Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0134_q15.pkl
Database        : CAlbicans dos251005 (20288 sequences; 6720871 residues)
Timestamp       : 18 Jan 2007 at 10:26:22 GMT
Significant hits: mALS3.5eoc        |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mSod5/Pga3        |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
                  TRBOTR            trypsin (EC3.4.21.4 ) precursor-bovine
                  mRBT5             |predicted| C. albicans fungus|CA2558| 241 aa
                  mALS1.5eoc        |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
                  19771.1           |Als5| CONTIG=Contig10233 POSCDS1=63367 POSCDS2=67410
                  mSSR1             |Candida albicans 212 aa - Secretory Stress Response
                  mPhr1             |experimentally validated by us| C albicans |CA4857| 548 aa
                  mEcm33.3          |predicted|m5366.2|CaECM33
                  mIPF8527|mPga29:  189 aa - Candida albicans unknown function
                  24611.1           CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
                  15898.1           |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
                  15860.2           |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
                  mPga24            |predicted| mIPF5185 C. albicans |CA1678| 533 aa
                  mUTR2             |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase
                  mTOS1             |predicted| C. albicans |CA2303| 468 aa
                  22365.1           CONTIG=Contig20215 POSCDS1=355726 POSCDS2=355977

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 30 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.    mALS3.5eoc                        Mass: 94266    Score: 619    Queries matched: 10
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   352.72   703.43   703.40   0.03 0  39  0.011 1  R.APFTLR.W
3   385.75   769.49   769.47   0.02 0  27  0.071 1  R.VIPSLNK.V
26   696.35   1390.68   1390.64   0.04 0  58  9.8e-005 1  K.TCSSNGIFITYK.N + Deamidation (NQ)
44   846.46   1690.91   1690.85   0.06 0  115  1.7e-010 1  K.FTTSQTSVDLTAHGVK.Y
51   606.63   1816.88   1816.84   0.03 1  (77) 1.2e-006 1  K.CFTAGTNTVTFNDGGKK.I
52   909.46   1816.90   1816.84   0.06 1  90  5.3e-008 1  K.CFTAGTNTVTFNDGGKK.I
58   1047.50   2092.98   2092.94   0.05 0  130  4.8e-012 1  K.GLNDWNYPVSSESFSYTK.T
59   1047.51   2093.00   2092.94   0.06 0  (66) 1.3e-005 1  K.GLNDWNYPVSSESFSYTK.T
71   850.13   2547.36   2547.31   0.06 0  (61) 4.5e-005 1  K.ALGTVTLPLAFNVGGTGSSVDLEDSK.C
72   1274.71   2547.41   2547.31   0.11 0  160  5.8e-015 1  K.ALGTVTLPLAFNVGGTGSSVDLEDSK.C

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 619    Queries matched: 10
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 619    Queries matched: 10
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928

2.    mSod5/Pga3                        Mass: 22006    Score: 377    Queries matched: 9
 |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   431.25   860.48   860.46   0.02 0  41  0.0052 1  K.SNIEGTIK.F
6   495.76   989.50   989.47   0.04 0  54  0.00022 1  -.GDAPISTDSK.G
27   469.92   1406.75   1406.72   0.03 0  (111) 5.1e-010 1  R.AATPAAHEVGDLAGK.H
28   704.38   1406.75   1406.72   0.03 0  111  4.6e-010 1  R.AATPAAHEVGDLAGK.H
29   704.38   1406.75   1406.72   0.04 0  (57) 0.00011 1  R.AATPAAHEVGDLAGK.H
30   704.39   1406.77   1406.72   0.05 0  (86) 1.3e-007 1  R.AATPAAHEVGDLAGK.H
36   788.87   1575.73   1575.69   0.04 0  85  1.6e-007 1  K.TEYDDSYISLNEK.S
47   872.49   1742.96   1742.90   0.06 1  50  0.00062 1  -.GDAPISTDSKGSPSLIAK.F
76   674.07   2692.25   2692.20   0.05 1  36  0.013 1  K.HGNIMGESYKTEYDDSYISLNEK.S

3.    TRBOTR                            Mass: 24662    Score: 251    Queries matched: 5
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   577.31   1152.60   1152.57   0.03 0  73  3.1e-006 1  K.SSGTSYPDVLK.C
63   1082.60   2163.19   2163.03   0.15 0  110  6.5e-010 1  R.LGEDNINVVEGNEQFISASK.S + Deamidation (NQ)
65   758.41   2272.20   2272.15   0.05 0  69  6.7e-006 1  K.SIVHPSYNSNTLNNDIMLIK.L
66   1137.13   2272.24   2272.15   0.09 0  (12) 3.5 1  K.SIVHPSYNSNTLNNDIMLIK.L
67   763.74   2288.20   2288.15   0.05 0  (17) 0.86 1  K.SIVHPSYNSNTLNNDIMLIK.L + Oxidation (M)

4.    mRBT5                             Mass: 22745    Score: 248    Queries matched: 5
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   619.30   1236.59   1236.57   0.02 0  31  0.043 1  R.IYDQLPECAK.E + Deamidation (NQ)
80   1183.90   3548.67   3548.53   0.14 0  (126) 8.3e-012 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
81   1183.90   3548.67   3548.53   0.14 0  207  7.1e-020 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
82   1189.24   3564.69   3564.52   0.16 0  (92) 2.3e-008 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N + Oxidation (M)
84   1318.30   3951.87   3952.67   -0.80 1  11  2.5 1  K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAKNCK.G + 2 Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 248    Queries matched: 5
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 248    Queries matched: 5
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
5.    mALS1.5eoc                        Mass: 69052    Score: 189    Queries matched: 3
 |predicted| C. albicans |CA0909| 658 aa - agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
31   708.36   1414.71   1414.67   0.04 0  60  5.8e-005 1  K.STVDPSGYLYASR.V
 58   1047.50   2092.98   2092.94   0.05 0  130  4.8e-012 1  K.GLNDWNYPVSSESFSYTK.T
 59   1047.51   2093.00   2092.94   0.06 0  (66) 1.3e-005 1  K.GLNDWNYPVSSESFSYTK.T

 
      Proteins matching the same set of peptides:
      13002.2                           Mass: 133694   Score: 189    Queries matched: 3
 |Als1| CONTIG=Contig10233 POSCDS1=72223 POSCDS2=76005
      21498.1                           Mass: 133402   Score: 189    Queries matched: 3
 |Als1| CONTIG=Contig20233 POSCDS1=71475 POSCDS2=75257
6.    19771.1                           Mass: 142317   Score: 172    Queries matched: 3
 |Als5| CONTIG=Contig10233 POSCDS1=63367 POSCDS2=67410
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 31   708.36   1414.71   1414.66   0.05 0  12  3.5 2  K.STVDQSGYLTTSR.F + Deamidation (NQ)
 71   850.13   2547.36   2547.31   0.06 0  (61) 4.5e-005 1  K.ALGTVTLPIAFNVGGTGSSVDLEDSK.C
 72   1274.71   2547.41   2547.31   0.11 0  160  5.8e-015 1  K.ALGTVTLPIAFNVGGTGSSVDLEDSK.C

 
      Proteins matching the same set of peptides:
      21493.1                           Mass: 142567   Score: 172    Queries matched: 3
 CONTIG=Contig20233 POSCDS1=62616 POSCDS2=66659
7.    mSSR1                             Mass: 20690    Score: 165    Queries matched: 7
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
18   635.84   1269.67   1269.66   0.02 0  80  5.2e-007 1  -.APPACLLACVAK.V
19   635.85   1269.68   1269.66   0.03 0  (39) 0.006 1  -.APPACLLACVAK.V
20   635.85   1269.69   1269.66   0.03 0  (70) 5.6e-006 1  -.APPACLLACVAK.V
21   635.85   1269.69   1269.66   0.04 0  (53) 0.00027 1  -.APPACLLACVAK.V
41   814.89   1627.76   1627.70   0.06 0  (28) 0.089 1  K.CSGLNDLSCICTTK.N
42   815.37   1628.73   1628.68   0.05 0  68  8.7e-006 1  K.CSGLNDLSCICTTK.N + Deamidation (NQ)
45   855.41   1708.81   1708.76   0.04 0  17  1.1 1  K.EICPNGDADTAISAFK.S + Deamidation (NQ)

8.    mPhr1                             Mass: 58075    Score: 161    Queries matched: 2
 |experimentally validated by us| C albicans |CA4857| 548 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
46   861.43   1720.85   1720.79   0.06 0  75  1.5e-006 1  R.QIPVGYSSNDDEEIR.V
64   1121.55   2241.09   2240.99   0.10 0  85  1.4e-007 1  R.GIAYQQDAAGSVSSGYDADPNR.K

 
      Proteins matching the same set of peptides:
      15932.2                           Mass: 60276    Score: 161    Queries matched: 2
 |Phr1| CONTIG=Contig10192 POSCDS1=117957 POSCDS2=119603
      23455.1                           Mass: 60747    Score: 161    Queries matched: 2
 CONTIG=Contig20192 POSCDS1=117993 POSCDS2=119639
9.    mEcm33.3                          Mass: 41984    Score: 77     Queries matched: 1
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
35   787.43   1572.85   1572.81   0.04 0  77  1.1e-006 1  K.TIGGALQISDNSELR.S

 
      Proteins matching the same set of peptides:
      5366.2                            Mass: 43798    Score: 77     Queries matched: 1
 |Ecm33.3| CaECM33 CONTIG=Contig10163 POSCDS1=164904 POSCDS2=166142
      24311.1                           Mass: 42880    Score: 77     Queries matched: 1
 CONTIG=Contig20163 POSCDS1=164513 POSCDS2=165751
10.   mIPF8527|mPga29:                  Mass: 19928    Score: 73     Queries matched: 2
 189 aa - Candida albicans unknown function
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
10   554.33   1106.65   1106.63   0.01 0  16  1.6 1  -.TISSIQLFAK.S
24   679.90   1357.78   1357.75   0.03 1  58  0.00011 1  K.KTDDSAPITIVAK.F

11.   24611.1                           Mass: 47890    Score: 73     Queries matched: 3
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   548.27   1094.53   1094.49   0.04 0  35  0.015 1  R.YDQAQDDIK.K
 15   619.30   1236.59   1236.63   -0.04 0  0  50 8  K.NDTHHILIMK.F + Oxidation (M)
48   890.95   1779.89   1779.83   0.05 0  37  0.011 1  K.SSDCSPVPALGSSFLEK.F

12.   15898.1                           Mass: 39582    Score: 71     Queries matched: 3
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   476.26   950.51   950.48   0.03 1  2  34 5  K.AYVEEGRK.A
33   759.86   1517.70   1517.65   0.05 0  16  1.6 1  K.GITYSPYSDNGGCK.S
57   1025.56   2049.10   2049.04   0.07 0  53  0.00026 1  K.SESQIASEIAQLSGFDVIR.L

 
      Proteins matching the same set of peptides:
      m15898.1|mSCW1:                   Mass: 35901    Score: 71     Queries matched: 3
 346 aa - glucanase (by homology) Candida albicans
13.   15860.2                           Mass: 61554    Score: 50     Queries matched: 2
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
55   970.04   1938.06   1938.01   0.05 0  32  0.032 1  K.LFVGVPATSNIAGYVDTSK.L
70   1264.17   2526.33   2526.21   0.12 0  17  0.97 1  K.NYFLSAAPQCPYPDASLGDLLSK.V

 
      Proteins matching the same set of peptides:
      19719.2                           Mass: 51350    Score: 50     Queries matched: 2
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
      mCHT2                             Mass: 59565    Score: 47     Queries matched: 2
 583 aa - chitinase 2 precursor Candida albicans
14.   mPga24                            Mass: 52805    Score: 42     Queries matched: 1
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
17   635.84   1269.67   1269.64   0.03 0  42  0.003 1  K.VITVVACDEHK.C

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 42     Queries matched: 1
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 42     Queries matched: 1
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
15.   mUTR2                             Mass: 49676    Score: 34     Queries matched: 1
 |predicted| C. albicans |CA0605| 470 aa - 1,3-1,4-beta-glucanase
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
60   711.38   2131.13   2131.06   0.07 1  34  0.022 1  K.GTIEWAGGLINWDSEDIKK.Y

 
      Proteins matching the same set of peptides:
      8080.2                            Mass: 52187    Score: 34     Queries matched: 1
 |Utr2| CONTIG=Contig20123 POSCDS1=148155 POSCDS2=149567
      29345.1                           Mass: 54908    Score: 34     Queries matched: 1
 CONTIG=Contig10123 POSCDS1=148333 POSCDS2=149745
16.   mTOS1                             Mass: 47812    Score: 33     Queries matched: 2
 |predicted| C. albicans |CA2303| 468 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   617.86   1233.70   1233.53   0.17 0  2  39 5  R.QIDDQDCNVK.H
39   802.37   1602.72   1602.68   0.04 0  31  0.047 1  R.TLQYGEATCSCWK.T

 
      Proteins matching the same set of peptides:
      6517.2                            Mass: 49921    Score: 33     Queries matched: 2
 |Tos1| (no GPI) CONTIG=Contig10123 POSCDS1=187827 POSCDS2=189233
      25628.1                           Mass: 51833    Score: 33     Queries matched: 2
 CONTIG=Contig20123 POSCDS1=187678 POSCDS2=189084
17.   22365.1                           Mass: 9715     Score: 31     Queries matched: 1
 CONTIG=Contig20215 POSCDS1=355726 POSCDS2=355977
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 2   352.72   703.43   703.37   0.06 0  31  0.065 2  R.APFDVR.G

 
      Proteins matching the same set of peptides:
      28240.1                           Mass: 9715     Score: 31     Queries matched: 1
 CONTIG=Contig10215 POSCDS1=356285 POSCDS2=356536
18.   4104.2                            Mass: 62102    Score: 25     Queries matched: 1
 CONTIG=Contig10139 POSCDS1=64761 POSCDS2=66413
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   628.37   1254.72   1254.69   0.03 0  25  0.18 1  R.ELQLIQAGVER.E

 
      Proteins matching the same set of peptides:
      4107.2                            Mass: 62159    Score: 25     Queries matched: 1
 CONTIG=Contig20139 POSCDS1=67476 POSCDS2=69137
      4109.2                            Mass: 61209    Score: 25     Queries matched: 1
 CONTIG=Contig10139 POSCDS1=70524 POSCDS2=72164
      17561.3                           Mass: 58713    Score: 25     Queries matched: 1
 CONTIG=Contig20139 POSCDS1=70432 POSCDS2=71925
      18774.1                           Mass: 45011    Score: 25     Queries matched: 1
 CONTIG=Contig10139 POSCDS1=68141 POSCDS2=69340
      25253.1                           Mass: 62705    Score: 25     Queries matched: 1
 CONTIG=Contig20139 POSCDS1=64550 POSCDS2=66202
19.   15363.2                           Mass: 40824    Score: 25     Queries matched: 1
 |Pir1| CONTIG=Contig20045 POSCDS1=52307 POSCDS2=53464
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
56   664.00   1988.99   1988.93   0.06 0  25  0.18 1  K.ACSSANNLEMTLHDSVLK.D

 
      Proteins matching the same set of peptides:
      m15363.2                          Mass: 38940    Score: 25     Queries matched: 1
 |mPir1| 367 aa Candida albicans
      19968.1                           Mass: 36680    Score: 25     Queries matched: 1
 |Pir1| CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
      m19968.1                          Mass: 34796    Score: 25     Queries matched: 1
 |mPir1| 328 aa CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
20.   2121.2                            Score: 22     Queries matched: 2
 CONTIG=Contig10196 POSCDS1=69210 POSCDS2=72338
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 9   548.27   1094.53   1094.52   0.00 0  16  1.3 2  K.YNQTAQELK.S + Deamidation (NQ)
 24   679.90   1357.78   1357.49   0.29 0  8  10 4  K.QGDNDSSYNDDK.K + Deamidation (NQ)

 
      Proteins matching the same set of peptides:
      23186.1                           Score: 22     Queries matched: 2
Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
75   1304.65   2607.28   2607.14   0.14 0  12  2.9 1  GVDYQPGGSSELEDPLADTNVCER
5   476.26   950.51   950.52   -0.01 1  11  4.2 1  SFVVKDTR
83   1312.63   3934.86   3934.83   0.03 1  10  3.1 1  EQMLATIFCGVTGGSTSYVSSNILMQKSEIFYDNK + Deamidation (NQ); Oxidation (M)
40   807.41   1612.81   1612.70   0.11 0  7  11 1  EGVNNNGYFEQVNK + 2 Deamidation (NQ)
7   518.78   1035.55   1035.58   -0.03 0  7  11 1  NGVHNGVVLK
77   1093.85   3278.54   3278.58   -0.04 1  6  8.7 1  HNHNEFQTCMNLLGIDQFILTLKMSLK + 2 Deamidation (NQ); 2 Oxidation (M)
38   797.90   1593.79   1593.95   -0.16 1  5  16 1  KFFNISVVIVTLSK
73   850.77   2549.29   2549.27   0.02 1  4  19 1  AVSEALNTVATLSSGNGAKIEATESK + 2 Deamidation (NQ)
34   784.39   1566.77   1566.71   0.06 0  4  23 1  SSMESSINVNAINSI + 2 Deamidation (NQ)
74   1275.68   2549.35   2549.27   0.08 1  4  23 1  AVSEALNTVATLSSGNGAKIEATESK + 2 Deamidation (NQ)
14   617.86   1233.70   1233.59   0.11 0  4  27 1  QPMDLGTIQSK + Deamidation (NQ); Oxidation (M)
37   532.27   1593.77   1593.95   -0.18 1  3  25 1  KFFNISVVIVTLSK
13   589.34   1176.67   1176.62   0.05 1  3  31 1  STMAGDLNLKK
50   900.94   1799.87   1799.81   0.06 0  3  26 1  LFLEYIGESNNNQAGK + 4 Deamidation (NQ)
68   1151.06   2300.10   2300.15   -0.05 0  3  26 1  LSTSIMSSTEATSVASLLLMNK + Deamidation (NQ); Oxidation (M)
78   1171.28   3510.81   3510.95   -0.14 1  3  26 1  LPNNLIAQPDIVTAVKGADLIIFNLPHQFLPK + 2 Deamidation (NQ)
85   1396.37   4186.09   4185.99   0.10 1  2  20 1  LDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTK + 2 Deamidation (NQ); Oxidation (M)
54   931.92   1861.82   1861.92   -0.10 0  1  47 1  GSNYLLNQGDEIAVGVGR + Deamidation (NQ)
62   1075.56   2149.10   2149.01   0.09 0  1  48 1  SNLSINESNDNSNVSILSNK + Deamidation (NQ)
1   425.22   424.22        
8   538.33   1074.65        
11   561.30   1120.59        
22   638.81   1275.60        
23   653.80   1305.59        
25   463.92   1388.74        
32   755.39   1508.76        
43   821.90   1641.78        
49   898.48   1794.95        
53   608.60   1822.78        
61   1066.58   2131.15        
69   1202.57   2403.13        
79   1178.22   3531.64        
86   1299.65   5194.55        

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidation (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.8 Da
Fragment Mass Tolerance: ± 0.4 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 86

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 38.6    0.03    1  mALS3.5eoc R.APFTLR.W
 30.7    0.06   17  22365.1    R.APFDVR.G
 20.8    0.09                  R.APQTMR.Q
  9.9    0.08                  R.NQATLR.R
  9.2    0.09                  K.ADPMVR.R
  8.9    0.08                  K.AEESLR.M
  8.1    0.09                  K.ANQQLK.R
  7.5    0.08                  K.ADGAVSGK.I
  6.9    0.08                  R.VSQDVR.Y
  6.9    0.10                  K.WQDVR.G
Top scoring peptide matches to query 3
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 27.2    0.02    1  mALS3.5eoc R.VIPSLNK.V
 16.8    0.10                  K.NPPVTNK.V
 14.3    0.02                  R.VLKPQGK.L
 12.8    0.01                  K.VIPWKK.I
  9.7    0.01                  K.VLPSKAR.L
  8.8    0.01                  R.VLRTPGK.A
  8.5    0.13                  K.QDNAPPK.K
  7.6    0.02                  K.VSIPLNK.K
  7.4    0.02                  R.LVDKPAK.D
  5.8    0.10                  K.KDPDAPK.R
Top scoring peptide matches to query 4
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 41.0    0.02    2  mSod5/Pga3 K.SNIEGTIK.F
 17.9    0.04                  R.NSMPATLK.K
  9.7    0.01                  K.SNNTAVKK.S
  7.3   -0.01                  K.SINRMIK.D
  6.4    0.05                  R.SLGANRDK.V
  5.9    0.06                  K.SGANLPSSK.E
  5.9    0.02                  R.SLATAAAEK.A
  5.5    0.05                  R.NSQNRIK.K
  4.9    0.05                  K.SQVQNKR.R
  3.4    0.10                  R.SNQEGVIN.-
Top scoring peptide matches to query 5
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.3   -0.01               K.SFVVKDTR.V
  3.5    0.07               -.MSEELAQK.T
  3.5   -0.02               R.SFVSSRLR.V
  3.2    0.01               R.SMVTSVRR.E
  2.3    0.03   12  15898.1 K.AYVEEGRK.A
Top scoring peptide matches to query 6
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 54.4    0.04    2  mSod5/Pga3 -.GDAPISTDSK.G
  7.0   -0.03                  K.NKPYPKSR.Y
  5.7    0.04                  K.KDENQIDK.T
  5.4   -0.03                  K.LLNMKESR.I
  4.8    0.07                  R.SQASEEDPK.K
  3.8    0.01                  K.KDNLMNVR.D
  2.2   -0.01                  K.EFASKSPPK.S
  2.2    0.01                  K.SEGHAAPPPK.S
Top scoring peptide matches to query 7
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.0   -0.03        K.NGVHNGVVLK.T
  0.4    0.09        K.QKQEMEAR.E
Top scoring peptide matches to query 8
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 9
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 35.4    0.04   11  24611.1 R.YDQAQDDIK.K
 15.8    0.00   20  2121.2  K.YNQTAQELK.S
  8.1    0.00   20  2121.2  K.YNQTAQELK.S
  3.5    0.00               K.YNNLGESGLK.I
  1.4   -0.01               R.YQSVIDGWK.I
Top scoring peptide matches to query 10
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein          Peptide
 15.6    0.01   10  mIPF8527|mPga29: -.TISSIQLFAK.S
Top scoring peptide matches to query 11
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 12
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 72.5    0.03    3  TRBOTR K.SSGTSYPDVLK.C
 10.6   -0.03              R.KVGVQEPPSGR.F
  6.6    0.07              K.KMGSIETDQK.H
  4.4    0.11              R.TQSDVNSSWK.L
  3.4    0.02              R.QMLQSPFFR.Q
  3.0    0.11              K.QEICDFQGR.G
  2.8   -0.01              K.VQQPAKAPANK.Q
  2.6    0.12              K.QHGAPEDDER.H
  2.4    0.02              K.LMNIVNMYR.E
  2.3    0.13              K.CKMEGGGGEGR.T
Top scoring peptide matches to query 13
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.3    0.05        -.STMAGDLNLKK.S
Top scoring peptide matches to query 14
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.6    0.11             K.QPMDLGTIQSK.L
  3.1    0.13             K.QVNRTPNQMK.D
  2.5    0.02             R.QTEKPLFSRK.T
  2.1    0.11             K.QLDQNQRTTK.N
  2.0    0.17   16  mTOS1 R.QIDDQDCNVK.H
  1.5    0.15             K.FQPLNDQENK.E
  1.5    0.15             K.FQPLNDQENK.E
  1.4   -0.00             R.KLTVQQLFEK.G
  1.4   -0.00             R.KLTVQQLFEK.G
  0.7    0.11             R.KPYNNKPDQK.N
Top scoring peptide matches to query 15
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 31.1    0.02    4  mRBT5   IYDQLPECAK
  7.1   -0.10               K.FIKNTIYPNK.F
  6.5   -0.02               K.QFTLSRQDNK.T
  6.1    0.03               K.KDTMELEEDK.K
  1.8   -0.03               K.KDLCGQEFIK.F
  1.2   -0.07               K.LKDTLEEVYK.F
  0.7   -0.06               K.FLVNLENMIK.L
  0.4   -0.04   11  24611.1 K.NDTHHILIMK.F
Top scoring peptide matches to query 16
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 25.0    0.03   18  4104.2 R.ELQLIQAGVER.E
  0.1    0.03              K.TIFSQQKYLK.R
Top scoring peptide matches to query 17
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 42.4    0.03   14  mPga24 K.VITVVACDEHK.C
  2.5   -0.05              K.AITDLASIQIPK.L
  1.0    0.06              K.QGEPVALKPTDN.-
Top scoring peptide matches to query 18
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 80.1    0.02    7  mSSR1 -.APPACLLACVAK.V
  1.2    0.01             M.APVVQQPAPSFK.K
  0.4    0.06             K.APKFLTYCNR.F
Top scoring peptide matches to query 19
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 39.4    0.03    7  mSSR1 -.APPACLLACVAK.V
Top scoring peptide matches to query 20
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 69.8    0.03    7  mSSR1 -.APPACLLACVAK.V
  2.0    0.03             M.APVVQQPAPSFK.K
  0.1    0.07             K.APKFLTYCNR.F
Top scoring peptide matches to query 21
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 52.9    0.04    7  mSSR1 -.APPACLLACVAK.V
  0.2    0.08             K.APKFLTYCNR.F
  0.2    0.03             M.APVVQQPAPSFK.K
Top scoring peptide matches to query 22
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 23
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 24
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein          Peptide
 57.6    0.03   10  mIPF8527|mPga29: K.KTDDSAPITIVAK.F
 12.2    0.06                        K.EVRDIQSQLAAK.T
 10.1    0.09                        K.QPTMPGLSSSPIK.E
  7.8    0.29   20  2121.2           K.QGDNDSSYNDDK.K
  6.6   -0.02                        K.LLQRTESATVLK.G
  5.4    0.29   20  2121.2           K.QGDNDSSYNDDK.K
  5.0    0.05                        K.KFMNLIYVTTK.L
  4.6    0.08                        K.DNNWILNVKDK.K
  4.5    0.07                        R.GNEAVLTPKETAK.L
  4.3    0.08                        K.QRYPNNPIDLK.F
Top scoring peptide matches to query 25
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 26
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 57.9    0.04    1  mALS3.5eoc K.TCSSNGIFITYK.N
 12.2    0.07                  K.NMSHKLDGGDSSK.M
  4.7    0.06                  K.QKPKNNQNSNSK.T
  4.3    0.06                  K.QKPKNNQNSNSK.T
  4.3    0.06                  K.QKPKNNQNSNSK.T
  4.3    0.06                  K.QKPKNNQNSNSK.T
  4.1    0.06                  K.QKPKNNQNSNSK.T
  3.3   -0.00                  K.LVQSQIKTNDNK.S
  1.6    0.02                  K.LDNANASLTAANSK.I
  0.1   -0.02                  R.INKITNIMPSDK.N
Top scoring peptide matches to query 27
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
110.6    0.03    2  mSod5/Pga3 R.AATPAAHEVGDLAGK.H
Top scoring peptide matches to query 28
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
111.1    0.03    2  mSod5/Pga3 R.AATPAAHEVGDLAGK.H
 19.4    0.14                  R.QNQGDWMGVVSGK.G
 14.8    0.14                  R.QNQGDWMGVVSGK.G
  8.2    0.04                  K.MNSLSNLLQDKK.K
  5.7    0.15                  K.RSQENNSNNNTK.L
  4.3    0.04                  R.KMNSLSNLLQDK.K
  3.8    0.07                  K.QAQERDEYLQK.N
  3.4    0.15                  K.KNSIYYCSNQK.K
  3.4    0.00                  R.GEFIPISEMLKK.T
  3.0    0.04                  R.KMNSLSNLLQDK.K
Top scoring peptide matches to query 29
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 57.4    0.04    2  mSod5/Pga3 R.AATPAAHEVGDLAGK.H
Top scoring peptide matches to query 30
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 86.5    0.05    2  mSod5/Pga3 R.AATPAAHEVGDLAGK.H
  3.9    0.06                  K.MNSLSNLLQDKK.K
  3.5    0.16                  R.QNQGDWMGVVSGK.G
  3.5    0.02                  R.GEFIPISEMLKK.T
  3.0    0.03                  R.SRSSSLLNTISNK.I
  1.7    0.05                  -.NKFNCELIQLK.V
Top scoring peptide matches to query 31
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 59.8    0.04    5  mALS1.5eoc K.STVDPSGYLYASR.V
 12.0    0.05    6  19771.1    K.STVDQSGYLTTSR.F
  8.2    0.07                  R.ISSYSSCLDLNR.C
  5.7    0.08                  K.NDATMWISAMFK.R
  4.8   -0.09                  R.IAMLLFNIPDIR.L
  4.6   -0.07                  K.LRTDLLETADIR.R
  3.6    0.08                  K.TSDVMETVFQDK.K
  3.6    0.07                  -.STTMQDSFDQKK.Q
  0.9   -0.01                  R.DKQQVVGGDSNLR.K
  0.8    0.05                  R.QQHFNRAENIR.R
Top scoring peptide matches to query 32
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 33
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 15.8    0.05   12  15898.1 K.GITYSPYSDNGGCK.S
  1.1    0.05               K.SSDGSSSSNSSSSSKK.G
Top scoring peptide matches to query 34
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.0    0.06        R.SSMESSINVNAINSI.-
  1.3    0.14        R.MEGIGNGGDDSLQEK.L
Top scoring peptide matches to query 35
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein  Peptide
 76.6    0.04    9  mEcm33.3 K.TIGGALQISDNSELR.S
  5.1   -0.01                K.NVGALQGIQFLRQK.G
  5.1   -0.01                K.NVGALQGIQFLRQK.G
Top scoring peptide matches to query 36
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 85.2    0.04    2  mSod5/Pga3 K.TEYDDSYISLNEK.S
  4.5   -0.07                  K.LTTNTIDDLGKEEK.F
  1.7   -0.02                  -.EKNSYNQSVIQHK.V
  1.4   -0.02                  -.EKNSYNQSVIQHK.V
  1.2   -0.07                  K.TSYRALLSHSAQGGK.G
Top scoring peptide matches to query 37
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.5   -0.18        R.KFFNISVVIVTLSK.M
Top scoring peptide matches to query 38
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  5.3   -0.16        R.KFFNISVVIVTLSK.M
  1.2    0.05        R.LIELNCDSINMEK.I
Top scoring peptide matches to query 39
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 30.9    0.04   16  mTOS1 R.TLQYGEATCSCWK.T
  0.1   -0.05             K.VRSLEEANAELENK.I
Top scoring peptide matches to query 40
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  7.1    0.11        K.EGVNNNGYFEQVNK.N
  5.8    0.11        K.EGVNNNGYFEQVNK.N
  1.0   -0.08        K.YGLNHVVSLIENKK.A
Top scoring peptide matches to query 41
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 27.6    0.06    7  mSSR1 K.CSGLNDLSCICTTK.N
Top scoring peptide matches to query 42
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 68.0    0.05    7  mSSR1 K.CSGLNDLSCICTTK.N
Top scoring peptide matches to query 43
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 44
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
115.4    0.06    1  mALS3.5eoc K.FTTSQTSVDLTAHGVK.Y
  3.8    0.17                  K.FTPDYTNYATTPNGK.I
  1.9   -0.02                  -.MSAFSAALSLAITPALK.D
Top scoring peptide matches to query 45
Score greater than 29 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 16.8    0.04    7  mSSR1 K.EICPNGDADTAISAFK.S
Top scoring peptide matches to query 46
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 75.3    0.06    8  mPhr1 R.QIPVGYSSNDDEEIR.V
  9.3   -0.04             K.KLIINGGGNGGGGDHNIK.H
  8.9   -0.04             K.KLIINGGGNGGGGDHNIK.H
  5.3    0.03             K.QLLSNNSSLERSSQR.L
  4.1   -0.03             K.QLITFDNLQCARIK.A
  3.5    0.04             K.KIGYMNNSFNFELK.N
  3.5    0.04             K.KIGYMNNSFNFELK.N
  3.5    0.04             K.KIGYMNNSFNFELK.N
  3.5   -0.04             K.KLIINGGGNGGGGDHNIK.H
  3.5   -0.08             R.KLTNSILTMSIEDLK.N
Top scoring peptide matches to query 47
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 49.5    0.06    2  mSod5/Pga3 -.GDAPISTDSKGSPSLIAK.F
  0.6    0.11                  K.QNLPNLTSQQIEDLK.N
  0.6    0.11                  K.QNLPNLTSQQIEDLK.N
  0.2    0.08                  K.KNQVVGMDGEIPQVTK.L
Top scoring peptide matches to query 48
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 37.0    0.05   11  24611.1 K.SSDCSPVPALGSSFLEK.F
  3.7    0.01               R.KSFTSTTTTTTSSTTTK.S
  1.4    0.01               R.EEMTKNQVSLTCLVK.G
Top scoring peptide matches to query 49
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 50
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.3    0.06        R.LFLEYIGESNNNQAGK.I
  1.4    0.08        K.NDYINSSGNISNLQMK.F
  0.2   -0.00        K.QQQITLYPHLDSNNK.W
Top scoring peptide matches to query 51
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 76.8    0.03    1  mALS3.5eoc K.CFTAGTNTVTFNDGGKK.I
  3.7    0.08                  R.ISFCENTNINSAGFNK.R
  1.0    0.08                  R.ISFCENTNINSAGFNK.R
  0.1   -0.09                  K.DLLLYSIFESQAYKK.G
Top scoring peptide matches to query 52
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 90.5    0.06    1  mALS3.5eoc K.CFTAGTNTVTFNDGGKK.I
  5.0    0.11                  R.ISFCENTNINSAGFNK.R
  2.7    0.05                  K.HGIESMLMHYVEEVK.E
  0.9    0.18                  R.CMSGRLACQCSSNGVL.-
  0.4    0.15                  K.FSPTTKSSNNNNSMNR.Q
Top scoring peptide matches to query 53
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 54
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.9   -0.10        K.GSNYLLNQGDEIAVGVGR.D
  0.7   -0.12        -.NQRVVIVANHDQTPNR.A
Top scoring peptide matches to query 55
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 32.4    0.05   13  15860.2 K.LFVGVPATSNIAGYVDTSK.L
  4.4    0.12               R.VIRFGGNVNDVSIMMDR.V
  4.4    0.12               R.VIRFGGNVNDVSIMMDR.V
  4.3    0.10               R.VQELDPNVPVDTDDIIR.I
  1.6    0.10               K.LSNVGTGSFDVFAQMPRL.-
  1.4    0.06               K.QYLVVESVYMLPNARR.A
  1.3    0.18               R.NLNPGDHNDEDVVKQLK.Y
  1.3    0.15               K.LNTSVYYEYAKAEQMK.S
  0.8   -0.00               K.VIFRLLLQLAMFDSEK.V
Top scoring peptide matches to query 56
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 24.5    0.06   19  15363.2 K.ACSSANNLEMTLHDSVLK.D
Top scoring peptide matches to query 57
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 53.3    0.07   12  15898.1 K.SESQIASEIAQLSGFDVIR.L
  1.3    0.08               K.KSTPTTSQPVGTSNLSSSLR.S
Top scoring peptide matches to query 58
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
130.4    0.05    1+ mALS3.5eoc K.GLNDWNYPVSSESFSYTK.T
  1.3    0.05                  K.NSSNNTNNSNQRNTTTPTK.Q
  1.3    0.05                  K.NSSNNTNNSNQRNTTTPTK.Q
  1.3    0.05                  K.NSSNNTNNSNQRNTTTPTK.Q
  0.7   -0.07                  K.QRVILPTGPMHQYTHWK.Q
Top scoring peptide matches to query 59
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 66.0    0.06    1+ mALS3.5eoc K.GLNDWNYPVSSESFSYTK.T
  1.1   -0.04                  R.LGIIAMSTLSMINDDIETR.K
  0.6   -0.06                  R.VQTAVTMRSVTGNMTQVIR.G
Top scoring peptide matches to query 60
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 33.9    0.07   15  mUTR2 K.GTIEWAGGLINWDSEDIKK.Y
Top scoring peptide matches to query 61
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 62
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  0.6    0.09        M.SNLSINESNDNSNVSILSNK.S
Top scoring peptide matches to query 63
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
109.8    0.15    3  TRBOTR R.LGEDNINVVEGNEQFISASK.S
108.2    0.15    3  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 95.8    0.15    3  TRBOTR R.LGEDNINVVEGNEQFISASK.S
 80.4    0.15    3  TRBOTR R.LGEDNINVVEGNEQFISASK.S
Top scoring peptide matches to query 64
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 85.5    0.10    8  mPhr1 R.GIAYQQDAAGSVSSGYDADPNR.K
  3.1    0.05             K.LGESFKISEFVDDQNEIDR.A
  3.1    0.05             K.LGESFKISEFVDDQNEIDR.A
  2.1    0.21             K.QLGSNNNNNGNTNIMENTLR.I
Top scoring peptide matches to query 65
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 69.1    0.05    3  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  1.6   -0.77              R.NGNNNNNNNNNLQDLLNNLK.-
  1.4    0.22              R.NGNNNNNNNNNLQDLLNNLK.-
  1.4    0.22              R.NGNNNNNNNNNLQDLLNNLK.-
  1.4   -0.77              R.NGNNNNNNNNNLQDLLNNLK.-
  1.4   -0.77              R.NGNNNNNNNNNLQDLLNNLK.-
  1.3    0.22              R.NGNNNNNNNNNLQDLLNNLK.-
  1.3   -0.77              R.NGNNNNNNNNNLQDLLNNLK.-
  1.0    0.10              R.NFQVEYAMKAVENGGTSIGIK.C
  0.8   -0.02              K.HKPMARTNELTNLYTLIIK.S
Top scoring peptide matches to query 66
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.3    0.09    3  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
  8.4    0.13              K.HSPNLTPFNETQNASNFLIK.S
  8.4    0.13              K.HSPNLTPFNETQNASNFLIK.S
  6.2    0.13              K.HSPNLTPFNETQNASNFLIK.S
  5.1    0.10              R.TPTDFLNLVQMFTDLFNIK.H
  4.9    0.13              K.HSPNLTPFNETQNASNFLIK.S
  4.1    0.13              K.HSPNLTPFNETQNASNFLIK.S
  4.0    0.21              K.ELGADHTLDYNDPNVIENLK.A
  2.9    0.08              R.TIVCGDDEQDIINSLNILLK.Q
  2.4    0.07              R.APNWQIAMSKQISQDISLIK.T
Top scoring peptide matches to query 67
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.4    0.05    3  TRBOTR K.SIVHPSYNSNTLNNDIMLIK.L
Top scoring peptide matches to query 68
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.7   -0.05        K.LSTSIMSSTEATSVASLLLMNK.I
  2.3    0.04        R.FQDQIVAILPYYNHCDFR.E
  2.3    0.04        R.FQDQIVAILPYYNHCDFR.E
  2.1   -0.09        K.LDCDQPNNSLIPYKQIILR.S
Top scoring peptide matches to query 69
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 70
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 17.4    0.12   13  15860.2 K.NYFLSAAPQCPYPDASLGDLLSK.V
Top scoring peptide matches to query 71
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 61.0    0.06    6  19771.1    K.ALGTVTLPIAFNVGGTGSSVDLEDSK.C
 61.0    0.06    1  mALS3.5eoc K.ALGTVTLPLAFNVGGTGSSVDLEDSK.C
Top scoring peptide matches to query 72
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
160.5    0.11    6  19771.1    K.ALGTVTLPIAFNVGGTGSSVDLEDSK.C
160.5    0.11    1  mALS3.5eoc K.ALGTVTLPLAFNVGGTGSSVDLEDSK.C
  5.8    0.14                  K.DDKPPAPISRSNSMNANLAPGAPVK.E
  0.1    0.16                  K.VKDELASQVSNQITNIQSIVSNR.H
Top scoring peptide matches to query 73
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  4.3    0.02        K.AVSEALNTVATLSSGNGAKIEATESK.K
Top scoring peptide matches to query 74
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  3.9    0.08        K.AVSEALNTVATLSSGNGAKIEATESK.K
  2.5    0.12        K.GIRQNEEQLELTSMLGIQCISK.Q
  2.0    0.05        R.QQIYVMNILTNNICAGWIGVLK.F
  2.0    0.05        R.QQIYVMNILTNNICAGWIGVLK.F
  2.0    0.07        K.EQITRILDYTPNNFNQVESLR.L
  2.0   -0.00        R.SQEIYKQLSTLPYLQPTNWIK.S
  2.0    0.04        R.NLITQTPFIIMAGDPFLSDPSKK.R
  2.0    0.04        R.NLITQTPFIIMAGDPFLSDPSKK.R
  1.0    0.11        -.NNMSGLTLNQIELNQIKSSWNK.I
  0.0    0.12        K.GIRQNEEQLELTSMLGIQCISK.Q
Top scoring peptide matches to query 75
Score greater than 25 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 12.1    0.14        R.GVDYQPGGSSELEDPLADTNVCER.D
Top scoring peptide matches to query 76
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein    Peptide
 35.8    0.05    2  mSod5/Pga3 K.HGNIMGESYKTEYDDSYISLNEK.S
Top scoring peptide matches to query 77
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  6.4   -0.04        R.HNHNEFQTCMNLLGIDQFILTLKMSLK.S
  6.4   -0.04        R.HNHNEFQTCMNLLGIDQFILTLKMSLK.S
  6.4   -0.04        R.HNHNEFQTCMNLLGIDQFILTLKMSLK.S
  6.4   -0.04        R.HNHNEFQTCMNLLGIDQFILTLKMSLK.S
  6.4   -0.04        R.HNHNEFQTCMNLLGIDQFILTLKMSLK.S
  6.4   -0.04        R.HNHNEFQTCMNLLGIDQFILTLKMSLK.S
  2.6   -0.16        -.MIHESSLVMSLVEEQESITLHPKPGFVIK.T
  2.0   -0.06        K.MKLSVLMGYTHMNYSLMFSLVNYLFFK.S
  1.5   -0.17        K.LIGAHVMQNGSITLEIINTLETIDDDNVLK.F
  0.8    0.03        K.ADQEEVTACCGNFSSLLSQFGSELLQFIK.L
Top scoring peptide matches to query 78
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  2.5   -0.14        K.LPNNLIAQPDIVTAVKGADLIIFNLPHQFLPK.I
  2.5   -0.14        K.LPNNLIAQPDIVTAVKGADLIIFNLPHQFLPK.I
Top scoring peptide matches to query 79
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
Top scoring peptide matches to query 80
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
126.3    0.14    4  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
  2.4   -0.15             K.DFYQYCQSKNIPIIVISSGMKPIIYALLEK.L
  2.4   -0.15             K.DFYQYCQSKNIPIIVISSGMKPIIYALLEK.L
Top scoring peptide matches to query 81
Score greater than 27 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
207.0    0.14    4  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
  1.9   -0.15             K.DFYQYCQSKNIPIIVISSGMKPIIYALLEK.L
  1.9   -0.15             K.DFYQYCQSKNIPIIVISSGMKPIIYALLEK.L
Top scoring peptide matches to query 82
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 91.5    0.16    4  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK.N
Top scoring peptide matches to query 83
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 10.4    0.03        K.EQMLATIFCGVTGGSTSYVSSNILMQKSEIFYDNK.W
  2.8    0.13        R.NKMSPDNEPQPPNEDELLNNILPSYHMFQSTVSK.N
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
  2.5    0.00        K.HQQQQHHYHPRPPMSINTSMIPLTPVSNSTSPNR.F
Top scoring peptide matches to query 84
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
 11.1   -0.80    4  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAKNCK.G
  9.1    0.19    4  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAKNCK.G
  3.2   -0.80    4  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAKNCK.G
  2.2    0.19    4  mRBT5 K.QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAKNCK.G
Top scoring peptide matches to query 85
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide
  1.9    0.10        K.LDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTK.Q
  1.9    0.10        K.LDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTK.Q
  1.9    0.10        K.LDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTK.Q
  1.9    0.10        K.LDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTK.Q
  1.9    0.10        K.LDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTK.Q
  1.9    0.10        K.LDMVAVPSFSAGAMENCGLVTFRTVDLLIDADNANVNTK.Q
Top scoring peptide matches to query 86
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
Score   Delta  Hit  Protein Peptide