scoring peptide matches to query 31
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.1    0.17               R.MAGFPENALK.A
 11.4    0.12               R.FAESKVAVDK.I
  7.2    0.08               R.TVVGAPPPVEK.E
  6.9    0.19               K.SMKIDQENK.F
  6.9    0.19               K.SMKIDQENK.F
  6.4    0.19               -.MSQEDLLTR.V
  6.4    0.17   20  12729.2 R.QQSVSKASQK.S
  5.5    0.15               R.FAQKLSQDR.N
  5.4   -0.78               R.YGLCGPNGAGK.S
  5.2    0.11               -.MSITRLSSAK.L
Top scoring peptide matches to query 32
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.8    0.15        R.FAQKLSQDR.N
 11.7    0.12        R.KFADIGNTVK.K
 11.0    0.18        R.MAGFPENALK.A
  9.7    0.19        -.MSQEDLLTR.V
  9.4    0.13        R.FAGCGSLLLR.T
  8.4    0.21        K.QSSELSNAQK.N
  7.9    0.12        K.FADIGNTVKK.Q
  7.1    0.11        K.FKSWVEAVK.E
  6.7    0.16        K.SIFNQLNEK.S
  5.9    0.24        K.SNDQTQANSK.L
Top scoring peptide matches to query 33
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.4    0.18               R.MAGFPENALK.A
  6.0    0.13               R.KFADIGNTVK.K
  5.0    0.22               K.ASTAESEAAQK.L
  4.7    0.15               R.FAQKLSQDR.N
  4.7    0.20               K.SMKIDQENK.F
  4.7    0.20               K.SMKIDQENK.F
  3.0    0.19               R.NSNHRHATR.V
  2.4    0.18   20  12729.2 R.QQSVSKASQK.S
  1.4    0.14               R.FAGCGSLLLR.T
  1.0    0.19               R.NSNHRHATR.V
Top scoring peptide matches to query 34
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.0   -0.72               R.MAGFPENALK.A
 13.3   -0.74               K.SIFNQLNEK.S
  6.6   -0.74               K.SIFNQLNEK.S
  6.1    0.26   20  12729.2 R.QQSVSKASQK.S
  5.6   -0.70               K.SMKIDQENK.F
  5.5   -0.73               K.SIFNHGYQK.Y
  4.9    0.21               R.KFADIGNTVK.K
  4.7   -0.66               K.SNDQTQANSK.L
  4.3   -0.74               K.SIFNQLNEK.S
  3.2   -0.71               R.SNVEYGPSNK.A
Top scoring peptide matches to query 35
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.2    0.14        K.NFIFNNSNK.D
  9.7    0.14        R.TCSLVFEDK.I
  7.3    0.18        K.NNFQIMSNK.F
  7.3    0.18        K.NNFQIMSNK.F
  6.8    0.17        R.EAFASPMSSR.R
  6.1    0.11        K.FNDTFVINK.Q
  6.1    0.24        -.MNQNNAMNK.Y
  6.1    0.24        -.MNQNNAMNK.Y
  6.1    0.24        -.MNQNNAMNK.Y
  4.4    0.21        R.FDCKNGDNK.R
Top scoring peptide matches to query 36
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.4    0.00        K.ETTIHNFNK.N
  2.4   -0.12        K.MIILDKMLK.K
Top scoring peptide matches to query 37
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.3    0.17    9  19516.2 R.GGIQGFHGDVK.V
  9.3    0.09               K.INKEVNLGVK.Y
  6.5    0.07               K.GSLLLAWQVK.D
  2.6    0.19               R.TLFMTGNSVK.Q
  2.3    0.07               R.CITAPVKVVK.K
  2.3    0.19               -.EAAFFNSTVK.S
  2.3    0.19               K.EKEHQESVK.K
  2.3    0.17               R.FSKYMPDVK.T
  2.3    0.11               R.HLDDLFKVK.K
  2.3    0.18               K.HMMQRPAVK.R
Top scoring peptide matches to query 38
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 21.0    0.18    8  mALS1.5eoc K.TCTSNGIQIK.Y
  9.2   -0.79                  R.FNIIDEQDK.D
  5.9    0.18                  -.MIQNVTRDK.L
  5.1    0.18                  -.MIQNVTRDK.L
  4.9    0.29                  K.EPDDAGSTSDK.N
  4.4    0.24                  K.TDNGNAGTKNK.G
  4.4    0.16                  K.FLINNEKNK.T
  4.4    0.16                  K.FLINNEKNK.T
  3.5    0.18                  K.MVRVDASQSK.L
  3.4    0.29                  K.ESEQEQEDK.D
Top scoring peptide matches to query 39
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 46.6    0.18   13  mUTR2 R.YDYPQTPSR.I
  8.7    0.18             K.YNDITCIAR.T
  2.0    0.14             -.YLFDELNGR.L
  0.3    0.17             K.YNSQLKENK.E
  0.0    0.12             K.YNNLLNFVK.R
Top scoring peptide matches to query 40
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 78.6    0.17    2  mSod5/Pga3 K.HGNIMGESYK.T
 10.0    0.15                  R.HASINSTDYK.S
  5.3    0.08                  K.EIVLYAHYK.K
  5.0    0.08                  R.QVSRQLFQK.A
  4.8    0.16                  R.QINLMNEEK.R
  4.3    0.09                  K.SVIQTAIQMK.T
  3.7    0.12                  R.ENFKEVQNK.Y
  3.2    0.09                  K.EGGLDQYLLK.S
  3.0    0.02                  M.QIFVKTLTGK.T
  2.5    0.10                  K.WSINNFINK.D
Top scoring peptide matches to query 41
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 38.6   -0.73    2  mSod5/Pga3 K.HGNIMGESYK.T
 16.7    0.25    2  mSod5/Pga3 K.HGNIMGESYK.T
  5.8   -0.75                  R.HASINSTDYK.S
  0.9   -0.78                  R.NGLEANIEFK.T
Top scoring peptide matches to query 42
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 71.5    0.17    5  9023.3 K.SNQQAAISSIK.S
 13.1    0.19   19  572.2  R.DVNKTIQEAK.Q
 13.1    0.17              R.NGPSMILSSIK.L
 10.1    0.15              R.NSKLDISQIK.D
  8.7    0.17              R.NKSQNDSLLK.A
  3.4    0.15              K.KLQINNSLSK.L
  3.3    0.19              R.ELSLNNELSK.E
  3.0    0.22              K.QPSTPATQTSK.R
  2.8    0.15              K.KLQINNSLSK.L
  2.2    0.19              R.NGELGAIGSSIK.R
Top scoring peptide matches to query 43
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 44
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.7    0.26        K.GDDNIEKQIK.E
 10.2    0.21        K.SIRQIDNVSK.S
  8.5    0.22        R.TVEDKALAEGK.V
  8.4    0.22        K.SLSVSDPSIQK.N
  8.3    0.24        K.QAVKTDPCLK.Y
  7.4    0.13        -.ILQFLGSIIR.M
  7.1    0.26        R.LSANQALEDAK.H
  7.1    0.26        R.LSANQALEDAK.H
  6.9    0.15        R.AQVGITKLTTK.T
  6.8   -0.78        K.SNQIKSNQIK.L
Top scoring peptide matches to query 45
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7    0.15        K.QGTGTSASSIKK.S
Top scoring peptide matches to query 46
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.4    0.28              -.MSNSNINNKK.F
  2.7    0.28              -.MSNSNINNKK.F
  2.1    0.17   15  8325.2 K.DHASVQISIAK.V
  1.2    0.23              K.SLEQTSFDLK.S
  1.1    0.26              K.FEEVLNSSDK.S
  1.0   -0.69              K.VSSACDNCKK.R
  0.4    0.28              K.MLDEQEKMK.S
  0.1    0.31              R.FGQTQNSNNR.T
  0.1    0.31              R.FGQTQNSNNR.T
  0.0    0.30              K.QESSSSGKNNK.D
Top scoring peptide matches to query 47
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 47.1    0.18    7  mCrh11  R.GGYHDIANPLK.D
 16.6    0.13   18  27852.1 R.SDAKGAINAPIK.V
 13.2    0.23               K.NYSNNNKTTK.I
 10.2   -0.75               K.NYSNNNKTTK.I
  9.4    0.09               K.FIPISPPSAKK.S
  8.3    0.16               K.SNPGNNQVLLK.Q
  8.3    0.23               R.KVNEAFSNMK.I
  8.0    0.11               K.SRLGIQQPSAK.E
  7.9    0.15               R.LHTYAQNLPK.E
  7.9    0.17               K.IQNNEIPIDK.Y
Top scoring peptide matches to query 48
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 49
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 51.4    0.19   11  mRBT5 IYDQLPECAK
 33.4   -0.79   11  mRBT5 IYDQLPECAK
  5.6    0.15             K.FENETELLLK.Y
  4.9    0.04             R.HRLLTEIINK.D
  4.4    0.13             K.GAGSFVNEKTVK.V
  3.9    0.18             K.INQFITNQQK.L
  3.2    0.14             K.IDYQSIQIEK.S
  2.6    0.26             K.FQPLNDQENK.E
  1.1    0.15             K.SQQQLQLFLK.I
  1.1    0.22             R.IQITMQENEK.I
Top scoring peptide matches to query 50
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 14.4    0.20   11  mRBT5 IYDQLPECAK
Top scoring peptide matches to query 51
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.8    0.12        -.QGETEEALIQK.R
Top scoring peptide matches to query 52
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.5    0.32   20  12729.2 K.QMQGQINGQMK.E
 11.5   -0.67   20  12729.2 K.QMQGQINGQMK.E
  7.3    0.25   19  572.2   R.DTAGRSAEMSLK.D
  5.1   -0.67               K.EAEEASTTEDGK.K
  1.4    0.13               RLQNPAAAPSLK
  1.0   -0.67               K.NGQCVEGLMQK.R
  0.5   -0.73               K.GEEYYDLHIK.H
  0.5    0.23               K.QAYDLLSAQEK.E
  0.5   -0.75               K.QAYDLLSAQEK.E
  0.2    0.32               K.NGQCVEGLMQK.R
Top scoring peptide matches to query 53
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 48.1    0.21   12  mPga24 K.VITVVACDEHK.C
  5.6    0.13              K.VITPSISDLTPK.I
  4.1    0.12              R.IVLSQVNEIQK.H
  3.5    0.13              K.VIKQPTMLGQR.M
  3.1    0.24              K.QGEPVALKPTDN.-
  1.8    0.21              R.SNISLPMVEHK.G
  1.6   -0.79              K.YHTRNSVALNP.-
Top scoring peptide matches to query 54
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.7    0.21   12  mPga24 K.VITVVACDEHK.C
  1.1   -0.77              R.QGMWEKVTHR.H
Top scoring peptide matches to query 55
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.0    0.15        K.KLGSDNNDGQQK.V
  0.7    0.01        K.KWEGQIGFITK.E
Top scoring peptide matches to query 56
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.3   -0.15        K.NPLIVNEQQKK.L
  8.3   -0.15        K.NPLIVNEQQKK.L
  8.3   -0.15        K.NPLIVNEQQKK.L
  8.3   -0.23        K.NPLLNLISISTK.H
Top scoring peptide matches to query 57
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 58
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 59
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 61.5    0.20   10  8527.1 K.KTDDSAPITIVAK.F
  7.3    0.23              K.EVRDIQSQLAAK.T
  5.2    0.26              K.QPTMPGLSSSPIK.E
  3.2    0.26              K.KPVDAAMIAEDAK.Q
  3.2    0.22              K.KFMNLIYVTTK.L
  1.8   -0.75              K.EVRDIQSQLAAK.T
  1.2    0.16              K.LLQRTESATVLK.G
Top scoring peptide matches to query 60
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 13.4    0.23   10  8527.1 K.KTDDSAPITIVAK.F
Top scoring peptide matches to query 61
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 62
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 63
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 64
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 65
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 78.0   -0.78    1  mALS3.5eoc K.TCSSNGIFITYK.N
 64.7    0.20    1  mALS3.5eoc K.TCSSNGIFITYK.N
 12.6   -0.76                  K.QKPKNNQNSNSK.T
 10.0    0.23                  K.QKPKNNQNSNSK.T
 10.0    0.23                  K.QKPKNNQNSNSK.T
  9.4   -0.75                  K.NMSHKLDGGDSSK.M
  8.8    0.23                  K.QKPKNNQNSNSK.T
  8.8    0.23                  K.QKPKNNQNSNSK.T
  7.8   -0.76                  K.QKPKNNQNSNSK.T
  7.8   -0.76                  K.QKPKNNQNSNSK.T
Top scoring peptide matches to query 66
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 36.1    0.20    1  mALS3.5eoc K.TCSSNGIFITYK.N
  8.4    0.23                  K.NMSHKLDGGDSSK.M
  3.0    0.23                  K.QKPKNNQNSNSK.T
  2.4    0.23                  K.QKPKNNQNSNSK.T
  2.0    0.18                  K.NFHHGRFFSSR.Y
  1.8   -0.72                  R.SSSSSSSSSSSSNSK.D
  0.4    0.15                  R.HLHLQEINGSSR.G
Top scoring peptide matches to query 67
Score greater than 15 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 44.5    0.19    2  mSod5/Pga3 R.AATPAAHEVGDLAGK.H
  0.2   -0.76                  R.IWLTNCEESKK.L
Top scoring peptide matches to query 68
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 69
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.7   -0.75        K.TLRESTSPSESSK.S
  4.5   -0.77        R.NQLSNEALFSRK.N
  4.5   -0.77        R.NQLSNEALFSRK.N
  4.5   -0.77        R.NQLSNEALFSRK.N
  0.9    0.19        K.YDQKPSIKNVSK.E
  0.2    0.32        R.QNQGDWMGVVSGK.G
  0.2    0.32        R.QNQGDWMGVVSGK.G
  0.2    0.32        R.QNQGDWMGVVSGK.G
  0.1    0.32        R.VYDIDNPDWDR.W
Top scoring peptide matches to query 70
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 39.8    0.21    8  mALS1.5eoc K.STVDPSGYLYASR.V
 10.3    0.23                  K.STVDQSGYLTTSR.F
  3.9    0.10                  K.LRTDLLETADIR.R
  3.4    0.25                  K.TSDVMETVFQDK.K
  3.3    0.24                  -.STTMQDSFDQKK.Q
  1.8    0.24                  R.ISSYSSCLDLNR.C
  1.3   -0.74                  -.STTMQDSFDQKK.Q
  0.8    0.19                  K.TTSPLPNVSNINR.Q
  0.5   -0.73                  R.NPTENNNEPRTK.K
  0.5   -0.73                  R.NPTENNNEPRTK.K
Top scoring peptide matches to query 71
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.2   -0.72        K.ALQMEANELEER.K
  4.1   -0.80        K.DIFEGLYASKYK.T
  2.5   -0.72        K.ALQMEANELEER.K
  2.2    0.21        K.QSPVSSTGVDVSIR.D
  2.1    0.30        K.GESTPGPSGASNAGSR.R
  1.9    0.16        K.KLSALSLNQTMPK.K
  1.9    0.12        K.IFNTIGEILEKR.L
  1.9    0.27        K.TRCLQCHTVEK.G
  1.8    0.14        K.ILSICFLNPISR.H
  1.6   -0.73        K.FVEQSVNSFTMK.F
Top scoring peptide matches to query 72
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.1    0.15        R.MALKSVLVQIGEK.Y
Top scoring peptide matches to query 73
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.0    0.19        K.RVYLVLTNVNLK.V
  3.9    0.40        K.QDQTQATPGNIEK.D
  3.4    0.32        R.ECEGNIRGGISIK.I
  2.5   -0.76        K.FNLLQEQLTISK.I
  1.9    0.31        K.EFPENELVQLSK.R
  0.6   -0.63        K.LQSQSQSPEGLEK.Q
  0.4    0.35        K.GEESVEQGENKVK.A
  0.1   -0.66        R.ANNVFNQVNGEVK.T
  0.1   -0.66        R.ANNVFNQVNGEVK.T
Top scoring peptide matches to query 74
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.2    0.28        K.TVNMNFESRVTK.L
  8.0   -0.77        R.MGQTFWIASLYK.F
  5.8    0.30        R.SRSSSTGHGDSTHK.R
  4.1    0.26        K.GNVQYVDFTGLTK.F
  3.3    0.32        K.NDSSLMVFSSNNK.K
  3.3    0.32        K.NDSSLMVFSSNNK.K
  1.6   -0.78        -.MVSSTLPPEEGLGK.Y
  0.7   -0.71        K.FLGMGRCDFVNK.S
  0.1    0.21        K.STPQSTNTPAAAVAK.S
Top scoring peptide matches to query 75
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.6    0.22    7  mCrh11 K.FDNGLGPHFESLK.K
Top scoring peptide matches to query 76
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.0    0.19        R.IQKGNELNDYDR.S
  3.0   -0.79        R.IQKGNELNDYDR.S
Top scoring peptide matches to query 77
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.1    0.24    6  mPhr1 K.YNDPLADADACKR.D
 17.1   -0.74    6  mPhr1 K.YNDPLADADACKR.D
  0.1    0.36             K.ESINNDDDDNDNK.E
  0.1    0.36             K.ESINNDDDDNDNK.E
  0.0    0.21             K.QKEFQGANIDDLK.N
Top scoring peptide matches to query 78
Score greater than 30 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.2    0.22    5  9023.3 K.GITYSPYSDNGGCK.S
Top scoring peptide matches to query 79
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 80
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.7    0.09        K.DSVAPPPPPVPDFIK.S
Top scoring peptide matches to query 81
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 21.8    0.23    2  mSod5/Pga3 K.TEYDDSYISLNEK.S
  2.1   -0.75    2  mSod5/Pga3 K.TEYDDSYISLNEK.S
Top scoring peptide matches to query 82
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 83
Score greater than 15 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3    0.05        R.KFFNISVVIVTLSK.M
  1.9    0.12        K.TIPPQWLQWLRR.T
  0.7   -0.79        K.DMGMSTLELNKVLK.R
  0.7   -0.79        K.DMGMSTLELNKVLK.R
  0.3    0.22        K.TGKSYMAENVLRPQ.-
Top scoring peptide matches to query 84
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8    0.24        K.ENSNSTNPELLETR.I
Top scoring peptide matches to query 85
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 18.1    0.23    7  mCrh11 K.QGTIDSGSNGLSLTMK.K
 15.3   -0.75    7  mCrh11 K.QGTIDSGSNGLSLTMK.K
  5.3    0.25              K.EIASNLNQIDQYAK.K
  3.3    0.22              R.SKLADALSTEMYHK.G
Top scoring peptide matches to query 86
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
107.6    0.23    4  mSSR1 K.CSGLNDLSCICTTK.N
 46.1   -0.75    4  mSSR1 K.CSGLNDLSCICTTK.N
  3.1    0.27             R.YGGQQNNYGNNNGAR.R
  2.7    0.20             R.QQQQPQQQQEEVK.S
  0.3    0.20             R.QQQQPQQQQEEVK.S
Top scoring peptide matches to query 87
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 88
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.8    0.28        K.NIWNTLNQAAHRSK.S
  4.1    0.28        K.NIWNTLNQAAHRSK.S
  2.8    0.21        R.KLQEIITEDNQVPK.E
  2.8    0.21        R.KLQEIITEDNQVPK.E
  2.4    0.18        K.TVPTVGFNVETVKHK.N
  0.8    0.29        K.NSIMVYDNQGTIKR.A
Top scoring peptide matches to query 89
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 90
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
103.8    0.25    1  mALS3.5eoc K.CFTAGTNTVTFNDGGK.K
 47.4   -0.73    1  mALS3.5eoc K.CFTAGTNTVTFNDGGK.K
 26.8   -0.73    1  mALS3.5eoc K.CFTAGTNTVTFNDGGK.K
  6.4    0.29                  K.SQQDYNNSLTIMEK.I
  6.4    0.29                  K.SQQDYNNSLTIMEK.I
  2.6    0.29                  K.SQQDYNNSLTIMEK.I
  1.9    0.24                  K.DIMYDTNLNELYGK.V
  0.9    0.29                  K.SQQDYNNSLTIMEK.I
Top scoring peptide matches to query 91
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
127.7    0.18    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
Top scoring peptide matches to query 92
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
126.6    0.23    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
 49.1   -0.75    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
Top scoring peptide matches to query 93
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 13.8    0.26    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
 13.2   -0.72    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
Top scoring peptide matches to query 94
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
106.6   -0.69    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
101.7    0.30    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
  5.1    0.32                  R.EIKNDPTSNGVVSTTK.N
  5.0    0.22                  K.LGTAGVIRELEFGTTK.D
  1.5    0.22                  -.MSAFSAALSLAITPALK.D
  0.6    0.35                  K.QRIEDENIEDTTTK.D
Top scoring peptide matches to query 95
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 96
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 97
Score greater than 33 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 98
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 99
Score greater than 15 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.4    0.23        R.LSAVANGKFVSQQQQK.D
  2.2    0.27        R.LSSTFSQRNNNQSPR.L
  2.2   -0.71        R.LSSTFSQRNNNQSPR.L
  2.2   -0.71        R.LSSTFSQRNNNQSPR.L
  2.0    0.27        R.LSSTFSQRNNNQSPR.L
  2.0   -0.71        R.LSSTFSQRNNNQSPR.L
  1.8    0.27        R.LSSTFSQRNNNQSPR.L
  1.3    0.27        R.LSSTFSQRNNNQSPR.L
  1.1    0.27        R.LSSTFSQRNNNQSPR.L
  0.6    0.27        R.LSSTFSQRNNNQSPR.L
Top scoring peptide matches to query 100
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 101
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 45.9    0.27    1  mALS3.5eoc K.CFTAGTNTVTFNDGGKK.I
 19.1   -0.72    1  mALS3.5eoc K.CFTAGTNTVTFNDGGKK.I
  8.6   -0.72    1  mALS3.5eoc K.CFTAGTNTVTFNDGGKK.I
  2.9   -0.78                  R.SPLERSIHHELEEDK.K
Top scoring peptide matches to query 102
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.1    0.27    6  mPhr1 R.VYAIDPDKDHEECMK.I
Top scoring peptide matches to query 103
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6   -0.80        K.NQNNFLEPPTGCLQVK.R
  2.3    0.10        K.VIASNGRTIGGMTNSPLR.R
  1.7    0.27        R.SQQQQQQQQQQQIPK.S
  0.8    0.13        K.ENLMTIFSFATVMVSR.I
  0.4    0.14        R.MENEHATNVILFRASK.D
Top scoring peptide matches to query 104
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.4    0.03        K.GTTPFIMLRSQIIQTR.S
 10.4    0.03        K.GTTPFIMLRSQIIQTR.S
Top scoring peptide matches to query 105
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 46.3    0.25   14  mPga36.1 K.QQSCGGTDDVSSQSATLK.C
 30.9   -0.73   14  mPga36.1 K.QQSCGGTDDVSSQSATLK.C
 30.9   -0.73   14  mPga36.1 K.QQSCGGTDDVSSQSATLK.C
  1.6    0.16                K.SIGDWNFVKTIGAGSMGK.V
Top scoring peptide matches to query 106
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 107
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 108
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 91.8   -0.71    3  mCHT2 -.SNQVALYWGQNGAGGQER.L
 89.5   -0.71    3  mCHT2 -.SNQVALYWGQNGAGGQER.L
 67.5   -0.71    3  mCHT2 -.SNQVALYWGQNGAGGQER.L
 67.3    0.28    3  mCHT2 -.SNQVALYWGQNGAGGQER.L
 54.0   -0.71    3  mCHT2 -.SNQVALYWGQNGAGGQER.L
 43.6   -0.71    3  mCHT2 -.SNQVALYWGQNGAGGQER.L
  0.8   -0.76             K.LQADMISLNKNGWLCR.N
  0.3   -0.67             R.ATTPELMPNSGSLNGGDTR.R
  0.1   -0.66             K.ESNNSNEDEIEKELER.Q
  0.1   -0.66             K.ESNNSNEDEIEKELER.Q
Top scoring peptide matches to query 109
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.4   -0.68        R.DVSWDANVVDNEHLNKK.K
  1.1    0.32        K.IQQLHAPSLSNNQSASQR.K
  0.8   -0.64        K.ACGNDDNFIQSLSRCVK.W
  0.8   -0.64        K.ACGNDDNFIQSLSRCVK.W
  0.8   -0.64        K.ACGNDDNFIQSLSRCVK.W
  0.6    0.34        K.ACGNDDNFIQSLSRCVK.W
  0.6    0.34        K.ACGNDDNFIQSLSRCVK.W
  0.6    0.34        K.ACGNDDNFIQSLSRCVK.W
Top scoring peptide matches to query 110
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.3    0.14        R.AELVNLIGVSGSANSTGDVQK.K
Top scoring peptide matches to query 111
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 112
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8    0.24        K.DLNKMLEQLNQTDVEINK.R
  0.8    0.24        K.DLNKMLEQLNQTDVEINK.R
  0.8    0.24        K.DLNKMLEQLNQTDVEINK.R
  0.8    0.24        K.DLNKMLEQLNQTDVEINK.R
  0.8    0.24        K.DLNKMLEQLNQTDVEINK.R
  0.8    0.24        K.DLNKMLEQLNQTDVEINK.R
  0.8   -0.74        K.DLNKMLEQLNQTDVEINK.R
  0.8   -0.74        K.DLNKMLEQLNQTDVEINK.R
  0.8   -0.74        K.DLNKMLEQLNQTDVEINK.R
  0.7    0.23        K.TELEADNQALKNQLTEISK.Q
Top scoring peptide matches to query 113
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.2   -0.67        K.LEQSEEEQQQQQQNKDTK.S
  1.6    0.02        R.MKVLHVISETPTSFLQHLK.E
  1.5    0.19        K.YDSMLQGILDVAQLPDPMGK.I
  0.1    0.13        K.YDSVYIMTTIKIIFEQNK.R
Top scoring peptide matches to query 114
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 115
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.2    0.32    6  mPhr1 R.GIAYQQDAAGSVSSGYDADPNRK.Y
  8.1   -0.66    6  mPhr1 R.GIAYQQDAAGSVSSGYDADPNRK.Y
  3.2   -0.66    6  mPhr1 R.GIAYQQDAAGSVSSGYDADPNRK.Y
  3.2   -0.66    6  mPhr1 R.GIAYQQDAAGSVSSGYDADPNRK.Y
Top scoring peptide matches to query 116
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 117
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.6   -0.72        R.NVNINNNVNDNVNDNFMTSNIK.S
Top scoring peptide matches to query 118
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 119
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7   -0.63        K.QCYSCGDVGHIQTECPNQAQGAK.C
  0.8    0.35        K.QCYSCGDVGHIQTECPNQAQGAK.C
  0.5   -0.63        K.QCYSCGDVGHIQTECPNQAQGAK.C
Top scoring peptide matches to query 120
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.1    0.35        K.CTCASDVMLQSCGFITIFEECK.L
  2.1   -0.64        K.CTCASDVMLQSCGFITIFEECK.L
Top scoring peptide matches to query 121
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.3   -0.73        K.YNKYYCTMCLASSCSPSSLPLQK.K
Top scoring peptide matches to query 122
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.8    0.33        R.VDATTQTQYDEISSNKANPINQVTK.K
  0.8    0.33        R.VDATTQTQYDEISSNKANPINQVTK.K
Top scoring peptide matches to query 123
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 124
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 125
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.9    0.05        K.QFQLFMSLTTYIDRLSLWDTLSVK.S
Top scoring peptide matches to query 126
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 127
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0   -0.57        R.FSPATTPEDLAMQQETNNTQYVSNNK.H
  7.0   -0.57        R.FSPATTPEDLAMQQETNNTQYVSNNK.H
  3.2   -0.38        R.HGQDRDNQYNDYDDSDVNGLNNDDK.D
  2.5    0.28        R.TNTAPNLQVQAEDPNQMVTQKVLAMR.S
  2.3    0.60        R.HGQDRDNQYNDYDDSDVNGLNNDDK.D
  2.3    0.60        R.HGQDRDNQYNDYDDSDVNGLNNDDK.D
  2.3    0.60        R.HGQDRDNQYNDYDDSDVNGLNNDDK.D
  2.3    0.60        R.HGQDRDNQYNDYDDSDVNGLNNDDK.D
  1.4   -0.57        R.FSPATTPEDLAMQQETNNTQYVSNNK.H
  1.0   -0.70        R.TNTAPNLQVQAEDPNQMVTQKVLAMR.S
Top scoring peptide matches to query 128
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 129
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  9.3    0.30        K.VVMSMTNQLDSMILIFQTLHNNASTTR.D
  9.3    0.30        K.VVMSMTNQLDSMILIFQTLHNNASTTR.D
  6.3   -0.37        K.TNDNGDENEGNEGNVTRINENDNGDDDK.T
  6.0   -0.65        R.IFNGQVFANKCVPTNSGDSTLGAQQEQR.A
  5.7   -0.68        K.DFIGHAMALWSTDDYLNEVARPTYER.I
  5.7   -0.68        K.QIMTTANDDILYDDCLAYEIVAQHIK.S
  5.7   -0.68        K.QIMTTANDDILYDDCLAYEIVAQHIK.S
  5.3    0.13        K.NKALTLIICVCGLYGTFLTWSILQER.I
  5.1    0.37        K.NDSNKETMQAELETPETLFPEGAEMIK.K
  5.1    0.37        K.NDSNKETMQAELETPETLFPEGAEMIK.K
Top scoring peptide matches to query 130
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 131
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 132
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 133
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 134
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 135
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 136
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  8.9   -0.66        R.TNFVVDFGDMTRFHPLQQCEPLMDLSWLER.Y
  8.9   -0.66        R.TNFVVDFGDMTRFHPLQQCEPLMDLSWLER.Y
  8.9   -0.55        R.VSETSDAPNNNVSVNVNETQMGPEKEHEPLPEGK.T
  8.9   -0.55        R.VSETSDAPNNNVSVNVNETQMGPEKEHEPLPEGK.T
  8.9   -0.55        R.VSETSDAPNNNVSVNVNETQMGPEKEHEPLPEGK.T
  8.9   -0.55        R.VSETSDAPNNNVSVNVNETQMGPEKEHEPLPEGK.T
  8.9   -0.55        R.VSETSDAPNNNVSVNVNETQMGPEKEHEPLPEGK.T
  8.9   -0.55        R.VSETSDAPNNNVSVNVNETQMGPEKEHEPLPEGK.T
Top scoring peptide matches to query 137
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 138
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5    0.59        R.LSSNKYIIDYDNNNNNNNNNNQDDNNDSISIPTK.E
Top scoring peptide matches to query 139
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 140
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 141
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.9   -0.78        R.GLQIANYSVVPLSDHFGIIEFVMNVQTMKGVISEQR.K
  3.9   -0.78        R.GLQIANYSVVPLSDHFGIIEFVMNVQTMKGVISEQR.K
  3.5   -0.70        K.DISLFNNLQNLNLTLTSQYSISYGFGILFNHPMAR.F
  3.5    0.29        K.DISLFNNLQNLNLTLTSQYSISYGFGILFNHPMAR.F
  3.1    0.42        -.HCYIKIQSTMSMPGSIDPPGQAQGQAPIIMNQESLR.Y
  3.1   -0.56        -.HCYIKIQSTMSMPGSIDPPGQAQGQAPIIMNQESLR.Y
  3.1    0.62        -.MDDLPPQPTPQQSYSQSQHHGSQPSHHSHHNNSNR.K
  3.1    0.62        -.MDDLPPQPTPQQSYSQSQHHGSQPSHHSHHNNSNR.K
  3.0    0.20        R.GLQIANYSVVPLSDHFGIIEFVMNVQTMKGVISEQR.K
  3.0    0.20        R.GLQIANYSVVPLSDHFGIIEFVMNVQTMKGVISEQR.K
Top scoring peptide matches to query 142
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.1   -0.45        K.QQEQHLSDVDNDKLSSSSNQQQQDAHETVLEEQEK.E
  1.1   -0.45        K.QQEQHLSDVDNDKLSSSSNQQQQDAHETVLEEQEK.E
  1.1   -0.45        K.QQEQHLSDVDNDKLSSSSNQQQQDAHETVLEEQEK.E
  0.5    0.53        K.QQEQHLSDVDNDKLSSSSNQQQQDAHETVLEEQEK.E
  0.5    0.53        K.QQEQHLSDVDNDKLSSSSNQQQQDAHETVLEEQEK.E
Top scoring peptide matches to query 143
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 144
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.4    0.58        K.VEGLSNLSCMEIDPEAAMSDLQQQAQQYNNDPNDPLK.S
  1.4    0.58        K.VEGLSNLSCMEIDPEAAMSDLQQQAQQYNNDPNDPLK.S
  1.4    0.58        K.VEGLSNLSCMEIDPEAAMSDLQQQAQQYNNDPNDPLK.S
Top scoring peptide matches to query 145
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 146
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 147
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide