Mascot Search Results

Peptide View

MS/MS Fragmentation of QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK
Found in mRBT5, |predicted| C. albicans fungus|CA2558| 241 aa

Match to Query 63: 3548.489172 from(1183.837000,3+) intensity(2318.3708)
From data file cw0134_q1.pkl

Click mouse within plot area to zoom in by factor of two about that point
Or,    to   Da 

Monoisotopic mass of neutral peptide Mr(calc): 3548.53
Fixed modifications: Carbamidomethyl (C)
Ions Score: 131  Expect: 1.4e-010  
Matches (Bold Red): 74/332 fragment ions using 152 most intense peaks
# b b++ b* b*++ b0 b0++ Seq. y y++ y* y*++ y0 y0++ #
1 129.07 65.04 112.04 56.52     Q             32
2 216.10 108.55 199.07 100.04 198.09 99.55 S 3421.48 1711.24 3404.45 1702.73 3403.47 1702.24 31
3 317.15 159.08 300.12 150.56 299.14 150.07 T 3334.45 1667.73 3317.42 1659.21 3316.44 1658.72 30
4 404.18 202.59 387.15 194.08 386.17 193.59 S 3233.40 1617.20 3216.37 1608.69 3215.39 1608.20 29
5 491.21 246.11 474.18 237.60 473.20 237.10 S 3146.37 1573.69 3129.34 1565.17 3128.36 1564.68 28
6 592.26 296.63 575.23 288.12 574.25 287.63 T 3059.33 1530.17 3042.31 1521.66 3041.32 1521.17 27
7 689.31 345.16 672.28 336.65 671.30 336.15 P 2958.29 1479.65 2941.26 1471.13 2940.28 1470.64 26
8 849.34 425.17 832.31 416.66 831.33 416.17 C 2861.23 1431.12 2844.21 1422.61 2843.22 1422.12 25
9 946.39 473.70 929.37 465.19 928.38 464.70 P 2701.20 1351.11 2684.18 1342.59 2683.19 1342.10 24
10 1109.46 555.23 1092.43 546.72 1091.45 546.23 Y 2604.15 1302.58 2587.12 1294.07 2586.14 1293.57 23
11 1295.54 648.27 1278.51 639.76 1277.53 639.27 W 2441.09 1221.05 2424.06 1212.53 2423.08 1212.04 22
12 1410.56 705.79 1393.54 697.27 1392.55 696.78 D 2255.01 1128.01 2237.98 1119.49 2237.00 1119.00 21
13 1511.61 756.31 1494.58 747.80 1493.60 747.30 T 2139.98 1070.49 2122.95 1061.98 2121.97 1061.49 20
14 1568.63 784.82 1551.61 776.31 1550.62 775.81 G 2038.93 1019.97 2021.91 1011.46     19
15 1728.66 864.84 1711.64 856.32 1710.65 855.83 C 1981.91 991.46 1964.88 982.95     18
16 1841.75 921.38 1824.72 912.86 1823.74 912.37 L 1821.88 911.44 1804.85 902.93     17
17 2001.78 1001.39 1984.75 992.88 1983.77 992.39 C 1708.80 854.90 1691.77 846.39     16
18 2100.85 1050.93 2083.82 1042.41 2082.84 1041.92 V 1548.77 774.89 1531.74 766.37     15
19 2231.89 1116.45 2214.86 1107.93 2213.88 1107.44 M 1449.70 725.35 1432.67 716.84     14
20 2328.94 1164.97 2311.91 1156.46 2310.93 1155.97 P 1318.66 659.83 1301.63 651.32     13
21 2457.00 1229.00 2439.97 1220.49 2438.99 1220.00 Q 1221.60 611.31 1204.58 602.79     12
22 2604.07 1302.54 2587.04 1294.02 2586.06 1293.53 F 1093.55 547.28 1076.52 538.76     11
23 2675.10 1338.06 2658.08 1329.54 2657.09 1329.05 A 946.48 473.74 929.45 465.23     10
24 2732.12 1366.57 2715.10 1358.05 2714.11 1357.56 G 875.44 438.22 858.41 429.71     9
25 2803.16 1402.08 2786.14 1393.57 2785.15 1393.08 A 818.42 409.71 801.39 401.20     8
26 2902.23 1451.62 2885.20 1443.11 2884.22 1442.61 V 747.38 374.19 730.36 365.68     7
27 2959.25 1480.13 2942.23 1471.62 2941.24 1471.12 G 648.31 324.66 631.29 316.15     6
28 3073.29 1537.15 3056.27 1528.64 3055.28 1528.15 N 591.29 296.15 574.27 287.64     5
29 3233.33 1617.17 3216.30 1608.65 3215.31 1608.16 C 477.25 239.13 460.22 230.61     4
30 3332.39 1666.70 3315.37 1658.19 3314.38 1657.70 V 317.22 159.11 300.19 150.60     3
31 3403.43 1702.22 3386.40 1693.71 3385.42 1693.21 A 218.15 109.58 201.12 101.07     2
32             K 147.11 74.06 130.09 65.55     1

Error Distribution

NCBI BLAST search of QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK
(Parameters: blastp, nr protein database, expect=20000, no filter, PAM30)
Other BLAST web gateways

Mascot:  http://www.matrixscience.com/