Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0134_q1.pkl
Database        : CAlbicans dos (20286 sequences; 6720281 residues)
Timestamp       : 21 Mar 2005 at 16:06:51 GMT
Significant hits: mALS3.5eoc        |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mSod5/Pga3        |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
                  mPhr1             |experimentally validated by us| C albicans |CA4857| 548 aa
                  mSSR1             |Candida albicans 212 aa - Secretory Stress Response
                  mRBT5             |predicted| C. albicans fungus|CA2558| 241 aa
                  19771.1           |Als5| CONTIG=Contig10233 POSCDS1=63367 POSCDS2=67410
                  TRBOTR            trypsin (EC3.4.21.4 ) precursor-bovine
                  mCHT2             583 aa - chitinase 2 precursor Candida albicans
                  mALS4.5f          |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
                  mPga24            |predicted| mIPF5185 C. albicans |CA1678| 533 aa
                  mIPF8527|mPga29:  189 aa - Candida albicans unknown function
                  mPga4             |predicted| mIPF8796 C. albicans CA4800| 451 aa
                  mCrh11            |predicted| C. albicans |CA0375|: 453 aa
                  15363.2           |Pir1| CONTIG=Contig20045 POSCDS1=52307 POSCDS2=53464
                  mSod4/Pga2        |predicted| mIPF1218 C. albicans |CA4835| 232 aa
                  mPga36.1          |predicted1| mIPF10662| C. albicans fungus|CA3827| 392 aa
                  12297.1           CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 30 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

Switch to Protein Summary Report

To create a bookmark for this report, right click this link: Peptide Summary Report (../data/20050321/F002754.dat)

        Error tolerant   

1.    mALS3.5eoc                        Mass: 94266    Score: 663    Peptides matched: 8
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
21   695.85   1389.68   1389.66   0.02 0  61  4.8e-005 1  TCSSNGIFITYK
 33   844.89   1687.76   1688.75   -0.99 0  (18) 0.74 2  CFTAGTNTVTFNDGGK
34   845.38   1688.75   1688.75   0.00 0  143  2.8e-013 1  CFTAGTNTVTFNDGGK
35   564.63   1690.87   1690.85   0.02 0  62  3e-005 1  FTTSQTSVDLTAHGVK
41   909.43   1816.85   1816.84   0.01 1  110  4.7e-010 1  CFTAGTNTVTFNDGGKK
42   606.63   1816.86   1816.84   0.02 1  (101) 3.7e-009 1  CFTAGTNTVTFNDGGKK
51   1047.48   2092.94   2092.94   -0.00 0  112  2.8e-010 1  GLNDWNYPVSSESFSYTK
57   1274.65   2547.28   2547.31   -0.02 0  175  9.2e-017 1  ALGTVTLPLAFNVGGTGSSVDLEDSK

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 663    Peptides matched: 8
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 663    Peptides matched: 8
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928

2.    mSod5/Pga3                        Mass: 22006    Score: 425    Peptides matched: 6
 |validated by us| mIPF1222 C. albicans |CA4836| 228 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
7   568.27   1134.53   1134.51   0.02 0  60  8.4e-005 1  HGNIMGESYK
23   704.37   1406.73   1406.72   0.01 0  125  2.1e-011 1  AATPAAHEVGDLAGK
27   788.86   1575.71   1575.69   0.02 0  7  12 1  TEYDDSYISLNEK
56   593.82   2371.25   2371.23   0.02 0  61  2.7e-005 1  GLPSDIGPFPYHVHEKPVPASK
60   898.40   2692.19   2692.20   -0.01 1  173  1.3e-016 1  HGNIMGESYKTEYDDSYISLNEK
61   674.06   2692.20   2692.20   0.01 1  (53) 0.00012 1  HGNIMGESYKTEYDDSYISLNEK

 
      Proteins matching the same set of peptides:
      1222.2                            Mass: 23689    Score: 425    Peptides matched: 6
 |Pga3/Sod5| CONTIG=Contig10139 POSCDS1=124618 POSCDS2=125304
      25296.1                           Mass: 26345    Score: 425    Peptides matched: 6
 CONTIG=Contig20139 POSCDS1=124373 POSCDS2=125059
3.    mPhr1                             Mass: 58075    Score: 326    Peptides matched: 5
 |experimentally validated by us| C albicans |CA4857| 548 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   520.26   1038.52   1038.50   0.02 0  69  8.5e-006 1  SNTDASAFVK
25   503.57   1507.70   1507.67   0.02 1  40  0.0055 1  YNDPLADADACKR
26   781.40   1560.78   1560.77   0.01 1  34  0.022 1  NNPEWNLDLYKR
33   844.89   1687.76   1687.75   0.01 0  100  5.1e-009 1  VAIADYFSCGSLDDR
45   617.28   1848.83   1848.80   0.02 1  83  2e-007 1  VYAIDPDKDHEECMK

 
      Proteins matching the same set of peptides:
      15932.2                           Mass: 60276    Score: 326    Peptides matched: 5
 |Phr1| CONTIG=Contig10192 POSCDS1=117957 POSCDS2=119603
      23455.1                           Mass: 60747    Score: 326    Peptides matched: 5
 CONTIG=Contig20192 POSCDS1=117993 POSCDS2=119639
4.    mSSR1                             Mass: 20690    Score: 205    Peptides matched: 3
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
29   814.86   1627.71   1627.70   0.00 0  119  6.3e-011 1  CSGLNDLSCICTTK
37   854.90   1707.78   1707.78   0.00 0  85  1.4e-007 1  EICPNGDADTAISAFK
54   768.01   2301.00   2300.01   0.99 1  1  23 1  CSGLNDLSCICTTKNSDVEK

 
      Proteins matching the same set of peptides:
      3054.1                            Mass: 22993    Score: 205    Peptides matched: 3
 |Ssr1| CONTIG=Contig10262 POSCDS1=71490 POSCDS2=72194
5.    mRBT5                             Mass: 22745    Score: 188    Peptides matched: 2
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
38   876.93   1751.84   1751.82   0.01 1  65  1.5e-005 1  IYDQLPECAKECVK
63   1183.84   3548.49   3548.53   -0.04 0  122  6.1e-012 1  QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK

 
      Proteins matching the same set of peptides:
      19952.1                           Mass: 24614    Score: 188    Peptides matched: 2
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 188    Peptides matched: 2
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
6.    19771.1                           Mass: 142317   Score: 175    Peptides matched: 1
 |Als5| CONTIG=Contig10233 POSCDS1=63367 POSCDS2=67410
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 57   1274.65   2547.28   2547.31   -0.02 0  175  9.2e-017 1  ALGTVTLPIAFNVGGTGSSVDLEDSK

 
      Proteins matching the same set of peptides:
      21493.1                           Mass: 142567   Score: 175    Peptides matched: 1
 CONTIG=Contig20233 POSCDS1=62616 POSCDS2=66659
7.    TRBOTR                            Mass: 24662    Score: 140    Peptides matched: 2
 trypsin (EC3.4.21.4 ) precursor-bovine
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
8   577.30   1152.58   1152.57   0.02 0  78  1.1e-006 1  SSGTSYPDVLK
53   758.40   2272.17   2272.15   0.02 0  62  2.4e-005 1  SIVHPSYNSNTLNNDIMLIK

8.    mCHT2                             Mass: 59565    Score: 121    Peptides matched: 3
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
2   495.29   988.56   988.54   0.02 0  49  0.0012 1  LSSAIEEIK
3   510.29   1018.56   1018.54   0.02 0  38  0.013 1  GENFVVQVK
49   970.02   1938.02   1938.01   0.01 0  34  0.016 1  LFVGVPATSNIAGYVDTSK

 
      Proteins matching the same set of peptides:
      15860.2                           Mass: 61554    Score: 121    Peptides matched: 3
 |Cht2| CONTIG=Contig10194 POSCDS1=2376 POSCDS2=4127
      19719.2                           Mass: 51350    Score: 121    Peptides matched: 3
 CONTIG=Contig20194 POSCDS1=2710 POSCDS2=4131
9.    mALS4.5f                          Mass: 167909   Score: 110    Peptides matched: 1
 |predicted| C. albicans |CA1527| 1593 aa agglutinin-like, 5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
31   825.92   1649.83   1649.83   0.01 0  110  5.3e-010 1  FITDQTSIDLVADGR

 
      Proteins matching the same set of peptides:
      13010.2                           Mass: 169769   Score: 110    Peptides matched: 1
 |Als4.5'| CONTIG=Contig2201 POSCDS1=7312 POSCDS2=12093
10.   mPga24                            Mass: 52805    Score: 91     Peptides matched: 1
 |predicted| mIPF5185 C. albicans |CA1678| 533 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
14   635.84   1269.66   1269.64   0.02 0  91  5.5e-008 1  VITVVACDEHK

 
      Proteins matching the same set of peptides:
      5185.2                            Mass: 54872    Score: 91     Peptides matched: 1
 |Pga24/Ycw1| CONTIG=Contig10184 POSCDS1=48416 POSCDS2=50017
      23664.1                           Mass: 56212    Score: 91     Peptides matched: 1
 CONTIG=Contig20184 POSCDS1=48545 POSCDS2=50146
11.   mIPF8527|mPga29:                  Mass: 19928    Score: 82     Peptides matched: 2
 189 aa - Candida albicans unknown function
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   554.33   1106.65   1106.63   0.02 0  63  3.7e-005 1  TISSIQLFAK
22   468.90   1403.69   1403.66   0.03 1  18  0.9 1  YSESEYAVSNKK

12.   mPga4                             Mass: 47426    Score: 80     Peptides matched: 3
 |predicted| mIPF8796 C. albicans CA4800| 451 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
11   412.88   1235.63   1235.61   0.02 1  28  0.1 1  TKNPSGDGGYLK
17   677.37   1352.73   1352.71   0.02 0  48  0.00097 1  YFQELGINTIR
 29   814.86   1627.71   1626.79   0.92 0  4  20 2  TIPVGYSAASVDEYR

 
      Proteins matching the same set of peptides:
      8796.1                            Mass: 49422    Score: 80     Peptides matched: 3
 |Pga4| CONTIG=Contig10194 POSCDS1=248535 POSCDS2=249890
      23247.1                           Mass: 53324    Score: 80     Peptides matched: 3
 CONTIG=Contig20194 POSCDS1=251401 POSCDS2=252756
13.   mCrh11                            Mass: 44667    Score: 74     Peptides matched: 1
 |predicted| C. albicans |CA0375|: 453 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
39   890.93   1779.85   1779.83   0.01 0  74  1.8e-006 1  SSDCSPVPALGSSFLEK

 
      Proteins matching the same set of peptides:
      14360.2                           Mass: 46818    Score: 74     Peptides matched: 1
 |Crh11| CONTIG=Contig10158 POSCDS1=92919 POSCDS2=94280
      24611.1                           Mass: 47890    Score: 74     Peptides matched: 1
 CONTIG=Contig20158 POSCDS1=86016 POSCDS2=87377
14.   15363.2                           Mass: 40824    Score: 65     Peptides matched: 1
 |Pir1| CONTIG=Contig20045 POSCDS1=52307 POSCDS2=53464
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
50   663.99   1988.96   1988.93   0.03 0  65  1.5e-005 1  ACSSANNLEMTLHDSVLK

 
      Proteins matching the same set of peptides:
      m15363.2                          Mass: 38940    Score: 65     Peptides matched: 1
 |mPir1| 367 aa Candida albicans
      19968.1                           Mass: 36680    Score: 65     Peptides matched: 1
 |Pir1| CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
      m19968.1                          Mass: 34796    Score: 65     Peptides matched: 1
 |mPir1| 328 aa CONTIG=Contig10045 POSCDS1=52996 POSCDS2=54036
15.   mSod4/Pga2                        Mass: 22239    Score: 52     Peptides matched: 1
 |predicted| mIPF1218 C. albicans |CA4835| 232 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
15   650.36   1298.70   1298.68   0.02 0  52  0.00047 1  TPAALELGDLSGR

 
      Proteins matching the same set of peptides:
      1218.1                            Mass: 23826    Score: 52     Peptides matched: 1
 |Pga2/Sod4| CONTIG=Contig10139 POSCDS1=127254 POSCDS2=127952
      25297.1                           Mass: 25136    Score: 52     Peptides matched: 1
 CONTIG=Contig20139 POSCDS1=127009 POSCDS2=127707
16.   mPga36.1                          Mass: 35596    Score: 50     Peptides matched: 1
 |predicted1| mIPF10662| C. albicans fungus|CA3827| 392 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
43   608.59   1822.75   1822.74   0.02 0  50  0.00038 1  ADQICNDHCSNAYQK

 
      Proteins matching the same set of peptides:
      10662.2                           Mass: 37379    Score: 50     Peptides matched: 1
 |Pga36| CONTIG=Contig10233 POSCDS1=119212 POSCDS2=120390
      21466.1                           Mass: 39845    Score: 50     Peptides matched: 1
 CONTIG=Contig20233 POSCDS1=118488 POSCDS2=119666
17.   12297.1                           Score: 34     Peptides matched: 1
 CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 38   876.93   1751.84   1750.84   1.00 1  34  0.019 2  IYDQIPKCAQECVK

 
      Proteins matching the same set of peptides:
      24214.1                           Score: 34     Peptides matched: 1
18.   3292.2                            Mass: 80133    Score: 26     Peptides matched: 1
 CONTIG=Contig10203 POSCDS1=88218 POSCDS2=90344
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
9   582.81   1163.61   1164.73   -1.12 1  26  0.19 1  FIVFVTAIKK

 
      Proteins matching the same set of peptides:
      22868.1                           Mass: 82654    Score: 26     Peptides matched: 1
 CONTIG=Contig20203 POSCDS1=88211 POSCDS2=90337
19.   8884.2                            Score: 23     Peptides matched: 1
 CONTIG=Contig10176 POSCDS1=47092 POSCDS2=54798
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 3   510.29   1018.56   1018.54   0.02 0  23  0.42 2  DANVFVLNK

 
      Proteins matching the same set of peptides:
      23847.1                           Score: 23     Peptides matched: 1
20.   9023.3                            Mass: 33980    Score: 18     Peptides matched: 1
 |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
44   924.42   1846.82   1846.82   0.01 1  18  0.62 1  ADGPYNAEKYWGIYSN

 
      Proteins matching the same set of peptides:
      15898.1                           Mass: 39582    Score: 18     Peptides matched: 1
 |Scw1| CONTIG=Contig20125 POSCDS1=83941 POSCDS2=85077
      m15898.1|mSCW1:                   Mass: 35901    Score: 18     Peptides matched: 1
 346 aa - glucanase (by homology) Candida albicans
Peptide matches not assigned to protein hits: (no details means no match)
List sorted by Decreasing Score. Sort by Decreasing Intensity or Increasing Query # / Mr

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   619.80   1237.59   1236.60   0.99 1  12  4.5 1  DTKGGFLQDEK
30   821.88   1641.74   1641.80   -0.05 0  11  4.6 1  QSHASTAVTSSSSAPPK
20   463.91   1388.71   1387.76   0.95 1  6  18 1  KTFQPGLWNLGK
32   836.87   1671.73   1670.78   0.96 1  5  17 1  DNNFEKSLSDFDIK
1   432.69   863.36   862.42   0.94 0  4  33 1  QDMIAASK
13   625.31   1248.62   1247.61   1.00 1  3  33 1  NSNTNNSLKEK
16   660.82   1319.63   1320.77   -1.14 0  3  31 1  ISIVLYEIIMK
40   900.91   1799.80   1799.95   -0.14 1  2  31 1  YVISEPLHQFRFHK
18   681.85   1361.69   1360.76   0.93 0  2  48 1  NLIELGLSLFDK
24   478.24   1431.71   1430.75   0.96 1  1  44 1  TVLIWTQDRDGK
5   548.77   1095.52         
10   615.28   1228.54         
19   460.91   1379.69         
28   535.61   1603.81         
36   565.28   1692.80         
46   931.89   1861.76         
47   475.21   1896.82         
48   953.93   1905.85         
52   734.72   2201.14         
55   790.33   2367.98         
58   1275.61   2549.21         
59   850.75   2549.23         
62   1124.81   3371.40         
64   1191.17   3570.49         
65   897.63   3586.47         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Data File Name         : cw0134_q1.pkl
Number of queries      : 65

Mascot:  http://www.matrixscience.com/ 

Top scoring peptide matches to query 1
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.3    0.94                                        QDMIAASK
  3.9   -0.15                                        LTIYLNK
  1.8    0.91                                        LINFDNK
Top scoring peptide matches to query 2
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 48.7    0.02   8                             mCHT2  LSSAIEEIK
 12.4   -0.99                                        NSSLSNLKK
 11.3   -0.92                                        NSIASAGENK
  6.5   -0.03                                        ISKLSNISK
  6.0   -0.05                                        IRLFALEK
  5.9    0.09                                        MSFSATAFK
  5.4    0.03                                        ISTHAVSFK
  4.7    0.00                                        SLNSQSLIK
  4.3    0.04                                        IRSEDEIK
  3.9   -0.02                                        LSPIRTFR
Top scoring peptide matches to query 3
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 38.3    0.02   8                             mCHT2  GENFVVQVK
 23.2    0.02  19                            8884.2  DANVFVLNK
 17.7    1.08                                        IWNANTGDK
  8.9    1.05                                        NANEDLSKK
  6.4   -0.02                                        LGKMVIGSSK
  5.9   -0.97                                        GEFDVNLVK
  5.3    1.00                                        VRVLMTGDK
  5.1    0.01                                        GGFGEVVKAR
  5.1    0.98                                        GELTTTIRK
  4.9    0.98                                        GQLSGTKLSK
Top scoring peptide matches to query 4
Score greater than 29 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 69.3    0.02   3                             mPhr1  SNTDASAFVK
 12.4    0.98                                        SITFKAEDK
 11.3    1.04                                        GLMDCLMAK
  9.0   -1.06                                        MATVIPPPSK
  7.5   -0.04                                        ITVHNGDRK
  7.0    0.05                                        NSQSEYSPK
  6.9   -1.07                                        LAHIQPSFK
  6.8   -0.10                                        SGPSVIVPRK
  6.1   -1.10                                        SPQSIKPKR
  4.7   -0.02                                        NSSLTVGYAK
Top scoring peptide matches to query 5
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 6
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 63.0    0.02  11                  mIPF8527|mPga29:  TISSIQLFAK
  6.8   -0.97                                        SAGTFGKILSK
  6.8   -0.90                                        YSINQLDGAK
  6.0    0.08                                        TSNAKLMQSK
  5.8   -0.90                                        SQLVSMCRK
  4.3    0.04                                        ITNFFQIPK
  3.9   -0.91                                        DWETFGILK
  3.7    0.13                                        DVSEGAGPTFK
  3.1   -1.00                                        NLHSQRIIK
  2.4    0.02                                        TILDTAAKFK
Top scoring peptide matches to query 7
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 59.7    0.02   2                        mSod5/Pga3  HGNIMGESYK
  6.8    0.00                                        HASINSTDYK
  1.5   -0.10                                        LLEYVNKEK
  0.0   -1.08                                        KELDDLIYK
Top scoring peptide matches to query 8
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 77.9    0.02   7                            TRBOTR  SSGTSYPDVLK
  9.9    1.01                                        MVNTTSTSRR
  9.5   -0.01                                        NLVFDYINR
  8.8   -0.01                                        IIYCTGITGR
  8.8    1.04                                        SIMSGMVWNK
  8.8    1.07                                        SMLSEESNQK
  7.6    0.00                                        LMNIVNMYR
  6.5   -0.09                                        LTTSYKTLVK
  5.5    0.04                                        ISDASDDKFR
  3.8    0.10                                        QHGAPEDDER
Top scoring peptide matches to query 9
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 25.6   -1.12  18                            3292.2  FIVFVTAIKK
  8.6   -0.00                                        QGTGTSASSIKK
  3.2    1.07                                        MIMALVNDEQ
  3.0   -0.01                                        ATSTSLTMPKK
  2.6    1.02                                        DLAMEDITKK
  2.3   -0.06                                        LFKSAVMIQK
  1.9   -0.09                                        QPNIINPKLK
  1.1    0.98                                        ALTFVGGDKAGK
Top scoring peptide matches to query 10
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 11
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 28.2    0.02  12                             mPga4  TKNPSGDGGYLK
  4.6   -1.02                                        GKWLNTDYLK
  2.5    0.95                                        LEEIVYTQLK
Top scoring peptide matches to query 12
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 11.7    0.99                                        DTKGGFLQDEK
  7.9    1.03                                        KDTMELEEDK
  4.4   -1.09                                        LCTTLMLLFK
  4.3    1.00                                        GLSLEVDDFDK
  3.1    1.01                                        KDAEAWFNEK
  1.1    0.95                                        LGTKINYGDEK
  0.7    0.98                                        YQNNINSKEK
Top scoring peptide matches to query 13
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.5    1.00                                        NSNTNNSLKEK
  1.3    0.98                                        KAAVIVDNMCK
  1.1    0.92                                        IYVNGGLKQTR
Top scoring peptide matches to query 14
Score greater than 29 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 90.6    0.02  10                            mPga24  VITVVACDEHK
 11.3   -0.06                                        VITPSISDLTPK
  6.3   -0.07                                        IVLSQVNEIQK
  2.1   -0.02                                        VLQNNARQEAK
  1.6   -0.10                                        LISVEKLNNLK
  0.9    0.95                                        TIQSLGAQGLGPK
  0.3    1.02                                        KLAGGVDFDGYK
Top scoring peptide matches to query 15
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 51.5    0.02  15                        mSod4/Pga2  TPAALELGDLSGR
Top scoring peptide matches to query 16
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.4   -1.14                                        ISIVLYEIIMK
  3.0    0.96                                        NLEPYAVELGSK
  2.7   -1.15                                        VAAIGLTKNHLGK
  2.5   -1.00                                        VTGCEVPTPYAK
  0.9    0.91                                        NPFSIELPFKK
Top scoring peptide matches to query 17
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 47.7    0.02  12                             mPga4  YFQELGINTIR
  4.7    0.01                                        FAAERYIISQR
  4.4    1.04                                        CISNQLAKQYK
  4.1   -1.09                                        LVVVNLTNLLEK
  3.1    1.19                                        GCCTSPEDGLEK
Top scoring peptide matches to query 18
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.7    0.93                                        NLIELGLSLFDK
Top scoring peptide matches to query 19
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 20
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.5    0.95                                        KTFQPGLWNLGK
  5.5   -0.97                                        KFDDPEVINDAK
  2.7   -0.91                                        CQELQDNLDQK
  1.5    0.00                                        ATPALLYHDNFK
  1.3   -0.05                                        GGAVTHGLLHSRGK
  0.6   -0.98                                        WQSTINTIENGK
Top scoring peptide matches to query 21
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 61.4    0.02   1                        mALS3.5eoc  TCSSNGIFITYK
  7.6   -1.08                                        TRALNVVVNYDK
  5.1   -0.19                                        GVSHLIIVQIIAK
  3.7    0.02                                        FNSEEQFSKFK
  3.5   -0.03                                        VPPTKPSATYSDK
  2.9   -0.98                                        NFHHGRFFSSR
  2.5   -1.10                                        NLTLFSKPKTDK
  1.4    0.95                                        YPQYYKISSLK
  1.2   -1.05                                        TCMEAIQKVALK
  1.1   -1.05                                        GFSASSARLPGVSR
Top scoring peptide matches to query 22
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 18.5    0.03  11                  mIPF8527|mPga29:  YSESEYAVSNKK
Top scoring peptide matches to query 23
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
124.7    0.01   2                        mSod5/Pga3  AATPAAHEVGDLAGK
  6.2    1.00                                        DSPSPPPPPPPPPK
  3.6    0.06                                        SDSQSDIRSSTPK
  1.6    0.05                                        QAQERDEYLQK
  1.5   -1.06                                        IIGYTPPPTGHKK
  0.7   -0.92                                        NADSSKTNSDLEK
Top scoring peptide matches to query 24
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.3    0.96                                        TVLIWTQDRDGK
Top scoring peptide matches to query 25
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 39.8    0.02   3                             mPhr1  YNDPLADADACKR
Top scoring peptide matches to query 26
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 34.1    0.01   3                             mPhr1  NNPEWNLDLYKR
Top scoring peptide matches to query 27
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  6.8    0.02   2                        mSod5/Pga3  TEYDDSYISLNEK
Top scoring peptide matches to query 28
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 29
Score greater than 24 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
118.7    0.00   4                             mSSR1  CSGLNDLSCICTTK
  3.6    0.92  12                             mPga4  TIPVGYSAASVDEYR
  0.0   -0.11                                        TFSCPYLLIMVER
Top scoring peptide matches to query 30
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.6   -0.05                                        QSHASTAVTSSSSAPPK
  0.1   -0.08                                        IKNHEEIYQFHGK
Top scoring peptide matches to query 31
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
110.3    0.01   9                          mALS4.5f  FITDQTSIDLVADGR
  6.0   -0.02                                        VFDYAQQPLRATNK
  3.8    0.01                                        CMLLSIAYLSHTNK
  2.7   -0.03                                        YLSLDNNINEIKSK
  1.4   -1.09                                        LFDTKAIDIIEFVK
  1.1    0.00                                        SEKICSQEQTLSIK
  0.1   -1.04                                        HGIVEEYPPIVDKR
Top scoring peptide matches to query 32
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  4.8    0.96                                        DNNFEKSLSDFDIK
  2.8    0.78                                        IAAKRPTCVTIGSGIK
Top scoring peptide matches to query 33
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
100.0    0.01   3                             mPhr1  VAIADYFSCGSLDDR
 18.4   -0.99   1                        mALS3.5eoc  CFTAGTNTVTFNDGGK
  6.4   -1.19                                        GLAIGIALLSYGREEK
Top scoring peptide matches to query 34
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
142.7    0.00   1                        mALS3.5eoc  CFTAGTNTVTFNDGGK
  2.4   -1.08                                        KTTSTTSASSTTTTSTK
  0.2   -0.06                                        RDHSTTSNSPSVIFAA
  0.0   -0.06                                        CFISFPMITWAFLG
Top scoring peptide matches to query 35
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 62.4    0.02   1                        mALS3.5eoc  FTTSQTSVDLTAHGVK
Top scoring peptide matches to query 36
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 37
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 85.4    0.00   4                             mSSR1  EICPNGDADTAISAFK
  2.1   -0.07                                        SSDLSPTKTNLESTTK
  0.8   -0.10                                        SDSLHVIQSSPPSINK
  0.4   -1.10                                        ENLEVPFIWNHRR
  0.1   -0.15                                        QLFAQVTNPPIDPIR
Top scoring peptide matches to query 38
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 65.1    0.01   5                             mRBT5  IYDQLPECAKECVK
 34.0    1.00  17                           12297.1  IYDQIPKCAQECVK
 12.5    1.00                                        TTQSTLNFEPLGDSNK
  4.8   -0.04                                        DLGELSIMDNLYKNK
  3.8   -0.04                                        YLDSFPFEFYVVVK
  2.7   -0.06                                        SWLPSIYLCITGTNK
  2.4   -1.20                                        NSVPVTLKNSILEVLK
  1.9    1.04                                        CWKTNEDWITAAEK
  0.3   -1.03                                        FLQENNNYDTLVVGK
  0.3   -1.02                                        HDYSAKQAHVELAER
Top scoring peptide matches to query 39
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 74.2    0.01  13                            mCrh11  SSDCSPVPALGSSFLEK
 12.6   -0.03                                        KSFTSTTTTTTSSTTTK
  2.1   -0.01                                        AMSFMFEYLDGKITK
Top scoring peptide matches to query 40
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  1.8   -0.14                                        YVISEPLHQFRFHK
  0.7   -0.09                                        FKDIDETTAFIASNTK
Top scoring peptide matches to query 41
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
110.4    0.01   1                        mALS3.5eoc  CFTAGTNTVTFNDGGKK
  0.4   -0.14                                        LIDLIFQPIFNDLEK
Top scoring peptide matches to query 42
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
101.4    0.02   1                        mALS3.5eoc  CFTAGTNTVTFNDGGKK
  1.7   -0.14                                        LIDLIFQPIFNDLEK
  0.6    1.01                                        YNKEVMTAEEFATAGR
Top scoring peptide matches to query 43
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 50.0    0.02  16                          mPga36.1  ADQICNDHCSNAYQK
  1.3   -0.25                                        LSILLTFSSINESKSGK
  0.4   -1.14                                        QSVLVMNSEEVFESVK
Top scoring peptide matches to query 44
Score greater than 14 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 18.4    0.01  20                            9023.3  ADGPYNAEKYWGIYSN
Top scoring peptide matches to query 45
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 83.2    0.02   3                             mPhr1  VYAIDPDKDHEECMK
Top scoring peptide matches to query 46
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 47
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 48
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 49
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 34.3    0.01   8                             mCHT2  LFVGVPATSNIAGYVDTSK
  0.3    1.03                                        GDVGWQNSIRHNLSLNK
Top scoring peptide matches to query 50
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 64.5    0.03  14                           15363.2  ACSSANNLEMTLHDSVLK
  1.2    0.98                                        MSCPNALLSLHLDYIGGK
Top scoring peptide matches to query 51
Score greater than 19 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
111.7   -0.00   1                        mALS3.5eoc  GLNDWNYPVSSESFSYTK
Top scoring peptide matches to query 52
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 53
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 61.6    0.02   7                            TRBOTR  SIVHPSYNSNTLNNDIMLIK
  2.5   -1.12                                        QILHALAINANNESVGQKLLK
Top scoring peptide matches to query 54
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.8    0.99   4                             mSSR1  CSGLNDLSCICTTKNSDVEK
Top scoring peptide matches to query 55
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 56
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 61.0    0.02   2                        mSod5/Pga3  GLPSDIGPFPYHVHEKPVPASK
  4.1    0.04                                        IGSSNPITIYEDQMLIEALHK
  2.8   -0.10                                        GLAISLPITCYGLSALLGAQILK
Top scoring peptide matches to query 57
Score greater than 23 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
174.6   -0.02   1                        mALS3.5eoc  ALGTVTLPLAFNVGGTGSSVDLEDSK
174.6   -0.02   6                           19771.1  ALGTVTLPIAFNVGGTGSSVDLEDSK
Top scoring peptide matches to query 58
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 59
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 60
Score greater than 23 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
173.1   -0.01   2                        mSod5/Pga3  HGNIMGESYKTEYDDSYISLNEK
Top scoring peptide matches to query 61
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 53.5    0.01   2                        mSod5/Pga3  HGNIMGESYKTEYDDSYISLNEK
Top scoring peptide matches to query 62
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 63
Score greater than 20 indicates homology
Score greater than 23 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
122.5   -0.04   5                             mRBT5  QSTSSTPCPYWDTGCLCVMPQFAGAVGNCVAK
Top scoring peptide matches to query 64
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 65
Score greater than 22 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide