Mascot Search Results

User            : 
Email           : 
Search title    : 
MS data file    : cw0097_q1.pkl
Database        : CAlbicans dos (20286 sequences; 6720281 residues)
Timestamp       : 21 Mar 2005 at 16:02:09 GMT
Significant hits: Glu-C       |Endoproteinase- mature protein - (Staphylococcal serine proteinase) ACC P04188
                  9023.3      |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
                  mEcm33.3    |predicted|m5366.2|CaECM33
                  mRBT5       |predicted| C. albicans fungus|CA2558| 241 aa
                  mALS3.5eoc  |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
                  mSSR1       |Candida albicans 212 aa - Secretory Stress Response

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 30 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

Switch to Protein Summary Report

To create a bookmark for this report, right click this link: Peptide Summary Report (../data/20050321/F002748.dat)

        Error tolerant   

1.    Glu-C                             Mass: 29006    Score: 335    Peptides matched: 8
 |Endoproteinase- mature protein - (Staphylococcal serine proteinase) ACC P04188
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
5   570.38   1138.75   1138.63   0.11 0  49  0.00069 1  TLLTNKHVVD
7   408.61   1222.81   1222.69   0.12 0  24  0.23 1  SKGKITYLKGE
8   630.87   1259.72   1259.62   0.11 0  64  2.7e-005 1  VVKPATMSNNAE
11   645.41   1288.80   1288.67   0.14 1  41  0.0052 1  GDLAIVKFSPNE
13   458.96   1373.87   1373.74   0.12 0  (35) 0.019 1  NVRNFLKQNIE
14   687.94   1373.87   1373.74   0.13 0  51  0.00052 1  NVRNFLKQNIE
26   481.80   1923.19   1923.02   0.17 1  85  1e-007 1  LAIVKFSPNEQNKHIGE
28   664.06   1989.15   1988.97   0.18 0  20  0.36 1  ATHGDPHALKAFPSAINQD

 
      Proteins matching the same set of peptides:
      Glu-C/V8                          Mass: 36304    Score: 335    Peptides matched: 8
 |Endoproteinase precursor (Staphylococcal serine proteinase) ACC P04188

2.    9023.3                            Mass: 33980    Score: 112    Peptides matched: 1
 |Scw1| CONTIG=Contig10125 POSCDS1=84138 POSCDS2=85121
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
25   932.05   1862.09   1861.94   0.15 1  112  3.1e-010 1  LVNAGSATPSQIKAYVDE

3.    mEcm33.3                          Mass: 41984    Score: 101    Peptides matched: 2
 |predicted|m5366.2|CaECM33
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
6   574.87   1147.72   1147.61   0.11 0  72  5.2e-006 1  KTGLTAGITSAE
10   640.92   1279.82   1279.69   0.13 0  32  0.039 1  LRSFSGFPKLE

 
      Proteins matching the same set of peptides:
      5366.2                            Mass: 43798    Score: 101    Peptides matched: 2
 |Ecm33.3| CaECM33 CONTIG=Contig10163 POSCDS1=164904 POSCDS2=166142
      24311.1                           Mass: 42880    Score: 101    Peptides matched: 2
 CONTIG=Contig20163 POSCDS1=164513 POSCDS2=165751
4.    mRBT5                             Mass: 22745    Score: 63     Peptides matched: 1
 |predicted| C. albicans fungus|CA2558| 241 aa
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
23   908.47   1814.92   1814.76   0.16 0  63  2.4e-005 1  CVKQSTSSTPCPYWD

 
      Proteins matching the same set of peptides:
      12297.1                           Mass: 15525    Score: 63     Peptides matched: 1
 CONTIG=Contig10166 POSCDS1=62870 POSCDS2=63313
      19952.1                           Mass: 24614    Score: 63     Peptides matched: 1
 |Rbt5| CONTIG=Contig10231 POSCDS1=6478 POSCDS2=7203
      21544.1                           Mass: 25457    Score: 63     Peptides matched: 1
 CONTIG=Contig20231 POSCDS1=6478 POSCDS2=7203
      24214.1                           Mass: 16067    Score: 63     Peptides matched: 1
 CONTIG=Contig20166 POSCDS1=63254 POSCDS2=63697
5.    mALS3.5eoc                        Mass: 94266    Score: 51     Peptides matched: 1
 |predicted| C. albicans |CA0591| 886 aa agglutinin-like,5-prime end
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
12   682.91   1363.80   1363.67   0.13 0  51  0.00052 1  RSNVDPKGYLTD

 
      Proteins matching the same set of peptides:
      12561.3                           Mass: 95687    Score: 51     Peptides matched: 1
 |Als3.5'| CONTIG=Contig10129 POSCDS1=15287 POSCDS2=17932
      25511.1                           Mass: 95687    Score: 51     Peptides matched: 1
 |Als3.5'| CONTIG=Contig20129 POSCDS1=15283 POSCDS2=17928
6.    mSSR1                             Mass: 20690    Score: 42     Peptides matched: 1
 |Candida albicans 212 aa - Secretory Stress Response
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
16   750.46   1498.90   1497.77   1.14 0  42  0.0035 1  APPACLLACVAKVE

7.    848.1                             Mass: 64548    Score: 20     Peptides matched: 2
 CONTIG=Contig2507 POSCDS1=58057 POSCDS2=59742
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 13   458.96   1373.87   1374.82   -0.96 1  (1) 44 8  KFNLKLKKIDE
 14   687.94   1373.87   1374.82   -0.96 1  23  0.32 2  KFNLKLKKIDE

8.    12258.2                           Mass: 94881    Score: 19     Peptides matched: 1
 CONTIG=Contig10215 POSCDS1=289938 POSCDS2=292448
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 6   574.87   1147.72   1147.58   0.14 0  19  0.91 2  KGIKQSNSSAE

 
      Proteins matching the same set of peptides:
      16151.2                           Score: 19     Peptides matched: 1
9.    12784.2                           Mass: 67582    Score: 16     Peptides matched: 1
 CONTIG=Contig10170 POSCDS1=36274 POSCDS2=38043
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   750.46   1498.90   1498.80   0.11 1  16  1.2 2  EGLVKVNSQVANLE

 
      Proteins matching the same set of peptides:
      24120.1                           Mass: 68417    Score: 16     Peptides matched: 1
 CONTIG=Contig20170 POSCDS1=37244 POSCDS2=39013
10.   10139.2                           Mass: 10114    Score: 16     Peptides matched: 1
 CONTIG=Contig10051 POSCDS1=43539 POSCDS2=43823
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
1   463.30   924.59   924.50   0.09 0  16  1.8 1  VSAAHKVVD

 
      Proteins matching the same set of peptides:
      26904.1                           Mass: 10114    Score: 16     Peptides matched: 1
 CONTIG=Contig20051 POSCDS1=43561 POSCDS2=43845
11.   4628.1                            Score: 12     Peptides matched: 2
 CONTIG=Contig10237 POSCDS1=174281 POSCDS2=177337
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 13   458.96   1373.87   1374.79   -0.92 1  (1) 49 9  KFQKVIKVQEE
 14   687.94   1373.87   1374.79   -0.92 1  12  3.4 3  KFQKVIKVQEE

 
      Proteins matching the same set of peptides:
      21143.1                           Score: 12     Peptides matched: 2
12.   7005.2                            Score: 12     Peptides matched: 1
 CONTIG=Contig10202 POSCDS1=36271 POSCDS2=37992
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 10   640.92   1279.82   1279.66   0.17 0  12  3.5 2  NVRYVYQPLE

 
      Proteins matching the same set of peptides:
      22965.1                           Score: 12     Peptides matched: 1
13.   230.2                             Mass: 249169   Score: 12     Peptides matched: 1
 CONTIG=Contig10172 POSCDS1=74519 POSCDS2=81022
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 5   570.38   1138.75   1138.63   0.12 0  12  3.7 2  TIIFYLQLE

 
      Proteins matching the same set of peptides:
      24051.1                           Mass: 253355   Score: 12     Peptides matched: 1
 CONTIG=Contig20172 POSCDS1=74487 POSCDS2=80990
14.   10341.1                           Score: 11     Peptides matched: 1
 CONTIG=Contig10218 POSCDS1=58438 POSCDS2=58845
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   687.94   1373.87   1373.73   0.13 1  11  4.5 4  FLKKDIYYRE

 
      Proteins matching the same set of peptides:
      22175.1                           Score: 11     Peptides matched: 1
15.   11245.2                           Score: 11     Peptides matched: 1
 CONTIG=Contig10246 POSCDS1=35677 POSCDS2=40077
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   687.94   1373.87   1374.73   -0.86 1  11  4.7 5  KVKQFESPQRE

 
      Proteins matching the same set of peptides:
      20811.1                           Score: 11     Peptides matched: 1
16.   10418.1                           Score: 11     Peptides matched: 1
 CONTIG=Contig10223 POSCDS1=15770 POSCDS2=18604
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   687.94   1373.87   1373.71   0.15 1  11  5.2 6  VNNNTSELKKVE

 
      Proteins matching the same set of peptides:
      17210.3                           Score: 11     Peptides matched: 1
17.   11638.2                           Mass: 117535   Score: 11     Peptides matched: 1
 CONTIG=Contig20198 POSCDS1=33116 POSCDS2=36268
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
24   614.08   1839.21   1839.04   0.17 0  11  3 1  VTQRALNTLRRVGAVGE

 
      Proteins matching the same set of peptides:
      16826.3                           Mass: 121302   Score: 11     Peptides matched: 1
 CONTIG=Contig10198 POSCDS1=33100 POSCDS2=36252
18.   mCHT2                             Score: 10     Peptides matched: 1
 583 aa - chitinase 2 precursor Candida albicans
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 11   645.41   1288.80   1289.75   -0.94 0  10  6.2 2  LATALRGKFAKD

 
      Proteins matching the same set of peptides:
      15860.2                           Score: 10     Peptides matched: 1
      19719.2                           Score: 10     Peptides matched: 1
19.   4923.1                            Score: 10     Peptides matched: 1
 CONTIG=Contig2518 POSCDS1=195544 POSCDS2=196074
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 14   687.94   1373.87   1373.73   0.14 0  10  6.3 7  TVGLNPRYLNVE

20.   18670.1                           Score: 9      Peptides matched: 1
 CONTIG=Contig10057 POSCDS1=80870 POSCDS2=81220
Check to include this hit in error tolerant search or archive report
       
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
 16   750.46   1498.90   1498.63   0.28 1  9  6.3 3  QSDQXQASTPSGGAE

Peptide matches not assigned to protein hits: (no details means no match)
List sorted by Decreasing Score. Sort by Decreasing Intensity or Increasing Query # / Mr

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Peptide
4   563.33   1124.65   1123.51   1.14 0  9  9.8 1  RNAQNQHQE
27   974.57   1947.13   1948.08   -0.94 1  7  7.1 1  EYGSSLLVVLTLGAISLVD
3   554.27   1106.52   1106.52   -0.00 1  7  15 1  RTGSDTTLGAE
2   546.29   1090.56   1090.55   0.01 1  6  20 1  SSPVKKSTEE
20   806.43   1610.84   1611.81   -0.97 1  6  15 1  QIVISNIVDHSTTGE
22   604.02   1809.05   1808.94   0.11 1  3  19 1  TIKVNRLDYNLNFAE
34   1054.81   3161.41   3161.36   0.05 1  1  11 1  NSTTPNGDWSQSKAFTNSGSSFPALNGTCE
9   427.61   1279.81         
15   733.91   1465.81         
17   751.86   1501.70         
18   507.25   1518.72         
19   760.37   1518.73         
21   899.94   1797.88         
29   674.07   2019.20         
30   697.39   2089.14         
31   852.08   2553.21         
32   938.10   2811.27         
33   1011.86   3032.56         
35   1065.88   3194.62         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : V8-DE
Fixed modifications    : Carbamidomethyl (C)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 1.2 Da
Fragment Mass Tolerance: ± 0.6 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Data File Name         : cw0097_q1.pkl
Number of queries      : 35

Mascot:  http://www.matrixscience.com/ 

Top scoring peptide matches to query 1
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 16.1    0.09  10                           10139.2  VSAAHKVVD
  7.7    0.13                                        TLLYAMVD
  7.4    0.15                                        ELSSYIVD
  4.8    0.05                                        IVLNRPVD
  3.2   -0.81                                        TNLYSDVD
  3.1    1.13                                        GGVVYTITD
  2.1    1.13                                        GSSIVLGYE
  1.5    0.18                                        IHHMTASE
  1.5    1.13                                        VNLSYSIE
  1.1    0.17                                        LKSDNGYE
Top scoring peptide matches to query 2
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  6.3    0.01                                        SSPVKKSTEE
  5.3    0.03                                        SVKVGNPFDE
  4.0    0.97                                        SMKQKLINE
  4.0    0.03                                        FINIDQNID
  3.5    0.06                                        MSDNNIVGIE
  3.4   -0.04                                        KYSKPLNLE
  2.5   -0.97                                        SNGQQGILFE
  1.3   -0.98                                        RIDIWFNE
  1.3   -0.01                                        SMTVLNAKVE
  0.9    0.13                                        NYQYYDPE
Top scoring peptide matches to query 3
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  6.8   -0.00                                        RTGSDTTLGAE
  6.8    0.98                                        KAQAFGLNEE
  6.2    1.02                                        ETIMNSSVPE
  4.8   -0.08                                        FTKQLVKDE
  4.7    0.92                                        QTKVIELFE
  4.6   -0.08                                        KTFVGLAKDE
  4.0    0.94                                        KDLNFNKLD
  3.6    0.88                                        KLTKVIEFE
  3.6    0.03                                        NYQEQPISE
  3.4   -1.03                                        SNGYVVDLIE
Top scoring peptide matches to query 4
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  8.5    1.14                                        RNAQNQHQE
  6.4   -0.03                                        SIIKVIPQLD
  0.5    0.04                                        VISIESLHLD
Top scoring peptide matches to query 5
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 49.3    0.11   1                             Glu-C  TLLTNKHVVD
 12.1    0.12  13                             230.2  TIIFYLQLE
  6.3    0.09                                        DVLNPVLKIE
  2.3    0.19                                        FSPESIFALE
  1.5    0.22                                        WLEPAVFYD
  1.3    0.15                                        LFREIIGYE
  0.2    0.09                                        RRRIDPLVD
Top scoring peptide matches to query 6
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 71.6    0.11   3                          mEcm33.3  KTGLTAGITSAE
 19.1    0.14   8                           12258.2  KGIKQSNSSAE
  8.4    0.15                                        KITLSDTQNE
  8.3    0.13                                        AFIADIAKGNE
  8.2    0.12                                        KAKAKCDKAE
  7.8    1.09                                        LSAKITAAMLE
  6.6    1.13                                        QMKLAIESVE
  5.7   -0.84                                        GHNVTIATHAE
  4.4    0.19                                        MQQIISHYE
  4.3    0.13                                        VQRTRTATSE
Top scoring peptide matches to query 7
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 23.7    0.12   1                             Glu-C  SKGKITYLKGE
  2.1   -0.74                                        GAHVWDPEGKE
  1.7    0.15                                        QIVELLTRHD
  0.6    1.12                                        KIKLYSIVSGD
Top scoring peptide matches to query 8
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 64.3    0.11   1                             Glu-C  VVKPATMSNNAE
  7.8   -0.00                                        KSMAKLNKLVE
  1.9    0.08                                        NKSIGINNSGKE
  1.9    0.13                                        NSNNSIDALIAE
  1.4    1.06                                        KESAKNQRIAD
Top scoring peptide matches to query 9
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 10
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 32.0    0.13   3                          mEcm33.3  LRSFSGFPKLE
 12.4    0.17  12                            7005.2  NVRYVYQPLE
  9.9    0.18                                        VNGYTKNDKIE
  7.4    1.15                                        KISRFYSIHE
  5.5   -0.85                                        QLILGGYFQKD
  4.0    0.10                                        LHQKKKEQIE
  3.9    1.09                                        VRLVAPGTPQLE
  3.2    0.06                                        FLGGKVKFKKE
  3.0    0.19                                        YLDGIAVGGSSLE
  2.0    1.13                                        KNLPIQTHISE
Top scoring peptide matches to query 11
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 41.1    0.14   1                             Glu-C  GDLAIVKFSPNE
 10.4   -0.94  18                             mCHT2  LATALRGKFAKD
  7.4    0.10                                        SVVARLSIQTSE
  5.7    1.13                                        QLNLQKEISSE
  4.9   -0.75                                        ENNSNNQITQE
  2.7    0.10                                        FNEKVLAXINE
  2.7    0.10                                        FNEKVLAXINE
  2.2   -0.85                                        KDNILEPFVSE
  2.2    0.14                                        IEFNIVSKNPE
  1.0    1.04                                        KLIRGSTKTRE
Top scoring peptide matches to query 12
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 50.7    0.13   5                        mALS3.5eoc  RSNVDPKGYLTD
  5.9   -0.84                                        NAGSVTSATKVTDD
  5.3    0.17                                        FVNNINNGGSITD
  3.5    0.16                                        NWPTFEKNLSE
  0.4    1.15                                        KINESCQNKKD
Top scoring peptide matches to query 13
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 34.9    0.12   1                             Glu-C  NVRNFLKQNIE
 10.8   -0.74                                        NFQNLYGYVEE
  6.7    0.18                                        LYLSHNGISEIE
  5.2    0.11                                        GFGKIVGDIIGGIE
  2.8    1.13                                        MNKIEQLKQLE
  2.2    0.13                                        LHPHHHVQIKE
  1.5   -0.80                                        NSSTLEGPKVNTE
  1.4   -0.96   7                             848.1  KFNLKLKKIDE
  0.9   -0.92  11                            4628.1  KFQKVIKVQEE
Top scoring peptide matches to query 14
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 50.6    0.13   1                             Glu-C  NVRNFLKQNIE
 22.8   -0.96   7                             848.1  KFNLKLKKIDE
 12.5   -0.92  11                            4628.1  KFQKVIKVQEE
 11.3    0.13  14                           10341.1  FLKKDIYYRE
 11.1   -0.86  15                           11245.2  KVKQFESPQRE
 10.6    0.15  16                           10418.1  VNNNTSELKKVE
  9.8    0.14  19                            4923.1  TVGLNPRYLNVE
  9.1    0.11                                        GFGKIVGDIIGGIE
  7.9    0.02                                        LSTTKITKKIIE
  7.4    0.16                                        FVKKNSHETRE
Top scoring peptide matches to query 15
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 16
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 41.8    1.14   6                             mSSR1  APPACLLACVAKVE
 16.3    0.11   9                           12784.2  EGLVKVNSQVANLE
  9.2    0.28  20                           18670.1  QSDQXQASTPSGGAE
  3.4    0.19                                        APKENTNNRVNNE
  0.3    0.12                                        ILAKHTMSKDQVE
Top scoring peptide matches to query 17
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 18
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 19
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 20
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  5.9   -0.97                                        QIVISNIVDHSTTGE
  4.0   -0.13                                        KRQKELLRKQRE
  2.5    1.18                                        DNFMGMNWAADPIE
Top scoring peptide matches to query 21
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 22
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  3.2    0.11                                        TIKVNRLDYNLNFAE
  0.7    0.11                                        FKNIKNMSSVIVVDSE
Top scoring peptide matches to query 23
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 62.9    0.16   4                             mRBT5  CVKQSTSSTPCPYWD
  1.7   -0.02                                        RYSLTNHKVHILGYD
  0.7   -0.11                                        QQDRKTVKNKKKLSD
  0.3    0.94                                        VKGLQAQIASSGLTVEVD
Top scoring peptide matches to query 24
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 10.5    0.17  17                           11638.2  VTQRALNTLRRVGAVGE
  0.3    0.23                                        GFPFSKTTNLAKSSLLE
Top scoring peptide matches to query 25
Score greater than 19 indicates homology
Score greater than 29 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
111.5    0.15   2                            9023.3  LVNAGSATPSQIKAYVDE
Top scoring peptide matches to query 26
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 85.3    0.17   1                             Glu-C  LAIVKFSPNEQNKHIGE
  3.3   -0.89                                        NAVGYVLHKVDKILVGAE
  1.8    0.32                                        LAYKQCFVASTSTADFD
Top scoring peptide matches to query 27
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  7.5   -0.94                                        EYGSSLLVVLTLGAISLVD
  2.8    0.10                                        FWVHMPLSYALLKITE
  1.6    0.10                                        VHLRCFLSFLDVVLTE
Top scoring peptide matches to query 28
Score greater than 14 indicates homology
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
 20.1    0.18   1                             Glu-C  ATHGDPHALKAFPSAINQD
Top scoring peptide matches to query 29
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 30
Score greater than 28 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 31
Score greater than 26 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 32
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 33
Score greater than 25 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
Top scoring peptide matches to query 34
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide
  0.9    0.05                                        NSTTPNGDWSQSKAFTNSGSSFPALNGTCE
Top scoring peptide matches to query 35
Score greater than 24 indicates identity
Status bar shows all hits for this peptide
 
Score   Delta  Hit                         Protein   Peptide